SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0005
         (698 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X99404-1|CAA67781.1|  338|Homo sapiens Berg36 protein.                107   3e-23
X79066-1|CAA55670.1|  338|Homo sapiens ERF-1 protein.                 107   3e-23
BT019468-1|AAV38275.1|  338|Homo sapiens zinc finger protein 36,...   107   3e-23
BC018340-1|AAH18340.1|  338|Homo sapiens zinc finger protein 36,...   107   3e-23
X78992-1|CAA55592.1|  492|Homo sapiens ERF-2 protein.                 105   2e-22
U07802-1|AAA91778.1|  482|Homo sapiens Tis11d protein.                105   2e-22
BC005010-1|AAH05010.1|  497|Homo sapiens ZFP36L2 protein protein.     105   2e-22
AC010883-1|AAY14992.1|  494|Homo sapiens unknown protein.             105   2e-22
M92844-1|AAC37600.1|  326|Homo sapiens zinc finger transcription...    82   2e-15
M92843-1|AAA58489.1|  326|Homo sapiens zinc finger transcription...    82   2e-15
M63625-1|AAA61240.1|  326|Homo sapiens tristetraproline protein.       82   2e-15
BC009693-1|AAH09693.1|  326|Homo sapiens zinc finger protein 36,...    82   2e-15
AY771351-1|AAV28731.1|  326|Homo sapiens zinc finger protein 36,...    82   2e-15
BC044642-1|AAH44642.1|  506|Homo sapiens RC3H2 protein protein.        41   0.004
AL359512-9|CAI94965.1|  935|Homo sapiens ring finger and CCCH-ty...    41   0.004
AL359512-8|CAI94964.1| 1191|Homo sapiens ring finger and CCCH-ty...    41   0.004
AL136170-3|CAI19419.1| 1086|Homo sapiens ring finger and CCCH-ty...    41   0.004
AL136170-2|CAI19417.1| 1094|Homo sapiens ring finger and CCCH-ty...    41   0.004
AL136170-1|CAI19418.1| 1133|Homo sapiens ring finger and CCCH-ty...    41   0.004
AL121983-3|CAH70710.1| 1086|Homo sapiens ring finger and CCCH-ty...    41   0.004
AL121983-2|CAH70709.1| 1094|Homo sapiens ring finger and CCCH-ty...    41   0.004
AL121983-1|CAI12318.1| 1133|Homo sapiens ring finger and CCCH-ty...    41   0.004
AK000308-1|BAA91073.1|  869|Homo sapiens protein ( Homo sapiens ...    41   0.004
AF255303-1|AAG00432.1| 1048|Homo sapiens membrane-associated nuc...    41   0.004
AB095945-1|BAC23121.1| 1109|Homo sapiens KIAA2025 protein protein.     41   0.004
AL032819-1|CAM26345.1|  332|Homo sapiens unkempt-like (Drosophil...    40   0.011
AL031721-3|CAM26440.1|  332|Homo sapiens unkempt-like (Drosophil...    40   0.011
BC053362-1|AAH53362.1|  818|Homo sapiens UNK protein protein.          36   0.14 
AB051540-1|BAB21844.1|  818|Homo sapiens KIAA1753 protein protein.     36   0.14 
AE006467-5|AAK61279.1|  756|Homo sapiens Ce protein similar to D...    35   0.32 
X98253-1|CAA66907.1|  343|Homo sapiens ZNF183 protein.                 34   0.56 
BT007175-1|AAP35839.1|  343|Homo sapiens zinc finger protein 183...    34   0.56 
BC025388-1|AAH25388.1|  322|Homo sapiens ring finger protein 113...    34   0.56 
BC020556-1|AAH20556.1|  343|Homo sapiens ring finger protein 113...    34   0.56 
BC017585-1|AAH17585.1|  322|Homo sapiens ring finger protein 113...    34   0.56 
BC000832-1|AAH00832.1|  343|Homo sapiens ring finger protein 113...    34   0.56 
AL136300-1|CAC42525.2|  322|Homo sapiens ring finger protein 113...    34   0.56 
AF539427-1|AAN33063.1|  322|Homo sapiens zinc finger protein ZNF...    34   0.56 
AC002477-1|AAB67605.1|  343|Homo sapiens zinc-finger protein pro...    34   0.56 
CR457320-1|CAG33601.1|  510|Homo sapiens TOE1 protein.                 33   0.74 
BC009364-1|AAH09364.1|  510|Homo sapiens target of EGR1, member ...    33   0.74 
AY169960-1|AAN75441.1|  510|Homo sapiens target of Egr1 protein ...    33   0.74 
AL359540-11|CAI21722.1|  510|Homo sapiens target of EGR1, member...    33   0.74 
AK024011-1|BAB14774.1|  510|Homo sapiens protein ( Homo sapiens ...    33   0.74 
U79569-1|AAD00321.1|  269|Homo sapiens no arches protein.              33   1.3  
EF191081-1|ABN05292.1|  269|Homo sapiens cleavage and polyadenyl...    33   1.3  
CR542161-1|CAG46958.1|  269|Homo sapiens CPSF4 protein.                33   1.3  
BC050738-1|AAH50738.1|  243|Homo sapiens CPSF4 protein protein.        33   1.3  
BC003101-1|AAH03101.1|  244|Homo sapiens cleavage and polyadenyl...    33   1.3  
BC009973-1|AAH09973.1|  650|Homo sapiens dihydrouridine synthase...    32   2.3  
BC008362-1|AAH08362.1|  613|Homo sapiens DUS3L protein protein.        32   2.3  
AL365411-1|CAB96955.1|  465|Homo sapiens hypothetical protein, s...    32   2.3  
AK023958-1|BAB14740.1|  650|Homo sapiens protein ( Homo sapiens ...    32   2.3  
BC033786-1|AAH33786.2|  465|Homo sapiens ring finger protein 38 ...    30   6.9  
AL354935-3|CAO03541.1|  465|Homo sapiens ring finger protein 38 ...    30   6.9  
AL354935-2|CAO03540.1|  515|Homo sapiens ring finger protein 38 ...    30   6.9  
AL354935-1|CAH70194.1|  439|Homo sapiens ring finger protein 38 ...    30   6.9  
AL161792-4|CAO03554.1|  465|Homo sapiens ring finger protein 38 ...    30   6.9  
AL161792-3|CAO03553.1|  515|Homo sapiens ring finger protein 38 ...    30   6.9  
AL161792-1|CAI16895.1|  439|Homo sapiens ring finger protein 38 ...    30   6.9  
AK024996-1|BAB15050.1|  332|Homo sapiens protein ( Homo sapiens ...    30   6.9  
AF394047-1|AAM73697.1|  432|Homo sapiens RING finger protein 38 ...    30   6.9  
AB002358-1|BAA21638.2| 1019|Homo sapiens KIAA0360 protein.             30   6.9  
D63484-1|BAA09771.1|  944|Homo sapiens KIAA0150 protein.               30   9.1  
D29677-1|BAA06147.2| 1943|Homo sapiens KIAA0054 protein.               30   9.1  
BC130582-1|AAI30583.1| 1942|Homo sapiens helicase with zinc fing...    30   9.1  
BC094881-1|AAH94881.1| 1163|Homo sapiens HELZ protein protein.         30   9.1  
BC056895-1|AAH56895.1|  454|Homo sapiens HELZ protein protein.         30   9.1  
BC038670-1|AAH38670.1|  948|Homo sapiens zinc finger CCCH-type c...    30   9.1  
BC034435-1|AAH34435.1|  335|Homo sapiens ZC3H3 protein protein.        30   9.1  
BC001974-1|AAH01974.1|  498|Homo sapiens Unknown (protein for IM...    30   9.1  

>X99404-1|CAA67781.1|  338|Homo sapiens Berg36 protein.
          Length = 338

 Score =  107 bits (258), Expect = 3e-23
 Identities = 41/49 (83%), Positives = 46/49 (93%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           CQFAHG+ ELR+L RHPKYKTELCRTFH++GFCPYGPRCHF+HNAEE R
Sbjct: 135 CQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERR 183



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 29/74 (39%), Positives = 32/74 (43%)
 Frame = +2

Query: 32  NSVSSGLSWEQHPVLSRASSVPAHRALAGLLDRLGHRRLXXXXXXXXXXXXXXXXYKTEL 211
           N + S L  E  P LS   S    R+ +      G  RL                YKTEL
Sbjct: 65  NQLLSSLKGEPAPALSSRDSRFRDRSFSE-----GGERLLPTQKQPGGGQVNSSRYKTEL 119

Query: 212 CRPFEEAGVCKYGD 253
           CRPFEE G CKYGD
Sbjct: 120 CRPFEENGACKYGD 133



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 17/32 (53%), Positives = 19/32 (59%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR F   G C YG +C F H   E R
Sbjct: 114 RYKTELCRPFEENGACKYGDKCQFAHGIHELR 145



 Score = 32.7 bits (71), Expect = 1.3
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKTELCR F   G C YG   + +
Sbjct: 153 YKTELCRTFHTIGFCPYGPRCHFI 176


>X79066-1|CAA55670.1|  338|Homo sapiens ERF-1 protein.
          Length = 338

 Score =  107 bits (258), Expect = 3e-23
 Identities = 41/49 (83%), Positives = 46/49 (93%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           CQFAHG+ ELR+L RHPKYKTELCRTFH++GFCPYGPRCHF+HNAEE R
Sbjct: 135 CQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERR 183



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 29/74 (39%), Positives = 32/74 (43%)
 Frame = +2

Query: 32  NSVSSGLSWEQHPVLSRASSVPAHRALAGLLDRLGHRRLXXXXXXXXXXXXXXXXYKTEL 211
           N + S L  E  P LS   S    R+ +      G  RL                YKTEL
Sbjct: 65  NQLLSSLKGEPAPALSSRDSRFRDRSFSE-----GGERLLPTQKQPGGGQVNSSRYKTEL 119

Query: 212 CRPFEEAGVCKYGD 253
           CRPFEE G CKYGD
Sbjct: 120 CRPFEENGACKYGD 133



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 17/32 (53%), Positives = 19/32 (59%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR F   G C YG +C F H   E R
Sbjct: 114 RYKTELCRPFEENGACKYGDKCQFAHGIHELR 145



 Score = 32.7 bits (71), Expect = 1.3
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKTELCR F   G C YG   + +
Sbjct: 153 YKTELCRTFHTIGFCPYGPRCHFI 176


>BT019468-1|AAV38275.1|  338|Homo sapiens zinc finger protein 36,
           C3H type-like 1 protein.
          Length = 338

 Score =  107 bits (258), Expect = 3e-23
 Identities = 41/49 (83%), Positives = 46/49 (93%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           CQFAHG+ ELR+L RHPKYKTELCRTFH++GFCPYGPRCHF+HNAEE R
Sbjct: 135 CQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERR 183



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 29/74 (39%), Positives = 32/74 (43%)
 Frame = +2

Query: 32  NSVSSGLSWEQHPVLSRASSVPAHRALAGLLDRLGHRRLXXXXXXXXXXXXXXXXYKTEL 211
           N + S L  E  P LS   S    R+ +      G  RL                YKTEL
Sbjct: 65  NQLLSSLKGEPAPALSSRDSRFRDRSFSE-----GGERLLPTQKQPGGGQVNSSRYKTEL 119

Query: 212 CRPFEEAGVCKYGD 253
           CRPFEE G CKYGD
Sbjct: 120 CRPFEENGACKYGD 133



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 17/32 (53%), Positives = 19/32 (59%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR F   G C YG +C F H   E R
Sbjct: 114 RYKTELCRPFEENGACKYGDKCQFAHGIHELR 145



 Score = 32.7 bits (71), Expect = 1.3
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKTELCR F   G C YG   + +
Sbjct: 153 YKTELCRTFHTIGFCPYGPRCHFI 176


>BC018340-1|AAH18340.1|  338|Homo sapiens zinc finger protein 36,
           C3H type-like 1 protein.
          Length = 338

 Score =  107 bits (258), Expect = 3e-23
 Identities = 41/49 (83%), Positives = 46/49 (93%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           CQFAHG+ ELR+L RHPKYKTELCRTFH++GFCPYGPRCHF+HNAEE R
Sbjct: 135 CQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERR 183



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 29/74 (39%), Positives = 32/74 (43%)
 Frame = +2

Query: 32  NSVSSGLSWEQHPVLSRASSVPAHRALAGLLDRLGHRRLXXXXXXXXXXXXXXXXYKTEL 211
           N + S L  E  P LS   S    R+ +      G  RL                YKTEL
Sbjct: 65  NQLLSSLKGEPAPALSSRDSRFRDRSFSE-----GGERLLPTQKQPGGGQVNSSRYKTEL 119

Query: 212 CRPFEEAGVCKYGD 253
           CRPFEE G CKYGD
Sbjct: 120 CRPFEENGACKYGD 133



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 17/32 (53%), Positives = 19/32 (59%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR F   G C YG +C F H   E R
Sbjct: 114 RYKTELCRPFEENGACKYGDKCQFAHGIHELR 145



 Score = 32.7 bits (71), Expect = 1.3
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKTELCR F   G C YG   + +
Sbjct: 153 YKTELCRTFHTIGFCPYGPRCHFI 176


>X78992-1|CAA55592.1|  492|Homo sapiens ERF-2 protein.
          Length = 492

 Score =  105 bits (251), Expect = 2e-22
 Identities = 40/49 (81%), Positives = 45/49 (91%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           CQFAHG  ELR+L RHPKYKTELCRTFH++GFCPYGPRCHF+HNA+E R
Sbjct: 174 CQFAHGFHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNADERR 222



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 17/32 (53%), Positives = 19/32 (59%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR F   G C YG +C F H   E R
Sbjct: 153 RYKTELCRPFEESGTCKYGEKCQFAHGFHELR 184



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 16/19 (84%), Positives = 18/19 (94%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGD 253
           YKTELCRPFEE+G CKYG+
Sbjct: 154 YKTELCRPFEESGTCKYGE 172



 Score = 32.7 bits (71), Expect = 1.3
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKTELCR F   G C YG   + +
Sbjct: 192 YKTELCRTFHTIGFCPYGPRCHFI 215


>U07802-1|AAA91778.1|  482|Homo sapiens Tis11d protein.
          Length = 482

 Score =  105 bits (251), Expect = 2e-22
 Identities = 40/49 (81%), Positives = 45/49 (91%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           CQFAHG  ELR+L RHPKYKTELCRTFH++GFCPYGPRCHF+HNA+E R
Sbjct: 174 CQFAHGFHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNADERR 222



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 17/32 (53%), Positives = 19/32 (59%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR F   G C YG +C F H   E R
Sbjct: 153 RYKTELCRPFEESGTCKYGEKCQFAHGFHELR 184



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 16/19 (84%), Positives = 18/19 (94%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGD 253
           YKTELCRPFEE+G CKYG+
Sbjct: 154 YKTELCRPFEESGTCKYGE 172



 Score = 32.7 bits (71), Expect = 1.3
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKTELCR F   G C YG   + +
Sbjct: 192 YKTELCRTFHTIGFCPYGPRCHFI 215


>BC005010-1|AAH05010.1|  497|Homo sapiens ZFP36L2 protein protein.
          Length = 497

 Score =  105 bits (251), Expect = 2e-22
 Identities = 40/49 (81%), Positives = 45/49 (91%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           CQFAHG  ELR+L RHPKYKTELCRTFH++GFCPYGPRCHF+HNA+E R
Sbjct: 174 CQFAHGFHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNADERR 222



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 17/32 (53%), Positives = 19/32 (59%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR F   G C YG +C F H   E R
Sbjct: 153 RYKTELCRPFEESGTCKYGEKCQFAHGFHELR 184



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 16/19 (84%), Positives = 18/19 (94%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGD 253
           YKTELCRPFEE+G CKYG+
Sbjct: 154 YKTELCRPFEESGTCKYGE 172



 Score = 32.7 bits (71), Expect = 1.3
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKTELCR F   G C YG   + +
Sbjct: 192 YKTELCRTFHTIGFCPYGPRCHFI 215


>AC010883-1|AAY14992.1|  494|Homo sapiens unknown protein.
          Length = 494

 Score =  105 bits (251), Expect = 2e-22
 Identities = 40/49 (81%), Positives = 45/49 (91%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           CQFAHG  ELR+L RHPKYKTELCRTFH++GFCPYGPRCHF+HNA+E R
Sbjct: 174 CQFAHGFHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNADERR 222



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 17/32 (53%), Positives = 19/32 (59%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +YKTELCR F   G C YG +C F H   E R
Sbjct: 153 RYKTELCRPFEESGTCKYGEKCQFAHGFHELR 184



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 16/19 (84%), Positives = 18/19 (94%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGD 253
           YKTELCRPFEE+G CKYG+
Sbjct: 154 YKTELCRPFEESGTCKYGE 172



 Score = 32.7 bits (71), Expect = 1.3
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLL 268
           YKTELCR F   G C YG   + +
Sbjct: 192 YKTELCRTFHTIGFCPYGPRCHFI 215


>M92844-1|AAC37600.1|  326|Homo sapiens zinc finger transcriptional
           regulator protein.
          Length = 326

 Score = 81.8 bits (193), Expect = 2e-15
 Identities = 32/47 (68%), Positives = 35/47 (74%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           CQFAHG+ ELR   RHPKYKTELC  F+  G CPYG RCHF+HN  E
Sbjct: 124 CQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSE 170



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 18/33 (54%), Positives = 21/33 (63%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +YKTELCRTF   G C YG +C F H   E R+
Sbjct: 103 RYKTELCRTFSESGRCRYGAKCQFAHGLGELRQ 135



 Score = 35.5 bits (78), Expect = 0.18
 Identities = 13/18 (72%), Positives = 15/18 (83%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYG 250
           YKTELCR F E+G C+YG
Sbjct: 104 YKTELCRTFSESGRCRYG 121


>M92843-1|AAA58489.1|  326|Homo sapiens zinc finger transcriptional
           regulator protein.
          Length = 326

 Score = 81.8 bits (193), Expect = 2e-15
 Identities = 32/47 (68%), Positives = 35/47 (74%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           CQFAHG+ ELR   RHPKYKTELC  F+  G CPYG RCHF+HN  E
Sbjct: 124 CQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSE 170



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 18/33 (54%), Positives = 21/33 (63%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +YKTELCRTF   G C YG +C F H   E R+
Sbjct: 103 RYKTELCRTFSESGRCRYGAKCQFAHGLGELRQ 135



 Score = 35.5 bits (78), Expect = 0.18
 Identities = 13/18 (72%), Positives = 15/18 (83%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYG 250
           YKTELCR F E+G C+YG
Sbjct: 104 YKTELCRTFSESGRCRYG 121


>M63625-1|AAA61240.1|  326|Homo sapiens tristetraproline protein.
          Length = 326

 Score = 81.8 bits (193), Expect = 2e-15
 Identities = 32/47 (68%), Positives = 35/47 (74%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           CQFAHG+ ELR   RHPKYKTELC  F+  G CPYG RCHF+HN  E
Sbjct: 124 CQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSE 170



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 18/33 (54%), Positives = 21/33 (63%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +YKTELCRTF   G C YG +C F H   E R+
Sbjct: 103 RYKTELCRTFSESGRCRYGAKCQFAHGLGELRQ 135



 Score = 35.5 bits (78), Expect = 0.18
 Identities = 13/18 (72%), Positives = 15/18 (83%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYG 250
           YKTELCR F E+G C+YG
Sbjct: 104 YKTELCRTFSESGRCRYG 121


>BC009693-1|AAH09693.1|  326|Homo sapiens zinc finger protein 36,
           C3H type, homolog (mouse) protein.
          Length = 326

 Score = 81.8 bits (193), Expect = 2e-15
 Identities = 32/47 (68%), Positives = 35/47 (74%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           CQFAHG+ ELR   RHPKYKTELC  F+  G CPYG RCHF+HN  E
Sbjct: 124 CQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSE 170



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 18/33 (54%), Positives = 21/33 (63%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +YKTELCRTF   G C YG +C F H   E R+
Sbjct: 103 RYKTELCRTFSESGRCRYGAKCQFAHGLGELRQ 135



 Score = 35.5 bits (78), Expect = 0.18
 Identities = 13/18 (72%), Positives = 15/18 (83%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYG 250
           YKTELCR F E+G C+YG
Sbjct: 104 YKTELCRTFSESGRCRYG 121


>AY771351-1|AAV28731.1|  326|Homo sapiens zinc finger protein 36,
           C3H type, homolog (mouse) protein.
          Length = 326

 Score = 81.8 bits (193), Expect = 2e-15
 Identities = 32/47 (68%), Positives = 35/47 (74%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           CQFAHG+ ELR   RHPKYKTELC  F+  G CPYG RCHF+HN  E
Sbjct: 124 CQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSE 170



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 18/33 (54%), Positives = 21/33 (63%)
 Frame = +1

Query: 307 KYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +YKTELCRTF   G C YG +C F H   E R+
Sbjct: 103 RYKTELCRTFSESGRCRYGAKCQFAHGLGELRQ 135



 Score = 35.5 bits (78), Expect = 0.18
 Identities = 13/18 (72%), Positives = 15/18 (83%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYG 250
           YKTELCR F E+G C+YG
Sbjct: 104 YKTELCRTFSESGRCRYG 121


>BC044642-1|AAH44642.1|  506|Homo sapiens RC3H2 protein protein.
          Length = 506

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 16/37 (43%), Positives = 20/37 (54%)
 Frame = +1

Query: 295 QRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           Q + KYKT +CR     G CP G  C F H+ EE  +
Sbjct: 406 QPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEK 442


>AL359512-9|CAI94965.1|  935|Homo sapiens ring finger and CCCH-type
           zinc finger domains 2 protein.
          Length = 935

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 16/37 (43%), Positives = 20/37 (54%)
 Frame = +1

Query: 295 QRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           Q + KYKT +CR     G CP G  C F H+ EE  +
Sbjct: 277 QPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEK 313


>AL359512-8|CAI94964.1| 1191|Homo sapiens ring finger and CCCH-type
           zinc finger domains 2 protein.
          Length = 1191

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 16/37 (43%), Positives = 20/37 (54%)
 Frame = +1

Query: 295 QRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           Q + KYKT +CR     G CP G  C F H+ EE  +
Sbjct: 406 QPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEK 442


>AL136170-3|CAI19419.1| 1086|Homo sapiens ring finger and CCCH-type
           zinc finger domains 1 protein.
          Length = 1086

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = +1

Query: 298 RHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +H KYKT +CR     G CP G  C F H+ EE  +
Sbjct: 371 QHSKYKTYMCRDMKQRGGCPRGASCTFAHSQEELEK 406


>AL136170-2|CAI19417.1| 1094|Homo sapiens ring finger and CCCH-type
           zinc finger domains 1 protein.
          Length = 1094

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = +1

Query: 298 RHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +H KYKT +CR     G CP G  C F H+ EE  +
Sbjct: 371 QHSKYKTYMCRDMKQRGGCPRGASCTFAHSQEELEK 406


>AL136170-1|CAI19418.1| 1133|Homo sapiens ring finger and CCCH-type
           zinc finger domains 1 protein.
          Length = 1133

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = +1

Query: 298 RHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +H KYKT +CR     G CP G  C F H+ EE  +
Sbjct: 410 QHSKYKTYMCRDMKQRGGCPRGASCTFAHSQEELEK 445


>AL121983-3|CAH70710.1| 1086|Homo sapiens ring finger and CCCH-type
           zinc finger domains 1 protein.
          Length = 1086

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = +1

Query: 298 RHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +H KYKT +CR     G CP G  C F H+ EE  +
Sbjct: 371 QHSKYKTYMCRDMKQRGGCPRGASCTFAHSQEELEK 406


>AL121983-2|CAH70709.1| 1094|Homo sapiens ring finger and CCCH-type
           zinc finger domains 1 protein.
          Length = 1094

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = +1

Query: 298 RHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +H KYKT +CR     G CP G  C F H+ EE  +
Sbjct: 371 QHSKYKTYMCRDMKQRGGCPRGASCTFAHSQEELEK 406


>AL121983-1|CAI12318.1| 1133|Homo sapiens ring finger and CCCH-type
           zinc finger domains 1 protein.
          Length = 1133

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = +1

Query: 298 RHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +H KYKT +CR     G CP G  C F H+ EE  +
Sbjct: 410 QHSKYKTYMCRDMKQRGGCPRGASCTFAHSQEELEK 445


>AK000308-1|BAA91073.1|  869|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20301 fis, clone HEP06569. ).
          Length = 869

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 16/37 (43%), Positives = 20/37 (54%)
 Frame = +1

Query: 295 QRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           Q + KYKT +CR     G CP G  C F H+ EE  +
Sbjct: 211 QPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEK 247


>AF255303-1|AAG00432.1| 1048|Homo sapiens membrane-associated
           nucleic acid binding protein protein.
          Length = 1048

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 16/37 (43%), Positives = 20/37 (54%)
 Frame = +1

Query: 295 QRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           Q + KYKT +CR     G CP G  C F H+ EE  +
Sbjct: 406 QPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEK 442


>AB095945-1|BAC23121.1| 1109|Homo sapiens KIAA2025 protein protein.
          Length = 1109

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = +1

Query: 298 RHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           +H KYKT +CR     G CP G  C F H+ EE  +
Sbjct: 386 QHSKYKTYMCRDMKQRGGCPRGASCTFAHSQEELEK 421


>AL032819-1|CAM26345.1|  332|Homo sapiens unkempt-like (Drosophila)
           protein.
          Length = 332

 Score = 39.5 bits (88), Expect = 0.011
 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 1/44 (2%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPK-YKTELCRTFHSVGFCPYGPRCHFVH 384
           CQ+ H   E    Q HP+ YK+  C      G+CP GP C F H
Sbjct: 270 CQYCHSRTEQ---QFHPEIYKSTKCNDMRQTGYCPRGPFCAFAH 310


>AL031721-3|CAM26440.1|  332|Homo sapiens unkempt-like (Drosophila)
           protein.
          Length = 332

 Score = 39.5 bits (88), Expect = 0.011
 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 1/44 (2%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPK-YKTELCRTFHSVGFCPYGPRCHFVH 384
           CQ+ H   E    Q HP+ YK+  C      G+CP GP C F H
Sbjct: 270 CQYCHSRTEQ---QFHPEIYKSTKCNDMRQTGYCPRGPFCAFAH 310


>BC053362-1|AAH53362.1|  818|Homo sapiens UNK protein protein.
          Length = 818

 Score = 35.9 bits (79), Expect = 0.14
 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 1/44 (2%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPK-YKTELCRTFHSVGFCPYGPRCHFVH 384
           CQ+ H   E    Q HP+ YK+  C      G CP GP C F H
Sbjct: 286 CQYCHTRTEQ---QFHPEIYKSTKCNDMQQSGSCPRGPFCAFAH 326


>AB051540-1|BAB21844.1|  818|Homo sapiens KIAA1753 protein protein.
          Length = 818

 Score = 35.9 bits (79), Expect = 0.14
 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 1/44 (2%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPK-YKTELCRTFHSVGFCPYGPRCHFVH 384
           CQ+ H   E    Q HP+ YK+  C      G CP GP C F H
Sbjct: 286 CQYCHTRTEQ---QFHPEIYKSTKCNDMQQSGSCPRGPFCAFAH 326


>AE006467-5|AAK61279.1|  756|Homo sapiens Ce protein similar to Dm
           Cys3His finger protein protein.
          Length = 756

 Score = 34.7 bits (76), Expect = 0.32
 Identities = 12/27 (44%), Positives = 14/27 (51%)
 Frame = +1

Query: 304 PKYKTELCRTFHSVGFCPYGPRCHFVH 384
           P YK+  C      G+CP GP C F H
Sbjct: 471 PIYKSTKCNDMRQTGYCPRGPFCAFAH 497


>X98253-1|CAA66907.1|  343|Homo sapiens ZNF183 protein.
          Length = 343

 Score = 33.9 bits (74), Expect = 0.56
 Identities = 9/29 (31%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   GFC +G  C F+H+  +
Sbjct: 197 YQPDICKDYKETGFCGFGDSCKFLHDRSD 225



 Score = 30.7 bits (66), Expect = 5.2
 Identities = 9/30 (30%), Positives = 19/30 (63%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++E G C +GD+   L   ++Y
Sbjct: 197 YQPDICKDYKETGFCGFGDSCKFLHDRSDY 226


>BT007175-1|AAP35839.1|  343|Homo sapiens zinc finger protein 183
           (RING finger, C3HC4 type) protein.
          Length = 343

 Score = 33.9 bits (74), Expect = 0.56
 Identities = 9/29 (31%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   GFC +G  C F+H+  +
Sbjct: 197 YQPDICKDYKETGFCGFGDSCKFLHDRSD 225



 Score = 30.7 bits (66), Expect = 5.2
 Identities = 9/30 (30%), Positives = 19/30 (63%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++E G C +GD+   L   ++Y
Sbjct: 197 YQPDICKDYKETGFCGFGDSCKFLHDRSDY 226


>BC025388-1|AAH25388.1|  322|Homo sapiens ring finger protein 113B
           protein.
          Length = 322

 Score = 33.9 bits (74), Expect = 0.56
 Identities = 9/29 (31%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   GFC +G  C F+H+  +
Sbjct: 191 YQPDICKDYKETGFCGFGDSCKFLHDRSD 219



 Score = 31.1 bits (67), Expect = 4.0
 Identities = 9/32 (28%), Positives = 20/32 (62%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANYAI 292
           Y+ ++C+ ++E G C +GD+   L   ++Y +
Sbjct: 191 YQPDICKDYKETGFCGFGDSCKFLHDRSDYKL 222


>BC020556-1|AAH20556.1|  343|Homo sapiens ring finger protein 113A
           protein.
          Length = 343

 Score = 33.9 bits (74), Expect = 0.56
 Identities = 9/29 (31%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   GFC +G  C F+H+  +
Sbjct: 197 YQPDICKDYKETGFCGFGDSCKFLHDRSD 225



 Score = 30.7 bits (66), Expect = 5.2
 Identities = 9/30 (30%), Positives = 19/30 (63%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++E G C +GD+   L   ++Y
Sbjct: 197 YQPDICKDYKETGFCGFGDSCKFLHDRSDY 226


>BC017585-1|AAH17585.1|  322|Homo sapiens ring finger protein 113B
           protein.
          Length = 322

 Score = 33.9 bits (74), Expect = 0.56
 Identities = 9/29 (31%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   GFC +G  C F+H+  +
Sbjct: 191 YQPDICKDYKETGFCGFGDSCKFLHDRSD 219



 Score = 31.1 bits (67), Expect = 4.0
 Identities = 9/32 (28%), Positives = 20/32 (62%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANYAI 292
           Y+ ++C+ ++E G C +GD+   L   ++Y +
Sbjct: 191 YQPDICKDYKETGFCGFGDSCKFLHDRSDYKL 222


>BC000832-1|AAH00832.1|  343|Homo sapiens ring finger protein 113A
           protein.
          Length = 343

 Score = 33.9 bits (74), Expect = 0.56
 Identities = 9/29 (31%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   GFC +G  C F+H+  +
Sbjct: 197 YQPDICKDYKETGFCGFGDSCKFLHDRSD 225



 Score = 30.7 bits (66), Expect = 5.2
 Identities = 9/30 (30%), Positives = 19/30 (63%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++E G C +GD+   L   ++Y
Sbjct: 197 YQPDICKDYKETGFCGFGDSCKFLHDRSDY 226


>AL136300-1|CAC42525.2|  322|Homo sapiens ring finger protein 113B
           protein.
          Length = 322

 Score = 33.9 bits (74), Expect = 0.56
 Identities = 9/29 (31%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   GFC +G  C F+H+  +
Sbjct: 191 YQPDICKDYKETGFCGFGDSCKFLHDRSD 219



 Score = 31.1 bits (67), Expect = 4.0
 Identities = 9/32 (28%), Positives = 20/32 (62%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANYAI 292
           Y+ ++C+ ++E G C +GD+   L   ++Y +
Sbjct: 191 YQPDICKDYKETGFCGFGDSCKFLHDRSDYKL 222


>AF539427-1|AAN33063.1|  322|Homo sapiens zinc finger protein
           ZNF183L1 protein.
          Length = 322

 Score = 33.9 bits (74), Expect = 0.56
 Identities = 9/29 (31%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   GFC +G  C F+H+  +
Sbjct: 191 YQPDICKDYKETGFCGFGDSCKFLHDRSD 219



 Score = 31.1 bits (67), Expect = 4.0
 Identities = 9/32 (28%), Positives = 20/32 (62%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANYAI 292
           Y+ ++C+ ++E G C +GD+   L   ++Y +
Sbjct: 191 YQPDICKDYKETGFCGFGDSCKFLHDRSDYKL 222


>AC002477-1|AAB67605.1|  343|Homo sapiens zinc-finger protein
           protein.
          Length = 343

 Score = 33.9 bits (74), Expect = 0.56
 Identities = 9/29 (31%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   GFC +G  C F+H+  +
Sbjct: 197 YQPDICKDYKETGFCGFGDSCKFLHDRSD 225



 Score = 30.7 bits (66), Expect = 5.2
 Identities = 9/30 (30%), Positives = 19/30 (63%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++E G C +GD+   L   ++Y
Sbjct: 197 YQPDICKDYKETGFCGFGDSCKFLHDRSDY 226


>CR457320-1|CAG33601.1|  510|Homo sapiens TOE1 protein.
          Length = 510

 Score = 33.5 bits (73), Expect = 0.74
 Identities = 11/31 (35%), Positives = 18/31 (58%)
 Frame = +1

Query: 301 HPKYKTELCRTFHSVGFCPYGPRCHFVHNAE 393
           H  + T +C  F + G+CP GP+C   H+ +
Sbjct: 292 HRPHPTSICDNFSAYGWCPLGPQCPQSHDID 322


>BC009364-1|AAH09364.1|  510|Homo sapiens target of EGR1, member 1
           (nuclear) protein.
          Length = 510

 Score = 33.5 bits (73), Expect = 0.74
 Identities = 11/31 (35%), Positives = 18/31 (58%)
 Frame = +1

Query: 301 HPKYKTELCRTFHSVGFCPYGPRCHFVHNAE 393
           H  + T +C  F + G+CP GP+C   H+ +
Sbjct: 292 HRPHPTSICDNFSAYGWCPLGPQCPQSHDID 322


>AY169960-1|AAN75441.1|  510|Homo sapiens target of Egr1 protein
           protein.
          Length = 510

 Score = 33.5 bits (73), Expect = 0.74
 Identities = 11/31 (35%), Positives = 18/31 (58%)
 Frame = +1

Query: 301 HPKYKTELCRTFHSVGFCPYGPRCHFVHNAE 393
           H  + T +C  F + G+CP GP+C   H+ +
Sbjct: 292 HRPHPTSICDNFSAYGWCPLGPQCPQSHDID 322


>AL359540-11|CAI21722.1|  510|Homo sapiens target of EGR1, member 1
           (nuclear) protein.
          Length = 510

 Score = 33.5 bits (73), Expect = 0.74
 Identities = 11/31 (35%), Positives = 18/31 (58%)
 Frame = +1

Query: 301 HPKYKTELCRTFHSVGFCPYGPRCHFVHNAE 393
           H  + T +C  F + G+CP GP+C   H+ +
Sbjct: 292 HRPHPTSICDNFSAYGWCPLGPQCPQSHDID 322


>AK024011-1|BAB14774.1|  510|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13949 fis, clone Y79AA1001041. ).
          Length = 510

 Score = 33.5 bits (73), Expect = 0.74
 Identities = 11/31 (35%), Positives = 18/31 (58%)
 Frame = +1

Query: 301 HPKYKTELCRTFHSVGFCPYGPRCHFVHNAE 393
           H  + T +C  F + G+CP GP+C   H+ +
Sbjct: 292 HRPHPTSICDNFSAYGWCPLGPQCPQSHDID 322


>U79569-1|AAD00321.1|  269|Homo sapiens no arches protein.
          Length = 269

 Score = 32.7 bits (71), Expect = 1.3
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = +1

Query: 292 LQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           L RH   +  +C  +  VGFCP GP C F+H
Sbjct: 137 LCRHRHTRRVICVNY-LVGFCPEGPSCKFMH 166


>EF191081-1|ABN05292.1|  269|Homo sapiens cleavage and
           polyadenylation specific factor 4, 30kDa protein.
          Length = 269

 Score = 32.7 bits (71), Expect = 1.3
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = +1

Query: 292 LQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           L RH   +  +C  +  VGFCP GP C F+H
Sbjct: 137 LCRHRHTRRVICVNY-LVGFCPEGPSCKFMH 166


>CR542161-1|CAG46958.1|  269|Homo sapiens CPSF4 protein.
          Length = 269

 Score = 32.7 bits (71), Expect = 1.3
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = +1

Query: 292 LQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           L RH   +  +C  +  VGFCP GP C F+H
Sbjct: 137 LCRHRHTRRVICVNY-LVGFCPEGPSCKFMH 166


>BC050738-1|AAH50738.1|  243|Homo sapiens CPSF4 protein protein.
          Length = 243

 Score = 32.7 bits (71), Expect = 1.3
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = +1

Query: 292 LQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           L RH   +  +C  +  VGFCP GP C F+H
Sbjct: 137 LCRHRHTRRVICVNY-LVGFCPEGPSCKFMH 166


>BC003101-1|AAH03101.1|  244|Homo sapiens cleavage and
           polyadenylation specific factor 4, 30kDa protein.
          Length = 244

 Score = 32.7 bits (71), Expect = 1.3
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = +1

Query: 292 LQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           L RH   +  +C  +  VGFCP GP C F+H
Sbjct: 137 LCRHRHTRRVICVNY-LVGFCPEGPSCKFMH 166


>BC009973-1|AAH09973.1|  650|Homo sapiens dihydrouridine synthase
           3-like (S. cerevisiae) protein.
          Length = 650

 Score = 31.9 bits (69), Expect = 2.3
 Identities = 16/41 (39%), Positives = 19/41 (46%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHF 378
           C+F H V   R L+  P      C  F + G CPYG  C F
Sbjct: 141 CRFLHDVG--RYLETKPADLGPRCVLFETFGRCPYGVTCRF 179


>BC008362-1|AAH08362.1|  613|Homo sapiens DUS3L protein protein.
          Length = 613

 Score = 31.9 bits (69), Expect = 2.3
 Identities = 16/41 (39%), Positives = 19/41 (46%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHF 378
           C+F H V   R L+  P      C  F + G CPYG  C F
Sbjct: 104 CRFLHDVG--RYLETKPADLGPRCVLFETFGRCPYGVTCRF 142


>AL365411-1|CAB96955.1|  465|Homo sapiens hypothetical protein,
           similar to (AF091072.1) predicted protein [Homo sapiens]
           protein.
          Length = 465

 Score = 31.9 bits (69), Expect = 2.3
 Identities = 16/41 (39%), Positives = 19/41 (46%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHF 378
           C+F H V   R L+  P      C  F + G CPYG  C F
Sbjct: 124 CRFLHDVG--RYLETKPADLGPRCVLFETFGRCPYGVTCRF 162


>AK023958-1|BAB14740.1|  650|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13896 fis, clone THYRO1001703, weakly similar to
           NIFR3-LIKE PROTEIN. ).
          Length = 650

 Score = 31.9 bits (69), Expect = 2.3
 Identities = 16/41 (39%), Positives = 19/41 (46%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHF 378
           C+F H V   R L+  P      C  F + G CPYG  C F
Sbjct: 141 CRFLHDVG--RYLETKPADLGPRCVLFETFGRCPYGVTCRF 179


>BC033786-1|AAH33786.2|  465|Homo sapiens ring finger protein 38
           protein.
          Length = 465

 Score = 30.3 bits (65), Expect = 6.9
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = +3

Query: 513 LTPHSPPAMSPPAQATAFAFRRTNSP 590
           L+PH PP + PP Q   F  +++ SP
Sbjct: 229 LSPHHPPHLPPPGQFVPFQTQQSRSP 254


>AL354935-3|CAO03541.1|  465|Homo sapiens ring finger protein 38
           protein.
          Length = 465

 Score = 30.3 bits (65), Expect = 6.9
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = +3

Query: 513 LTPHSPPAMSPPAQATAFAFRRTNSP 590
           L+PH PP + PP Q   F  +++ SP
Sbjct: 229 LSPHHPPHLPPPGQFVPFQTQQSRSP 254


>AL354935-2|CAO03540.1|  515|Homo sapiens ring finger protein 38
           protein.
          Length = 515

 Score = 30.3 bits (65), Expect = 6.9
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = +3

Query: 513 LTPHSPPAMSPPAQATAFAFRRTNSP 590
           L+PH PP + PP Q   F  +++ SP
Sbjct: 279 LSPHHPPHLPPPGQFVPFQTQQSRSP 304


>AL354935-1|CAH70194.1|  439|Homo sapiens ring finger protein 38
           protein.
          Length = 439

 Score = 30.3 bits (65), Expect = 6.9
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = +3

Query: 513 LTPHSPPAMSPPAQATAFAFRRTNSP 590
           L+PH PP + PP Q   F  +++ SP
Sbjct: 203 LSPHHPPHLPPPGQFVPFQTQQSRSP 228


>AL161792-4|CAO03554.1|  465|Homo sapiens ring finger protein 38
           protein.
          Length = 465

 Score = 30.3 bits (65), Expect = 6.9
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = +3

Query: 513 LTPHSPPAMSPPAQATAFAFRRTNSP 590
           L+PH PP + PP Q   F  +++ SP
Sbjct: 229 LSPHHPPHLPPPGQFVPFQTQQSRSP 254


>AL161792-3|CAO03553.1|  515|Homo sapiens ring finger protein 38
           protein.
          Length = 515

 Score = 30.3 bits (65), Expect = 6.9
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = +3

Query: 513 LTPHSPPAMSPPAQATAFAFRRTNSP 590
           L+PH PP + PP Q   F  +++ SP
Sbjct: 279 LSPHHPPHLPPPGQFVPFQTQQSRSP 304


>AL161792-1|CAI16895.1|  439|Homo sapiens ring finger protein 38
           protein.
          Length = 439

 Score = 30.3 bits (65), Expect = 6.9
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = +3

Query: 513 LTPHSPPAMSPPAQATAFAFRRTNSP 590
           L+PH PP + PP Q   F  +++ SP
Sbjct: 203 LSPHHPPHLPPPGQFVPFQTQQSRSP 228


>AK024996-1|BAB15050.1|  332|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ21343 fis, clone COL02679. ).
          Length = 332

 Score = 30.3 bits (65), Expect = 6.9
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = +3

Query: 513 LTPHSPPAMSPPAQATAFAFRRTNSP 590
           L+PH PP + PP Q   F  +++ SP
Sbjct: 96  LSPHHPPHLPPPGQFVPFQTQQSRSP 121


>AF394047-1|AAM73697.1|  432|Homo sapiens RING finger protein 38
           protein.
          Length = 432

 Score = 30.3 bits (65), Expect = 6.9
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = +3

Query: 513 LTPHSPPAMSPPAQATAFAFRRTNSP 590
           L+PH PP + PP Q   F  +++ SP
Sbjct: 196 LSPHHPPHLPPPGQFVPFQTQQSRSP 221


>AB002358-1|BAA21638.2| 1019|Homo sapiens KIAA0360 protein.
          Length = 1019

 Score = 30.3 bits (65), Expect = 6.9
 Identities = 13/38 (34%), Positives = 24/38 (63%), Gaps = 2/38 (5%)
 Frame = -1

Query: 476 LIYDAIDPPDESDANEPPGDDGSL--RLASSALCTKWQ 369
           ++  A++P +++D N PPG +GS    +A S+  T+ Q
Sbjct: 524 VLMKAVEPKNKADENTPPGSEGSAISGVAESSTATRMQ 561


>D63484-1|BAA09771.1|  944|Homo sapiens KIAA0150 protein.
          Length = 944

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 15/41 (36%), Positives = 23/41 (56%)
 Frame = +1

Query: 274 VRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           +R+ R  QR  K K E C  ++  G C  G RC ++H+ E+
Sbjct: 655 IRQAR--QRREKRK-EYCMYYNRFGRCNRGERCPYIHDPEK 692


>D29677-1|BAA06147.2| 1943|Homo sapiens KIAA0054 protein.
          Length = 1943

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 11/25 (44%), Positives = 14/25 (56%)
 Frame = +1

Query: 322 LCRTFHSVGFCPYGPRCHFVHNAEE 396
           LC+ F   G C YG +C   H+ EE
Sbjct: 184 LCKRFLEQGICRYGAQCTSAHSQEE 208


>BC130582-1|AAI30583.1| 1942|Homo sapiens helicase with zinc finger
           protein.
          Length = 1942

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 11/25 (44%), Positives = 14/25 (56%)
 Frame = +1

Query: 322 LCRTFHSVGFCPYGPRCHFVHNAEE 396
           LC+ F   G C YG +C   H+ EE
Sbjct: 183 LCKRFLEQGICRYGAQCTSAHSQEE 207


>BC094881-1|AAH94881.1| 1163|Homo sapiens HELZ protein protein.
          Length = 1163

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 11/25 (44%), Positives = 14/25 (56%)
 Frame = +1

Query: 322 LCRTFHSVGFCPYGPRCHFVHNAEE 396
           LC+ F   G C YG +C   H+ EE
Sbjct: 183 LCKRFLEQGICRYGAQCTSAHSQEE 207


>BC056895-1|AAH56895.1|  454|Homo sapiens HELZ protein protein.
          Length = 454

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 11/25 (44%), Positives = 14/25 (56%)
 Frame = +1

Query: 322 LCRTFHSVGFCPYGPRCHFVHNAEE 396
           LC+ F   G C YG +C   H+ EE
Sbjct: 183 LCKRFLEQGICRYGAQCTSAHSQEE 207


>BC038670-1|AAH38670.1|  948|Homo sapiens zinc finger CCCH-type
           containing 3 protein.
          Length = 948

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 15/41 (36%), Positives = 23/41 (56%)
 Frame = +1

Query: 274 VRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           +R+ R  QR  K K E C  ++  G C  G RC ++H+ E+
Sbjct: 659 IRQAR--QRREKRK-EYCMYYNRFGRCNRGERCPYIHDPEK 696


>BC034435-1|AAH34435.1|  335|Homo sapiens ZC3H3 protein protein.
          Length = 335

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 15/41 (36%), Positives = 23/41 (56%)
 Frame = +1

Query: 274 VRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           +R+ R  QR  K K E C  ++  G C  G RC ++H+ E+
Sbjct: 46  IRQAR--QRREKRK-EYCMYYNRFGRCNRGERCPYIHDPEK 83


>BC001974-1|AAH01974.1|  498|Homo sapiens Unknown (protein for
           IMAGE:3457069) protein.
          Length = 498

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 15/41 (36%), Positives = 23/41 (56%)
 Frame = +1

Query: 274 VRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           +R+ R  QR  K K E C  ++  G C  G RC ++H+ E+
Sbjct: 209 IRQAR--QRREKRK-EYCMYYNRFGRCNRGERCPYIHDPEK 246


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 98,273,176
Number of Sequences: 237096
Number of extensions: 1943206
Number of successful extensions: 6809
Number of sequences better than 10.0: 71
Number of HSP's better than 10.0 without gapping: 6121
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6799
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8063224416
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).