BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0255.Seq (505 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK097644-1|BAC05131.1| 630|Homo sapiens protein ( Homo sapiens ... 30 5.3 BC004854-1|AAH04854.2| 378|Homo sapiens DNPEP protein protein. 29 9.2 >AK097644-1|BAC05131.1| 630|Homo sapiens protein ( Homo sapiens cDNA FLJ40325 fis, clone TESTI2031007. ). Length = 630 Score = 29.9 bits (64), Expect = 5.3 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 284 APLVARADSGRVAPAHATFALSYSLSIGLDR 376 +P+V+ GR+AP F LS L +GL+R Sbjct: 44 SPVVSNKCEGRMAPPETKFPLSKGLEMGLER 74 >BC004854-1|AAH04854.2| 378|Homo sapiens DNPEP protein protein. Length = 378 Score = 29.1 bits (62), Expect = 9.2 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +3 Query: 348 LTLSQSVSIALSLSFSLHFDTSVAYLRDVT 437 L+LS S+S++LSLS SL S + RD+T Sbjct: 9 LSLSLSLSLSLSLSLSLSLSRSTWFDRDLT 38 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 60,446,998 Number of Sequences: 237096 Number of extensions: 1000993 Number of successful extensions: 1986 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1970 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1986 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4649883964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -