SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0001
         (485 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF414442-1|AAL65133.2|22152|Homo sapiens ovarian cancer related ...    31   2.8  
BC106038-1|AAI06039.1|  622|Homo sapiens SRY (sex determining re...    30   5.0  
BC024254-1|AAH24254.1|  476|Homo sapiens abl-interactor 1 protein.     30   5.0  
AL592146-3|CAI16596.1|  604|Homo sapiens SRY (sex determining re...    30   5.0  
AL592146-2|CAI16595.1|  255|Homo sapiens SRY (sex determining re...    30   5.0  
AL390961-6|CAI17278.1|  452|Homo sapiens spectrin SH3 domain bin...    30   5.0  
AL390961-5|CAI17276.1|  481|Homo sapiens spectrin SH3 domain bin...    30   5.0  
AL390961-4|CAI17274.1|  476|Homo sapiens spectrin SH3 domain bin...    30   5.0  
AL139404-6|CAH73116.1|  452|Homo sapiens spectrin SH3 domain bin...    30   5.0  
AL139404-5|CAH73113.1|  481|Homo sapiens spectrin SH3 domain bin...    30   5.0  
AL139404-4|CAH73115.1|  476|Homo sapiens spectrin SH3 domain bin...    30   5.0  
AF540955-1|AAN28379.1|  476|Homo sapiens Abl-interactor 1 protein.     30   5.0  
AF149301-1|AAD50120.1|  622|Homo sapiens SOX13 protein.                30   5.0  
AF116571-1|AAF23875.1|  604|Homo sapiens SRY-like DNA binding pr...    30   5.0  
AF098915-1|AAD16237.1|  622|Homo sapiens type 1 diabetes autoant...    30   5.0  
AF083105-1|AAC83687.1|  890|Homo sapiens HMG box factor SOX-13 p...    30   5.0  
AB040151-1|BAB55675.1|  452|Homo sapiens hNap1 Binding Protein p...    30   5.0  
U38945-1|AAB01737.1|  173|Homo sapiens CDKN2A protein.                 29   6.6  
AY867077-1|AAW68950.1|  107|Homo sapiens anti-tetanus toxoid imm...    29   6.6  
AY866996-1|AAW68872.1|  107|Homo sapiens anti-tetanus toxoid imm...    29   6.6  
U43573-1|AAC50513.1|  743|Homo sapiens alpha-N-acetylglucosamini...    29   8.7  
U43572-1|AAC50512.1|  743|Homo sapiens alpha-N-acetylglucosamini...    29   8.7  
U40846-1|AAB06188.1|  743|Homo sapiens alpha-N-acetylglucosamini...    29   8.7  
L78465-1|AAB36605.1|  639|Homo sapiens alpha-N-acetylglucosamini...    29   8.7  
L78464-1|AAB36604.1|  743|Homo sapiens alpha-N-acetylglucosamini...    29   8.7  
BC053991-1|AAH53991.1|  743|Homo sapiens N-acetylglucosaminidase...    29   8.7  

>AF414442-1|AAL65133.2|22152|Homo sapiens ovarian cancer related tumor
            marker CA125 protein.
          Length = 22152

 Score = 30.7 bits (66), Expect = 2.8
 Identities = 19/46 (41%), Positives = 23/46 (50%)
 Frame = -3

Query: 315  STSILVRGASLGNGDSVXSNAIAVLIWVWRLTDHLTTASNGSDSSS 178
            STS     ASL + DS  S   A+  W+W LT  L T +  S S S
Sbjct: 2025 STSSPYSSASLESLDSTISRRNAITSWLWDLTTSLPTTTWPSTSLS 2070


>BC106038-1|AAI06039.1|  622|Homo sapiens SRY (sex determining
           region Y)-box 13 protein.
          Length = 622

 Score = 29.9 bits (64), Expect = 5.0
 Identities = 12/37 (32%), Positives = 20/37 (54%)
 Frame = -1

Query: 347 CHDAERSSTRALRPYSSEERRSGTETAXLQTPSQFSF 237
           CH+A + S  A  P   +  R+  ++A  Q P+Q +F
Sbjct: 33  CHEAPQGSATAAEPQPGDPARASQDSADPQAPAQGNF 69


>BC024254-1|AAH24254.1|  476|Homo sapiens abl-interactor 1 protein.
          Length = 476

 Score = 29.9 bits (64), Expect = 5.0
 Identities = 30/116 (25%), Positives = 46/116 (39%)
 Frame = -3

Query: 444 RTASYNIKRPVAXISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDSV 265
           R   Y    PV   +  PN     P  L     P R A LN R  +    G+S G+G   
Sbjct: 189 RNTPYKTLEPVKPPTV-PNDYMTSPARLGSQHSPGRTASLNQRPRTH--SGSSGGSGSRE 245

Query: 264 XSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGG 97
            S + ++ I +   T    T    +  S+ G++Y T  R   R ++    +  +GG
Sbjct: 246 NSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSGG 300


>AL592146-3|CAI16596.1|  604|Homo sapiens SRY (sex determining
           region Y)-box 13 protein.
          Length = 604

 Score = 29.9 bits (64), Expect = 5.0
 Identities = 12/37 (32%), Positives = 20/37 (54%)
 Frame = -1

Query: 347 CHDAERSSTRALRPYSSEERRSGTETAXLQTPSQFSF 237
           CH+A + S  A  P   +  R+  ++A  Q P+Q +F
Sbjct: 15  CHEAPQGSATAAEPQPGDPARASQDSADPQAPAQGNF 51


>AL592146-2|CAI16595.1|  255|Homo sapiens SRY (sex determining
           region Y)-box 13 protein.
          Length = 255

 Score = 29.9 bits (64), Expect = 5.0
 Identities = 12/37 (32%), Positives = 20/37 (54%)
 Frame = -1

Query: 347 CHDAERSSTRALRPYSSEERRSGTETAXLQTPSQFSF 237
           CH+A + S  A  P   +  R+  ++A  Q P+Q +F
Sbjct: 15  CHEAPQGSATAAEPQPGDPARASQDSADPQAPAQGNF 51


>AL390961-6|CAI17278.1|  452|Homo sapiens spectrin SH3 domain
           binding protein 1 protein.
          Length = 452

 Score = 29.9 bits (64), Expect = 5.0
 Identities = 30/116 (25%), Positives = 46/116 (39%)
 Frame = -3

Query: 444 RTASYNIKRPVAXISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDSV 265
           R   Y    PV   +  PN     P  L     P R A LN R  +    G+S G+G   
Sbjct: 194 RNTPYKTLEPVKPPTV-PNDYMTSPARLGSQHSPGRTASLNQRPRTH--SGSSGGSGSRE 250

Query: 264 XSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGG 97
            S + ++ I +   T    T    +  S+ G++Y T  R   R ++    +  +GG
Sbjct: 251 NSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSGG 305


>AL390961-5|CAI17276.1|  481|Homo sapiens spectrin SH3 domain
           binding protein 1 protein.
          Length = 481

 Score = 29.9 bits (64), Expect = 5.0
 Identities = 30/116 (25%), Positives = 46/116 (39%)
 Frame = -3

Query: 444 RTASYNIKRPVAXISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDSV 265
           R   Y    PV   +  PN     P  L     P R A LN R  +    G+S G+G   
Sbjct: 194 RNTPYKTLEPVKPPTV-PNDYMTSPARLGSQHSPGRTASLNQRPRTH--SGSSGGSGSRE 250

Query: 264 XSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGG 97
            S + ++ I +   T    T    +  S+ G++Y T  R   R ++    +  +GG
Sbjct: 251 NSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSGG 305


>AL390961-4|CAI17274.1|  476|Homo sapiens spectrin SH3 domain
           binding protein 1 protein.
          Length = 476

 Score = 29.9 bits (64), Expect = 5.0
 Identities = 30/116 (25%), Positives = 46/116 (39%)
 Frame = -3

Query: 444 RTASYNIKRPVAXISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDSV 265
           R   Y    PV   +  PN     P  L     P R A LN R  +    G+S G+G   
Sbjct: 189 RNTPYKTLEPVKPPTV-PNDYMTSPARLGSQHSPGRTASLNQRPRTH--SGSSGGSGSRE 245

Query: 264 XSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGG 97
            S + ++ I +   T    T    +  S+ G++Y T  R   R ++    +  +GG
Sbjct: 246 NSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSGG 300


>AL139404-6|CAH73116.1|  452|Homo sapiens spectrin SH3 domain
           binding protein 1 protein.
          Length = 452

 Score = 29.9 bits (64), Expect = 5.0
 Identities = 30/116 (25%), Positives = 46/116 (39%)
 Frame = -3

Query: 444 RTASYNIKRPVAXISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDSV 265
           R   Y    PV   +  PN     P  L     P R A LN R  +    G+S G+G   
Sbjct: 194 RNTPYKTLEPVKPPTV-PNDYMTSPARLGSQHSPGRTASLNQRPRTH--SGSSGGSGSRE 250

Query: 264 XSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGG 97
            S + ++ I +   T    T    +  S+ G++Y T  R   R ++    +  +GG
Sbjct: 251 NSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSGG 305


>AL139404-5|CAH73113.1|  481|Homo sapiens spectrin SH3 domain
           binding protein 1 protein.
          Length = 481

 Score = 29.9 bits (64), Expect = 5.0
 Identities = 30/116 (25%), Positives = 46/116 (39%)
 Frame = -3

Query: 444 RTASYNIKRPVAXISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDSV 265
           R   Y    PV   +  PN     P  L     P R A LN R  +    G+S G+G   
Sbjct: 194 RNTPYKTLEPVKPPTV-PNDYMTSPARLGSQHSPGRTASLNQRPRTH--SGSSGGSGSRE 250

Query: 264 XSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGG 97
            S + ++ I +   T    T    +  S+ G++Y T  R   R ++    +  +GG
Sbjct: 251 NSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSGG 305


>AL139404-4|CAH73115.1|  476|Homo sapiens spectrin SH3 domain
           binding protein 1 protein.
          Length = 476

 Score = 29.9 bits (64), Expect = 5.0
 Identities = 30/116 (25%), Positives = 46/116 (39%)
 Frame = -3

Query: 444 RTASYNIKRPVAXISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDSV 265
           R   Y    PV   +  PN     P  L     P R A LN R  +    G+S G+G   
Sbjct: 189 RNTPYKTLEPVKPPTV-PNDYMTSPARLGSQHSPGRTASLNQRPRTH--SGSSGGSGSRE 245

Query: 264 XSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGG 97
            S + ++ I +   T    T    +  S+ G++Y T  R   R ++    +  +GG
Sbjct: 246 NSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSGG 300


>AF540955-1|AAN28379.1|  476|Homo sapiens Abl-interactor 1 protein.
          Length = 476

 Score = 29.9 bits (64), Expect = 5.0
 Identities = 30/116 (25%), Positives = 46/116 (39%)
 Frame = -3

Query: 444 RTASYNIKRPVAXISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDSV 265
           R   Y    PV   +  PN     P  L     P R A LN R  +    G+S G+G   
Sbjct: 189 RNTPYKTLEPVKPPTV-PNDYMTSPARLGSQHSPGRTASLNQRPRTH--SGSSGGSGSRE 245

Query: 264 XSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGG 97
            S + ++ I +   T    T    +  S+ G++Y T  R   R ++    +  +GG
Sbjct: 246 NSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSGG 300


>AF149301-1|AAD50120.1|  622|Homo sapiens SOX13 protein.
          Length = 622

 Score = 29.9 bits (64), Expect = 5.0
 Identities = 12/37 (32%), Positives = 20/37 (54%)
 Frame = -1

Query: 347 CHDAERSSTRALRPYSSEERRSGTETAXLQTPSQFSF 237
           CH+A + S  A  P   +  R+  ++A  Q P+Q +F
Sbjct: 33  CHEAPQGSATAAEPQPGDPARASQDSADPQAPAQGNF 69


>AF116571-1|AAF23875.1|  604|Homo sapiens SRY-like DNA binding
           protein protein.
          Length = 604

 Score = 29.9 bits (64), Expect = 5.0
 Identities = 12/37 (32%), Positives = 20/37 (54%)
 Frame = -1

Query: 347 CHDAERSSTRALRPYSSEERRSGTETAXLQTPSQFSF 237
           CH+A + S  A  P   +  R+  ++A  Q P+Q +F
Sbjct: 15  CHEAPQGSATAAEPQPGDPARASQDSADPQAPAQGNF 51


>AF098915-1|AAD16237.1|  622|Homo sapiens type 1 diabetes
           autoantigen ICA12 protein.
          Length = 622

 Score = 29.9 bits (64), Expect = 5.0
 Identities = 12/37 (32%), Positives = 20/37 (54%)
 Frame = -1

Query: 347 CHDAERSSTRALRPYSSEERRSGTETAXLQTPSQFSF 237
           CH+A + S  A  P   +  R+  ++A  Q P+Q +F
Sbjct: 33  CHEAPQGSATAAEPQPGDPARASQDSADPQAPAQGNF 69


>AF083105-1|AAC83687.1|  890|Homo sapiens HMG box factor SOX-13
           protein.
          Length = 890

 Score = 29.9 bits (64), Expect = 5.0
 Identities = 12/37 (32%), Positives = 20/37 (54%)
 Frame = -1

Query: 347 CHDAERSSTRALRPYSSEERRSGTETAXLQTPSQFSF 237
           CH+A + S  A  P   +  R+  ++A  Q P+Q +F
Sbjct: 15  CHEAPQGSATAAEPQPGDPARASQDSADPQAPAQGNF 51


>AB040151-1|BAB55675.1|  452|Homo sapiens hNap1 Binding Protein
           protein.
          Length = 452

 Score = 29.9 bits (64), Expect = 5.0
 Identities = 30/116 (25%), Positives = 46/116 (39%)
 Frame = -3

Query: 444 RTASYNIKRPVAXISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDSV 265
           R   Y    PV   +  PN     P  L     P R A LN R  +    G+S G+G   
Sbjct: 194 RNTPYKTLEPVKPPTV-PNDYMTSPARLGSQHSPGRTASLNQRPRTH--SGSSGGSGSRE 250

Query: 264 XSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGG 97
            S + ++ I +   T    T    +  S+ G++Y T  R   R ++    +  +GG
Sbjct: 251 NSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSGG 305


>U38945-1|AAB01737.1|  173|Homo sapiens CDKN2A protein.
          Length = 173

 Score = 29.5 bits (63), Expect = 6.6
 Identities = 16/44 (36%), Positives = 19/44 (43%)
 Frame = -3

Query: 405 ISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNG 274
           + + P HD  Q P     A PRRGA+L     S L R      G
Sbjct: 101 LPRRPGHDDGQRPSGGAAAAPRRGAQLRRPRHSHLTRARRCPGG 144


>AY867077-1|AAW68950.1|  107|Homo sapiens anti-tetanus toxoid
           immunoglobulin light chain variable region protein.
          Length = 107

 Score = 29.5 bits (63), Expect = 6.6
 Identities = 21/59 (35%), Positives = 29/59 (49%)
 Frame = -3

Query: 207 TASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGGKASWLLKAWLF*VLKTGVKFRY 31
           T S  S S+S G   +TTCRT++  +          GKA  LL  +    L+TGV  R+
Sbjct: 5   TQSPSSLSASVGDRVTTTCRTSQSIFINLNWFQQKPGKAPKLL-IYSASTLQTGVPSRF 62


>AY866996-1|AAW68872.1|  107|Homo sapiens anti-tetanus toxoid
           immunoglobulin light chain variable region protein.
          Length = 107

 Score = 29.5 bits (63), Expect = 6.6
 Identities = 21/59 (35%), Positives = 29/59 (49%)
 Frame = -3

Query: 207 TASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGGKASWLLKAWLF*VLKTGVKFRY 31
           T S  S S+S G   +TTCRT++  +          GKA  LL  +    L+TGV  R+
Sbjct: 5   TQSPSSLSASVGDRVTTTCRTSQSIFINLNWFQQKPGKAPKLL-IYSASTLQTGVPSRF 62


>U43573-1|AAC50513.1|  743|Homo sapiens
           alpha-N-acetylglucosaminidase protein.
          Length = 743

 Score = 29.1 bits (62), Expect = 8.7
 Identities = 18/53 (33%), Positives = 25/53 (47%)
 Frame = -3

Query: 222 TDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGGKASWLLKAWLF 64
           TDH+  A   ++     +E S         Y +A  A DT  +A WLL+ WLF
Sbjct: 305 TDHIYGADTFNEMQPPSSEPSYLAAATTAVY-EAMTAVDT--EAVWLLQGWLF 354


>U43572-1|AAC50512.1|  743|Homo sapiens
           alpha-N-acetylglucosaminidase protein.
          Length = 743

 Score = 29.1 bits (62), Expect = 8.7
 Identities = 18/53 (33%), Positives = 25/53 (47%)
 Frame = -3

Query: 222 TDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGGKASWLLKAWLF 64
           TDH+  A   ++     +E S         Y +A  A DT  +A WLL+ WLF
Sbjct: 305 TDHIYGADTFNEMQPPSSEPSYLAAATTAVY-EAMTAVDT--EAVWLLQGWLF 354


>U40846-1|AAB06188.1|  743|Homo sapiens
           alpha-N-acetylglucosaminidase protein.
          Length = 743

 Score = 29.1 bits (62), Expect = 8.7
 Identities = 18/53 (33%), Positives = 25/53 (47%)
 Frame = -3

Query: 222 TDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGGKASWLLKAWLF 64
           TDH+  A   ++     +E S         Y +A  A DT  +A WLL+ WLF
Sbjct: 305 TDHIYGADTFNEMQPPSSEPSYLAAATTAVY-EAMTAVDT--EAVWLLQGWLF 354


>L78465-1|AAB36605.1|  639|Homo sapiens
           alpha-N-acetylglucosaminidase protein.
          Length = 639

 Score = 29.1 bits (62), Expect = 8.7
 Identities = 18/53 (33%), Positives = 25/53 (47%)
 Frame = -3

Query: 222 TDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGGKASWLLKAWLF 64
           TDH+  A   ++     +E S         Y +A  A DT  +A WLL+ WLF
Sbjct: 201 TDHIYGADTFNEMQPPSSEPSYLAAATTAVY-EAMTAVDT--EAVWLLQGWLF 250


>L78464-1|AAB36604.1|  743|Homo sapiens
           alpha-N-acetylglucosaminidase protein.
          Length = 743

 Score = 29.1 bits (62), Expect = 8.7
 Identities = 18/53 (33%), Positives = 25/53 (47%)
 Frame = -3

Query: 222 TDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGGKASWLLKAWLF 64
           TDH+  A   ++     +E S         Y +A  A DT  +A WLL+ WLF
Sbjct: 305 TDHIYGADTFNEMQPPSSEPSYLAAATTAVY-EAMTAVDT--EAVWLLQGWLF 354


>BC053991-1|AAH53991.1|  743|Homo sapiens N-acetylglucosaminidase,
           alpha- (Sanfilippo disease IIIB) protein.
          Length = 743

 Score = 29.1 bits (62), Expect = 8.7
 Identities = 18/53 (33%), Positives = 25/53 (47%)
 Frame = -3

Query: 222 TDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGGKASWLLKAWLF 64
           TDH+  A   ++     +E S         Y +A  A DT  +A WLL+ WLF
Sbjct: 305 TDHIYGADTFNEMQPPSSEPSYLAAATTAVY-EAMTAVDT--EAVWLLQGWLF 354


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 66,056,804
Number of Sequences: 237096
Number of extensions: 1154210
Number of successful extensions: 4991
Number of sequences better than 10.0: 26
Number of HSP's better than 10.0 without gapping: 4884
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4991
length of database: 76,859,062
effective HSP length: 84
effective length of database: 56,942,998
effective search space used: 4384610846
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).