BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0106 (648 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF270513-1|AAK37963.1| 1053|Homo sapiens extracellular glycoprot... 32 2.0 X04701-1|CAA28407.1| 705|Homo sapiens protein ( Human mRNA for ... 31 3.5 M14058-1|AAA51851.1| 705|Homo sapiens C1R protein. 31 3.5 BC035220-1|AAH35220.1| 705|Homo sapiens complement component 1,... 31 3.5 AB083037-1|BAC19850.2| 705|Homo sapiens r subcomponent of compl... 31 3.5 >AF270513-1|AAK37963.1| 1053|Homo sapiens extracellular glycoprotein EMILIN-2 precursor protein. Length = 1053 Score = 31.9 bits (69), Expect = 2.0 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -3 Query: 580 VLNGDERFRHVTTLHAWNETPCARDIIDRAPFRP 479 VL G E F AWN+ PC ++ R FRP Sbjct: 60 VLEGSESFIQAQYNCAWNQMPCPSALVYRVNFRP 93 >X04701-1|CAA28407.1| 705|Homo sapiens protein ( Human mRNA for complement component C1r. ). Length = 705 Score = 31.1 bits (67), Expect = 3.5 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 264 D*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSS 374 D + HCPY + A G +GE GK+ P +LD+S Sbjct: 244 DHQQVHCPYD-QLQIYANGKNIGEFCGKQRPPDLDTS 279 >M14058-1|AAA51851.1| 705|Homo sapiens C1R protein. Length = 705 Score = 31.1 bits (67), Expect = 3.5 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 264 D*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSS 374 D + HCPY + A G +GE GK+ P +LD+S Sbjct: 244 DHQQVHCPYD-QLQIYANGKNIGEFCGKQRPPDLDTS 279 >BC035220-1|AAH35220.1| 705|Homo sapiens complement component 1, r subcomponent protein. Length = 705 Score = 31.1 bits (67), Expect = 3.5 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 264 D*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSS 374 D + HCPY + A G +GE GK+ P +LD+S Sbjct: 244 DHQQVHCPYD-QLQIYANGKNIGEFCGKQRPPDLDTS 279 >AB083037-1|BAC19850.2| 705|Homo sapiens r subcomponent of complement component 1 protein. Length = 705 Score = 31.1 bits (67), Expect = 3.5 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 264 D*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSS 374 D + HCPY + A G +GE GK+ P +LD+S Sbjct: 244 DHQQVHCPYD-QLQIYANGKNIGEFCGKQRPPDLDTS 279 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,321,345 Number of Sequences: 237096 Number of extensions: 2043078 Number of successful extensions: 4796 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4795 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7197658880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -