BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0238.Seq (519 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC006362-1|AAH06362.2| 271|Homo sapiens phosphatidic acid phosp... 30 5.6 AL354855-2|CAI16275.1| 271|Homo sapiens phosphatidic acid phosp... 30 5.6 AK075207-1|BAC11472.1| 271|Homo sapiens protein ( Homo sapiens ... 30 5.6 AK027568-1|BAB55204.1| 271|Homo sapiens protein ( Homo sapiens ... 30 5.6 >BC006362-1|AAH06362.2| 271|Homo sapiens phosphatidic acid phosphatase type 2 domain containing 3 protein. Length = 271 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +1 Query: 61 LMAWVVSVSISRVLAERHYLLDSXXXXXXXXLEGLFMSLIW 183 L+ W + V +SRV+ RH++ D L+ + L+W Sbjct: 218 LVLWALCVGLSRVMIGRHHVTDVLSGFVIGYLQFRLVELVW 258 >AL354855-2|CAI16275.1| 271|Homo sapiens phosphatidic acid phosphatase type 2 domain containing 3 protein. Length = 271 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +1 Query: 61 LMAWVVSVSISRVLAERHYLLDSXXXXXXXXLEGLFMSLIW 183 L+ W + V +SRV+ RH++ D L+ + L+W Sbjct: 218 LVLWALCVGLSRVMIGRHHVTDVLSGFVIGYLQFRLVELVW 258 >AK075207-1|BAC11472.1| 271|Homo sapiens protein ( Homo sapiens cDNA FLJ90726 fis, clone PLACE1009546. ). Length = 271 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +1 Query: 61 LMAWVVSVSISRVLAERHYLLDSXXXXXXXXLEGLFMSLIW 183 L+ W + V +SRV+ RH++ D L+ + L+W Sbjct: 218 LVLWALCVGLSRVMIGRHHVTDVLSGFVIGYLQFRLVELVW 258 >AK027568-1|BAB55204.1| 271|Homo sapiens protein ( Homo sapiens cDNA FLJ14662 fis, clone NT2RP2002857. ). Length = 271 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +1 Query: 61 LMAWVVSVSISRVLAERHYLLDSXXXXXXXXLEGLFMSLIW 183 L+ W + V +SRV+ RH++ D L+ + L+W Sbjct: 218 LVLWALCVGLSRVMIGRHHVTDVLSGFVIGYLQFRLVELVW 258 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,678,340 Number of Sequences: 237096 Number of extensions: 1318442 Number of successful extensions: 1656 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1652 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4933413474 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -