SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0006
         (698 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC046098-1|AAH46098.1|  450|Homo sapiens CBF1 interacting corepr...    30   9.1  
BC038987-1|AAH38987.1|  289|Homo sapiens Similar to RIKEN cDNA 1...    30   9.1  
BC031018-1|AAH31018.1|  426|Homo sapiens CIR protein protein.          30   9.1  
BC021175-1|AAH21175.1|  227|Homo sapiens CIR protein protein.          30   9.1  
AY894575-1|AAX85114.1| 1214|Homo sapiens NBPF1 protein.                30   9.1  
AF379626-1|AAO15394.1|  502|Homo sapiens AC3 protein.                  30   9.1  
AF379622-1|AAO15391.1|  358|Homo sapiens AB18 protein.                 30   9.1  
AF098297-1|AAD05243.1|  450|Homo sapiens CBF1 interacting corepr...    30   9.1  
AC018470-1|AAY24216.1|  450|Homo sapiens unknown protein.              30   9.1  

>BC046098-1|AAH46098.1|  450|Homo sapiens CBF1 interacting
           corepressor protein.
          Length = 450

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 14/69 (20%), Positives = 34/69 (49%)
 Frame = +2

Query: 368 VHTMSLPRASAPPGLRPNEIIDQFHVTNFNVRLEIESEXLTGELKAGKQVPYLT*REPSI 547
           ++  S+P   + P + P+E+I +   + F ++  +    LT    + + V      +P +
Sbjct: 151 INASSVPTDGSGPSMHPSELIAEMRNSGFALKRNVLGRNLTANDPSQEYVASEGEEDPEV 210

Query: 548 DSLKATSTE 574
           + LK+ +T+
Sbjct: 211 EFLKSLTTK 219


>BC038987-1|AAH38987.1|  289|Homo sapiens Similar to RIKEN cDNA
           1700023B02 gene protein.
          Length = 289

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 14/69 (20%), Positives = 34/69 (49%)
 Frame = +2

Query: 368 VHTMSLPRASAPPGLRPNEIIDQFHVTNFNVRLEIESEXLTGELKAGKQVPYLT*REPSI 547
           ++  S+P   + P + P+E+I +   + F ++  +    LT    + + V      +P +
Sbjct: 151 INASSVPTDGSGPSMHPSELIAEMRNSGFALKRNVLGRNLTANDPSQEYVASEGEEDPEV 210

Query: 548 DSLKATSTE 574
           + LK+ +T+
Sbjct: 211 EFLKSLTTK 219


>BC031018-1|AAH31018.1|  426|Homo sapiens CIR protein protein.
          Length = 426

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 14/69 (20%), Positives = 34/69 (49%)
 Frame = +2

Query: 368 VHTMSLPRASAPPGLRPNEIIDQFHVTNFNVRLEIESEXLTGELKAGKQVPYLT*REPSI 547
           ++  S+P   + P + P+E+I +   + F ++  +    LT    + + V      +P +
Sbjct: 151 INASSVPTDGSGPSMHPSELIAEMRNSGFALKRNVLGRNLTANDPSQEYVASEGEEDPEV 210

Query: 548 DSLKATSTE 574
           + LK+ +T+
Sbjct: 211 EFLKSLTTK 219


>BC021175-1|AAH21175.1|  227|Homo sapiens CIR protein protein.
          Length = 227

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 14/69 (20%), Positives = 34/69 (49%)
 Frame = +2

Query: 368 VHTMSLPRASAPPGLRPNEIIDQFHVTNFNVRLEIESEXLTGELKAGKQVPYLT*REPSI 547
           ++  S+P   + P + P+E+I +   + F ++  +    LT    + + V      +P +
Sbjct: 151 INASSVPTDGSGPSMHPSELIAEMRNSGFALKRNVLGRNLTANDPSQEYVASEGEEDPEV 210

Query: 548 DSLKATSTE 574
           + LK+ +T+
Sbjct: 211 EFLKSLTTK 219


>AY894575-1|AAX85114.1| 1214|Homo sapiens NBPF1 protein.
          Length = 1214

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = -2

Query: 397  RSSGQRHRVDPVSVLEDSVDQLRLPVDVRFDVLDHYTHYR 278
            R SG    V+   VL+DS+D+      + F++ D + HYR
Sbjct: 1134 RLSGMLMEVEEPEVLQDSLDRCYSTPSMYFELPDSFQHYR 1173


>AF379626-1|AAO15394.1|  502|Homo sapiens AC3 protein.
          Length = 502

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = -2

Query: 397 RSSGQRHRVDPVSVLEDSVDQLRLPVDVRFDVLDHYTHYR 278
           R SG    V+   VL+DS+D+      + F++ D + HYR
Sbjct: 422 RLSGMLMEVEEPEVLQDSLDRCYSTPSMYFELPDSFQHYR 461


>AF379622-1|AAO15391.1|  358|Homo sapiens AB18 protein.
          Length = 358

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = -2

Query: 397 RSSGQRHRVDPVSVLEDSVDQLRLPVDVRFDVLDHYTHYR 278
           R SG    V+   VL+DS+D+      + F++ D + HYR
Sbjct: 278 RLSGMLMEVEEPEVLQDSLDRCYSTPSMYFELPDSFQHYR 317


>AF098297-1|AAD05243.1|  450|Homo sapiens CBF1 interacting
           corepressor CIR protein.
          Length = 450

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 14/69 (20%), Positives = 34/69 (49%)
 Frame = +2

Query: 368 VHTMSLPRASAPPGLRPNEIIDQFHVTNFNVRLEIESEXLTGELKAGKQVPYLT*REPSI 547
           ++  S+P   + P + P+E+I +   + F ++  +    LT    + + V      +P +
Sbjct: 151 INASSVPTDGSGPSMHPSELIAEMRNSGFALKRNVLGRNLTANDPSQEYVASEGEEDPEV 210

Query: 548 DSLKATSTE 574
           + LK+ +T+
Sbjct: 211 EFLKSLTTK 219


>AC018470-1|AAY24216.1|  450|Homo sapiens unknown protein.
          Length = 450

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 14/69 (20%), Positives = 34/69 (49%)
 Frame = +2

Query: 368 VHTMSLPRASAPPGLRPNEIIDQFHVTNFNVRLEIESEXLTGELKAGKQVPYLT*REPSI 547
           ++  S+P   + P + P+E+I +   + F ++  +    LT    + + V      +P +
Sbjct: 151 INASSVPTDGSGPSMHPSELIAEMRNSGFALKRNVLGRNLTANDPSQEYVASEGEEDPEV 210

Query: 548 DSLKATSTE 574
           + LK+ +T+
Sbjct: 211 EFLKSLTTK 219


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 90,237,417
Number of Sequences: 237096
Number of extensions: 1628054
Number of successful extensions: 4229
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 4146
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4229
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8063224416
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).