SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0010
         (598 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z99758-1|CAI22851.1|  376|Homo sapiens non-metastatic cells 7, p...    60   4e-09
BC006983-1|AAH06983.1|  376|Homo sapiens non-metastatic cells 7,...    60   4e-09
AL356852-1|CAI19238.1|  376|Homo sapiens non-metastatic cells 7,...    60   4e-09
AL031726-1|CAI18887.1|  376|Homo sapiens non-metastatic cells 7,...    60   4e-09
AF153191-1|AAD34622.1|  376|Homo sapiens nm23-H7 protein.              60   4e-09
AB209049-1|BAD92286.1|  283|Homo sapiens nucleoside-diphosphate ...    60   4e-09

>Z99758-1|CAI22851.1|  376|Homo sapiens non-metastatic cells 7,
           protein expressed in (nucleoside-diphosphate kinase)
           protein.
          Length = 376

 Score = 60.5 bits (140), Expect = 4e-09
 Identities = 30/79 (37%), Positives = 47/79 (59%)
 Frame = +3

Query: 255 DKYSFXCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGN 434
           +++ F  E YD +A  ++   L ++P D SV++ D K  +  LKR +   L+L+ L IGN
Sbjct: 5   ERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGN 64

Query: 435 IVNIFSKLLYIQDCGSCYT 491
            VN+FS+ L + D G  YT
Sbjct: 65  KVNVFSRQLVLIDYGDQYT 83


>BC006983-1|AAH06983.1|  376|Homo sapiens non-metastatic cells 7,
           protein expressed in (nucleoside-diphosphate kinase)
           protein.
          Length = 376

 Score = 60.5 bits (140), Expect = 4e-09
 Identities = 30/79 (37%), Positives = 47/79 (59%)
 Frame = +3

Query: 255 DKYSFXCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGN 434
           +++ F  E YD +A  ++   L ++P D SV++ D K  +  LKR +   L+L+ L IGN
Sbjct: 5   ERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGN 64

Query: 435 IVNIFSKLLYIQDCGSCYT 491
            VN+FS+ L + D G  YT
Sbjct: 65  KVNVFSRQLVLIDYGDQYT 83


>AL356852-1|CAI19238.1|  376|Homo sapiens non-metastatic cells 7,
           protein expressed in (nucleoside-diphosphate kinase)
           protein.
          Length = 376

 Score = 60.5 bits (140), Expect = 4e-09
 Identities = 30/79 (37%), Positives = 47/79 (59%)
 Frame = +3

Query: 255 DKYSFXCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGN 434
           +++ F  E YD +A  ++   L ++P D SV++ D K  +  LKR +   L+L+ L IGN
Sbjct: 5   ERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGN 64

Query: 435 IVNIFSKLLYIQDCGSCYT 491
            VN+FS+ L + D G  YT
Sbjct: 65  KVNVFSRQLVLIDYGDQYT 83


>AL031726-1|CAI18887.1|  376|Homo sapiens non-metastatic cells 7,
           protein expressed in (nucleoside-diphosphate kinase)
           protein.
          Length = 376

 Score = 60.5 bits (140), Expect = 4e-09
 Identities = 30/79 (37%), Positives = 47/79 (59%)
 Frame = +3

Query: 255 DKYSFXCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGN 434
           +++ F  E YD +A  ++   L ++P D SV++ D K  +  LKR +   L+L+ L IGN
Sbjct: 5   ERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGN 64

Query: 435 IVNIFSKLLYIQDCGSCYT 491
            VN+FS+ L + D G  YT
Sbjct: 65  KVNVFSRQLVLIDYGDQYT 83


>AF153191-1|AAD34622.1|  376|Homo sapiens nm23-H7 protein.
          Length = 376

 Score = 60.5 bits (140), Expect = 4e-09
 Identities = 30/79 (37%), Positives = 47/79 (59%)
 Frame = +3

Query: 255 DKYSFXCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGN 434
           +++ F  E YD +A  ++   L ++P D SV++ D K  +  LKR +   L+L+ L IGN
Sbjct: 5   ERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGN 64

Query: 435 IVNIFSKLLYIQDCGSCYT 491
            VN+FS+ L + D G  YT
Sbjct: 65  KVNVFSRQLVLIDYGDQYT 83


>AB209049-1|BAD92286.1|  283|Homo sapiens nucleoside-diphosphate
           kinase 7 isoform a variant protein.
          Length = 283

 Score = 60.5 bits (140), Expect = 4e-09
 Identities = 30/79 (37%), Positives = 47/79 (59%)
 Frame = +3

Query: 255 DKYSFXCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGN 434
           +++ F  E YD +A  ++   L ++P D SV++ D K  +  LKR +   L+L+ L IGN
Sbjct: 9   ERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGN 68

Query: 435 IVNIFSKLLYIQDCGSCYT 491
            VN+FS+ L + D G  YT
Sbjct: 69  KVNVFSRQLVLIDYGDQYT 87


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 77,773,252
Number of Sequences: 237096
Number of extensions: 1377259
Number of successful extensions: 2415
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 2396
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2415
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 6324506272
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).