BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0237.Seq (907 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y08110-1|CAA69325.1| 2214|Homo sapiens mosaic protein LR11 protein. 33 1.9 U60975-1|AAC50891.2| 2214|Homo sapiens gp250 precursor protein. 33 1.9 >Y08110-1|CAA69325.1| 2214|Homo sapiens mosaic protein LR11 protein. Length = 2214 Score = 32.7 bits (71), Expect = 1.9 Identities = 16/40 (40%), Positives = 27/40 (67%) Frame = -2 Query: 513 PVIFLINLQHQVGMALLHILHQRLTNTALTAFGATNIAAR 394 P++FLI L VG A+L+ H+RL ++ TAF ++ ++R Sbjct: 2142 PILFLILLSLGVGFAILYTKHRRL-QSSFTAFANSHYSSR 2180 >U60975-1|AAC50891.2| 2214|Homo sapiens gp250 precursor protein. Length = 2214 Score = 32.7 bits (71), Expect = 1.9 Identities = 16/40 (40%), Positives = 27/40 (67%) Frame = -2 Query: 513 PVIFLINLQHQVGMALLHILHQRLTNTALTAFGATNIAAR 394 P++FLI L VG A+L+ H+RL ++ TAF ++ ++R Sbjct: 2142 PILFLILLSLGVGFAILYTKHRRL-QSSFTAFANSHYSSR 2180 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,166,867 Number of Sequences: 237096 Number of extensions: 4004942 Number of successful extensions: 9289 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8720 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9286 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11714809042 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -