SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0013
         (698 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X53777-1|CAA37793.1|  184|Homo sapiens protein ( Human L23 mRNA ...    54   4e-07
BC106031-1|AAI06032.1|  184|Homo sapiens ribosomal protein L17 p...    54   4e-07
BC066324-1|AAH66324.1|  184|Homo sapiens ribosomal protein L17 p...    54   4e-07
BC066323-1|AAH66323.1|  184|Homo sapiens ribosomal protein L17 p...    54   4e-07
BC017831-1|AAH17831.1|  184|Homo sapiens ribosomal protein L17 p...    54   4e-07
BC000502-1|AAH00502.1|  184|Homo sapiens ribosomal protein L17 p...    54   4e-07
AB061824-1|BAB79462.1|  184|Homo sapiens ribosomal protein L17 p...    54   4e-07
AF414442-1|AAL65133.2|22152|Homo sapiens ovarian cancer related ...    30   6.9  
BC024254-1|AAH24254.1|  476|Homo sapiens abl-interactor 1 protein.     30   9.1  
AL390961-6|CAI17278.1|  452|Homo sapiens spectrin SH3 domain bin...    30   9.1  
AL390961-5|CAI17276.1|  481|Homo sapiens spectrin SH3 domain bin...    30   9.1  
AL390961-4|CAI17274.1|  476|Homo sapiens spectrin SH3 domain bin...    30   9.1  
AL139404-6|CAH73116.1|  452|Homo sapiens spectrin SH3 domain bin...    30   9.1  
AL139404-5|CAH73113.1|  481|Homo sapiens spectrin SH3 domain bin...    30   9.1  
AL139404-4|CAH73115.1|  476|Homo sapiens spectrin SH3 domain bin...    30   9.1  
AF540955-1|AAN28379.1|  476|Homo sapiens Abl-interactor 1 protein.     30   9.1  
AB040151-1|BAB55675.1|  452|Homo sapiens hNap1 Binding Protein p...    30   9.1  

>X53777-1|CAA37793.1|  184|Homo sapiens protein ( Human L23 mRNA for
           putative ribosomal protein. ).
          Length = 184

 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 24/33 (72%), Positives = 27/33 (81%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMPLR 607
           NP KSCK+RGSNLRVHFKN  ETA AI+ M +R
Sbjct: 10  NPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIR 42



 Score = 33.1 bits (72), Expect = 0.98
 Identities = 13/26 (50%), Positives = 20/26 (76%)
 Frame = +1

Query: 619 RYLKNVIDKKECIPFRRFXXRALGRC 696
           +YLK+V  +K+C+PFRR+    +GRC
Sbjct: 46  KYLKDVTLQKQCVPFRRYNG-GVGRC 70


>BC106031-1|AAI06032.1|  184|Homo sapiens ribosomal protein L17
           protein.
          Length = 184

 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 24/33 (72%), Positives = 27/33 (81%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMPLR 607
           NP KSCK+RGSNLRVHFKN  ETA AI+ M +R
Sbjct: 10  NPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIR 42



 Score = 33.1 bits (72), Expect = 0.98
 Identities = 13/26 (50%), Positives = 20/26 (76%)
 Frame = +1

Query: 619 RYLKNVIDKKECIPFRRFXXRALGRC 696
           +YLK+V  +K+C+PFRR+    +GRC
Sbjct: 46  KYLKDVTLQKQCVPFRRYNG-GVGRC 70


>BC066324-1|AAH66324.1|  184|Homo sapiens ribosomal protein L17
           protein.
          Length = 184

 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 24/33 (72%), Positives = 27/33 (81%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMPLR 607
           NP KSCK+RGSNLRVHFKN  ETA AI+ M +R
Sbjct: 10  NPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIR 42



 Score = 33.1 bits (72), Expect = 0.98
 Identities = 13/26 (50%), Positives = 20/26 (76%)
 Frame = +1

Query: 619 RYLKNVIDKKECIPFRRFXXRALGRC 696
           +YLK+V  +K+C+PFRR+    +GRC
Sbjct: 46  KYLKDVTLQKQCVPFRRYNG-GVGRC 70


>BC066323-1|AAH66323.1|  184|Homo sapiens ribosomal protein L17
           protein.
          Length = 184

 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 24/33 (72%), Positives = 27/33 (81%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMPLR 607
           NP KSCK+RGSNLRVHFKN  ETA AI+ M +R
Sbjct: 10  NPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIR 42



 Score = 33.1 bits (72), Expect = 0.98
 Identities = 13/26 (50%), Positives = 20/26 (76%)
 Frame = +1

Query: 619 RYLKNVIDKKECIPFRRFXXRALGRC 696
           +YLK+V  +K+C+PFRR+    +GRC
Sbjct: 46  KYLKDVTLQKQCVPFRRYNG-GVGRC 70


>BC017831-1|AAH17831.1|  184|Homo sapiens ribosomal protein L17
           protein.
          Length = 184

 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 24/33 (72%), Positives = 27/33 (81%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMPLR 607
           NP KSCK+RGSNLRVHFKN  ETA AI+ M +R
Sbjct: 10  NPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIR 42



 Score = 33.1 bits (72), Expect = 0.98
 Identities = 13/26 (50%), Positives = 20/26 (76%)
 Frame = +1

Query: 619 RYLKNVIDKKECIPFRRFXXRALGRC 696
           +YLK+V  +K+C+PFRR+    +GRC
Sbjct: 46  KYLKDVTLQKQCVPFRRYNG-GVGRC 70


>BC000502-1|AAH00502.1|  184|Homo sapiens ribosomal protein L17
           protein.
          Length = 184

 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 24/33 (72%), Positives = 27/33 (81%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMPLR 607
           NP KSCK+RGSNLRVHFKN  ETA AI+ M +R
Sbjct: 10  NPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIR 42



 Score = 33.1 bits (72), Expect = 0.98
 Identities = 13/26 (50%), Positives = 20/26 (76%)
 Frame = +1

Query: 619 RYLKNVIDKKECIPFRRFXXRALGRC 696
           +YLK+V  +K+C+PFRR+    +GRC
Sbjct: 46  KYLKDVTLQKQCVPFRRYNG-GVGRC 70


>AB061824-1|BAB79462.1|  184|Homo sapiens ribosomal protein L17
           protein.
          Length = 184

 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 24/33 (72%), Positives = 27/33 (81%)
 Frame = +2

Query: 509 NPAKSCKARGSNLRVHFKNXYETAMAIRKMPLR 607
           NP KSCK+RGSNLRVHFKN  ETA AI+ M +R
Sbjct: 10  NPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIR 42



 Score = 33.1 bits (72), Expect = 0.98
 Identities = 13/26 (50%), Positives = 20/26 (76%)
 Frame = +1

Query: 619 RYLKNVIDKKECIPFRRFXXRALGRC 696
           +YLK+V  +K+C+PFRR+    +GRC
Sbjct: 46  KYLKDVTLQKQCVPFRRYNG-GVGRC 70


>AF414442-1|AAL65133.2|22152|Homo sapiens ovarian cancer related tumor
            marker CA125 protein.
          Length = 22152

 Score = 30.3 bits (65), Expect = 6.9
 Identities = 18/46 (39%), Positives = 23/46 (50%)
 Frame = -2

Query: 322  STSILVRGASLGNGDSVTSNAHRVLIWVWRLTDHLTTASNGSDSSS 185
            STS     ASL + DS  S  + +  W+W LT  L T +  S S S
Sbjct: 2025 STSSPYSSASLESLDSTISRRNAITSWLWDLTTSLPTTTWPSTSLS 2070


>BC024254-1|AAH24254.1|  476|Homo sapiens abl-interactor 1 protein.
          Length = 476

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 30/116 (25%), Positives = 45/116 (38%)
 Frame = -2

Query: 451 RTASYNIKRPVADISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDSV 272
           R   Y    PV   +  PN     P  L     P R A LN R  +    G+S G+G   
Sbjct: 189 RNTPYKTLEPVKPPTV-PNDYMTSPARLGSQHSPGRTASLNQRPRTH--SGSSGGSGSRE 245

Query: 271 TSNAHRVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGG 104
            S +  + I +   T    T    +  S+ G++Y T  R   R ++    +  +GG
Sbjct: 246 NSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSGG 300


>AL390961-6|CAI17278.1|  452|Homo sapiens spectrin SH3 domain
           binding protein 1 protein.
          Length = 452

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 30/116 (25%), Positives = 45/116 (38%)
 Frame = -2

Query: 451 RTASYNIKRPVADISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDSV 272
           R   Y    PV   +  PN     P  L     P R A LN R  +    G+S G+G   
Sbjct: 194 RNTPYKTLEPVKPPTV-PNDYMTSPARLGSQHSPGRTASLNQRPRTH--SGSSGGSGSRE 250

Query: 271 TSNAHRVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGG 104
            S +  + I +   T    T    +  S+ G++Y T  R   R ++    +  +GG
Sbjct: 251 NSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSGG 305


>AL390961-5|CAI17276.1|  481|Homo sapiens spectrin SH3 domain
           binding protein 1 protein.
          Length = 481

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 30/116 (25%), Positives = 45/116 (38%)
 Frame = -2

Query: 451 RTASYNIKRPVADISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDSV 272
           R   Y    PV   +  PN     P  L     P R A LN R  +    G+S G+G   
Sbjct: 194 RNTPYKTLEPVKPPTV-PNDYMTSPARLGSQHSPGRTASLNQRPRTH--SGSSGGSGSRE 250

Query: 271 TSNAHRVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGG 104
            S +  + I +   T    T    +  S+ G++Y T  R   R ++    +  +GG
Sbjct: 251 NSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSGG 305


>AL390961-4|CAI17274.1|  476|Homo sapiens spectrin SH3 domain
           binding protein 1 protein.
          Length = 476

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 30/116 (25%), Positives = 45/116 (38%)
 Frame = -2

Query: 451 RTASYNIKRPVADISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDSV 272
           R   Y    PV   +  PN     P  L     P R A LN R  +    G+S G+G   
Sbjct: 189 RNTPYKTLEPVKPPTV-PNDYMTSPARLGSQHSPGRTASLNQRPRTH--SGSSGGSGSRE 245

Query: 271 TSNAHRVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGG 104
            S +  + I +   T    T    +  S+ G++Y T  R   R ++    +  +GG
Sbjct: 246 NSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSGG 300


>AL139404-6|CAH73116.1|  452|Homo sapiens spectrin SH3 domain
           binding protein 1 protein.
          Length = 452

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 30/116 (25%), Positives = 45/116 (38%)
 Frame = -2

Query: 451 RTASYNIKRPVADISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDSV 272
           R   Y    PV   +  PN     P  L     P R A LN R  +    G+S G+G   
Sbjct: 194 RNTPYKTLEPVKPPTV-PNDYMTSPARLGSQHSPGRTASLNQRPRTH--SGSSGGSGSRE 250

Query: 271 TSNAHRVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGG 104
            S +  + I +   T    T    +  S+ G++Y T  R   R ++    +  +GG
Sbjct: 251 NSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSGG 305


>AL139404-5|CAH73113.1|  481|Homo sapiens spectrin SH3 domain
           binding protein 1 protein.
          Length = 481

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 30/116 (25%), Positives = 45/116 (38%)
 Frame = -2

Query: 451 RTASYNIKRPVADISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDSV 272
           R   Y    PV   +  PN     P  L     P R A LN R  +    G+S G+G   
Sbjct: 194 RNTPYKTLEPVKPPTV-PNDYMTSPARLGSQHSPGRTASLNQRPRTH--SGSSGGSGSRE 250

Query: 271 TSNAHRVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGG 104
            S +  + I +   T    T    +  S+ G++Y T  R   R ++    +  +GG
Sbjct: 251 NSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSGG 305


>AL139404-4|CAH73115.1|  476|Homo sapiens spectrin SH3 domain
           binding protein 1 protein.
          Length = 476

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 30/116 (25%), Positives = 45/116 (38%)
 Frame = -2

Query: 451 RTASYNIKRPVADISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDSV 272
           R   Y    PV   +  PN     P  L     P R A LN R  +    G+S G+G   
Sbjct: 189 RNTPYKTLEPVKPPTV-PNDYMTSPARLGSQHSPGRTASLNQRPRTH--SGSSGGSGSRE 245

Query: 271 TSNAHRVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGG 104
            S +  + I +   T    T    +  S+ G++Y T  R   R ++    +  +GG
Sbjct: 246 NSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSGG 300


>AF540955-1|AAN28379.1|  476|Homo sapiens Abl-interactor 1 protein.
          Length = 476

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 30/116 (25%), Positives = 45/116 (38%)
 Frame = -2

Query: 451 RTASYNIKRPVADISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDSV 272
           R   Y    PV   +  PN     P  L     P R A LN R  +    G+S G+G   
Sbjct: 189 RNTPYKTLEPVKPPTV-PNDYMTSPARLGSQHSPGRTASLNQRPRTH--SGSSGGSGSRE 245

Query: 271 TSNAHRVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGG 104
            S +  + I +   T    T    +  S+ G++Y T  R   R ++    +  +GG
Sbjct: 246 NSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSGG 300


>AB040151-1|BAB55675.1|  452|Homo sapiens hNap1 Binding Protein
           protein.
          Length = 452

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 30/116 (25%), Positives = 45/116 (38%)
 Frame = -2

Query: 451 RTASYNIKRPVADISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDSV 272
           R   Y    PV   +  PN     P  L     P R A LN R  +    G+S G+G   
Sbjct: 194 RNTPYKTLEPVKPPTV-PNDYMTSPARLGSQHSPGRTASLNQRPRTH--SGSSGGSGSRE 250

Query: 271 TSNAHRVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGG 104
            S +  + I +   T    T    +  S+ G++Y T  R   R ++    +  +GG
Sbjct: 251 NSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSGG 305


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 98,796,258
Number of Sequences: 237096
Number of extensions: 1911227
Number of successful extensions: 6189
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 5967
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6176
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8063224416
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).