SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0109
         (498 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X52479-1|CAA36718.1|  672|Homo sapiens protein ( Human PKC alpha...    64   2e-10
M22199-1|AAA60098.1|  431|Homo sapiens PRKACA protein.                 64   2e-10
BC109274-1|AAI09275.1|  672|Homo sapiens protein kinase C, alpha...    64   2e-10
BC109273-1|AAI09274.1|  672|Homo sapiens protein kinase C, alpha...    64   2e-10
BC053321-1|AAH53321.1|  380|Homo sapiens PRKCA protein protein.        64   2e-10
AY633609-1|AAV33302.1|  672|Homo sapiens aging-associated gene 6...    64   2e-10
AB209475-1|BAD92712.1|  461|Homo sapiens protein kinase C, alpha...    64   2e-10
Z15114-1|CAA78820.1|  536|Homo sapiens protein kinase C gamma pr...    64   3e-10
M13977-1|AAA60102.1|  317|Homo sapiens protein kinase C-gamma pr...    64   3e-10
BC047876-1|AAH47876.1|  697|Homo sapiens protein kinase C, gamma...    64   3e-10
AF345987-1|AAK13533.1|  697|Homo sapiens protein kinase C gamma ...    64   3e-10
BC031067-1|AAH31067.1|  590|Homo sapiens SYT3 protein protein.         62   1e-09
BC028379-1|AAH28379.1|  590|Homo sapiens SYT3 protein protein.         62   1e-09
AB018277-1|BAA34454.2| 1190|Homo sapiens KIAA0734 protein protein.     50   5e-09
BC112129-1|AAI12130.1| 1187|Homo sapiens BAI1-associated protein...    50   5e-09
BC104966-1|AAI04967.1| 1187|Homo sapiens BAI1-associated protein...    50   5e-09
AL031709-3|CAB56182.2| 1187|Homo sapiens BAI1-associated protein...    50   5e-09
AE006467-1|AAK61275.1| 1187|Homo sapiens BAI associated protein ...    50   5e-09
AB017111-1|BAA34710.1| 1187|Homo sapiens BAI-associated protein ...    50   5e-09
AL031709-4|CAM26362.1| 1169|Homo sapiens BAI1-associated protein...    50   5e-09
X07109-1|CAA30130.1|  673|Homo sapiens protein ( Human mRNA for ...    60   6e-09
X06318-1|CAA29634.1|  671|Homo sapiens protein ( Human mRNA for ...    60   6e-09
M13975-1|AAA60095.1|  673|Homo sapiens protein kinase C beta-II ...    60   6e-09
BC036472-1|AAH36472.1|  673|Homo sapiens protein kinase C, beta ...    60   6e-09
BC101025-1|AAI01026.1|  342|Homo sapiens SYT10 protein protein.        59   7e-09
BC101024-1|AAI01025.1|  523|Homo sapiens synaptotagmin X protein.      59   7e-09
AY198413-1|AAP37477.1|  523|Homo sapiens synaptotagmin 10 protein.     59   7e-09
BC125170-1|AAI25171.1|  403|Homo sapiens synaptotagmin VII protein.    58   1e-08
AC002299-2|AAB97934.1|  496|Homo sapiens Protein kinase C beta (...    58   2e-08
AC002299-1|AAB97933.1|  494|Homo sapiens Protein kinase C beta (...    58   2e-08
AF038535-1|AAB92667.1|  418|Homo sapiens synaptotagmin VII protein.    57   3e-08
BC113663-1|AAI13664.1|  803|Homo sapiens RAS p21 protein activat...    55   1e-07
BC110873-1|AAI10874.1|  803|Homo sapiens RAS p21 protein activat...    55   1e-07
AY029206-1|AAK31582.1|  803|Homo sapiens calcium-promoted Ras in...    55   1e-07
AC105052-1|AAP22345.1|  724|Homo sapiens unknown protein.              55   1e-07
AB011110-1|BAA25464.2|  816|Homo sapiens KIAA0538 protein protein.     55   1e-07
BC046367-1|AAH46367.1|  491|Homo sapiens synaptotagmin IX protein.     54   2e-07
BC029605-1|AAH29605.1|  319|Homo sapiens SYT9 protein protein.         54   2e-07
BC044948-1|AAH44948.1|  425|Homo sapiens synaptotagmin VI protein.     54   3e-07
AL162594-4|CAM27152.1|  510|Homo sapiens synaptotagmin VI protein.     54   3e-07
AL162594-2|CAI18964.1|  425|Homo sapiens synaptotagmin VI protein.     54   3e-07
AB209671-1|BAD92908.1|  239|Homo sapiens protein kinase C, gamma...    54   4e-07
M55047-1|AAA60609.1|  422|Homo sapiens synaptotagmin p65 protein.      53   5e-07
BC108289-1|AAI08290.1|  423|Homo sapiens PCLO protein protein.         53   5e-07
BC058917-1|AAH58917.1|  422|Homo sapiens SYT1 protein protein.         53   5e-07
BC001304-1|AAH01304.2|  356|Homo sapiens PCLO protein protein.         53   5e-07
AC004082-1|AAB97937.1|  743|Homo sapiens WUGSC:H_DJ0897G10.1 pro...    53   5e-07
BC100817-1|AAI00818.1|  419|Homo sapiens synaptotagmin II protein.     52   1e-06
BC100816-1|AAI00817.1|  317|Homo sapiens SYT2 protein protein.         52   1e-06
BC100815-1|AAI00816.1|  419|Homo sapiens synaptotagmin II protein.     52   1e-06
BC100814-1|AAI00815.1|  419|Homo sapiens synaptotagmin II protein.     52   1e-06
AK094430-1|BAC04354.1|  419|Homo sapiens protein ( Homo sapiens ...    52   1e-06
AK090672-1|BAC03500.1|  419|Homo sapiens protein ( Homo sapiens ...    52   1e-06
X96783-1|CAA65579.1|  386|Homo sapiens synaptotagmin V protein.        49   8e-06
DQ090951-1|AAY99640.1|  385|Homo sapiens synaptotagmin V protein.      49   8e-06
BC046157-1|AAH46157.1|  386|Homo sapiens synaptotagmin V protein.      49   8e-06
BC033683-1|AAH33683.1|  344|Homo sapiens SYT5 protein protein.         49   8e-06
D31897-1|BAA06695.1|  400|Homo sapiens Doc2 protein.                   49   1e-05
BC146779-1|AAI46780.1| 1669|Homo sapiens intersectin 2 protein.        49   1e-05
AK091491-1|BAC03675.1|  891|Homo sapiens protein ( Homo sapiens ...    49   1e-05
AK000302-1|BAA91068.1|  436|Homo sapiens protein ( Homo sapiens ...    49   1e-05
AF248540-1|AAF63600.1| 1681|Homo sapiens intersectin 2 protein.        49   1e-05
AF182198-1|AAF59903.1| 1696|Homo sapiens intersectin 2 long isof...    49   1e-05
AC008073-6|AAY14668.1|  367|Homo sapiens unknown protein.              49   1e-05
AB033082-1|BAA86570.1| 1676|Homo sapiens KIAA1256 protein protein.     49   1e-05
BC111800-1|AAI11801.1| 1197|Homo sapiens UNC13B protein protein.       48   1e-05
BC111781-1|AAI11782.1| 1610|Homo sapiens UNC13B protein protein.       48   1e-05
BC063436-1|AAH63436.1|  400|Homo sapiens DOC2A protein protein.        48   1e-05
BC055284-1|AAH55284.1|  400|Homo sapiens double C2-like domains,...    48   1e-05
BC041769-1|AAH41769.2|  400|Homo sapiens DOC2A protein protein.        48   1e-05
AL354669-2|CAH71207.1| 1622|Homo sapiens unc-13 homolog B (C. el...    48   1e-05
AL354669-1|CAH71208.1| 1591|Homo sapiens unc-13 homolog B (C. el...    48   1e-05
AL353795-12|CAH71003.1| 1622|Homo sapiens unc-13 homolog B (C. e...    48   1e-05
AL353795-11|CAH71004.1| 1591|Homo sapiens unc-13 homolog B (C. e...    48   1e-05
AL160274-2|CAH73362.1| 1622|Homo sapiens unc-13 homolog B (C. el...    48   1e-05
AL160274-1|CAH73361.1| 1591|Homo sapiens unc-13 homolog B (C. el...    48   1e-05
AF020202-1|AAC19406.1| 1591|Homo sapiens Munc13 protein.               48   1e-05
AB209998-1|BAE06080.1| 1620|Homo sapiens UNC13B variant protein ...    48   1e-05
AB028955-1|BAA82984.2| 1702|Homo sapiens KIAA1032 protein protein.     48   2e-05
AB011131-1|BAA25485.1| 1212|Homo sapiens KIAA0559 protein protein.     48   2e-05
BC017259-1|AAH17259.1|  690|Homo sapiens rabphilin 3A homolog (m...    47   3e-05
BC009843-1|AAH09843.1|  621|Homo sapiens Unknown (protein for IM...    47   3e-05
BC002605-1|AAH02605.1|  607|Homo sapiens Unknown (protein for IM...    47   3e-05
AB023202-1|BAA76829.2|  697|Homo sapiens KIAA0985 protein protein.     47   3e-05
D70830-1|BAA11107.1|  412|Homo sapiens Doc2 beta protein.              47   4e-05
DQ013303-1|AAY67796.1|  532|Homo sapiens RAB11-FIP2 long isoform...    46   6e-05
BC075074-1|AAH75074.1|  512|Homo sapiens RAB11 family interactin...    46   6e-05
BC075073-1|AAH75073.1|  512|Homo sapiens RAB11 family interactin...    46   6e-05
AY037299-1|AAK68635.1|  512|Homo sapiens nRip11 protein.               46   6e-05
AB023158-1|BAA76785.2|  533|Homo sapiens KIAA0941 protein protein.     46   6e-05
BC111945-1|AAI11946.1|  748|Homo sapiens SMAD specific E3 ubiqui...    46   1e-04
BC093876-1|AAH93876.1|  748|Homo sapiens SMAD specific E3 ubiqui...    46   1e-04
AY014180-1|AAG50421.1|  748|Homo sapiens E3 ubiquitin ligase Smu...    46   1e-04
AF301463-1|AAG25641.1|  748|Homo sapiens ubiquitin E3 ligase SMU...    46   1e-04
AF183187-1|AAG17468.1| 1230|Homo sapiens heart/fetal otoferlin p...    46   1e-04
AF183186-1|AAG12992.1| 1307|Homo sapiens brain otoferlin short i...    46   1e-04
AF183185-1|AAG12991.1| 1997|Homo sapiens brain otoferlin long is...    46   1e-04
AF107403-1|AAD26117.1| 1230|Homo sapiens otoferlin protein.            46   1e-04
AC093378-2|AAY15083.1| 1230|Homo sapiens unknown protein.              46   1e-04
BC093724-1|AAH93724.1|  804|Homo sapiens RAS protein activator l...    45   2e-04
BC014420-1|AAH14420.1|  776|Homo sapiens RASAL1 protein protein.       45   2e-04
AB208935-1|BAD92172.1|  818|Homo sapiens RasGAP-activating-like ...    45   2e-04
BC030005-1|AAH30005.1|  600|Homo sapiens MCTP1 protein protein.        44   2e-04
AY656716-1|AAT73059.1|  778|Homo sapiens MCTP1S protein.               44   2e-04
AY656715-1|AAT73058.1|  999|Homo sapiens MCTP1L protein.               44   2e-04
AL389875-2|CAO03392.1| 1794|Homo sapiens fer-1-like 4 (C. elegan...    44   2e-04
AL121586-1|CAB89410.2| 1794|Homo sapiens fer-1-like 4 (C. elegan...    44   2e-04
AL109827-5|CAI20117.2| 1794|Homo sapiens fer-1-like 4 (C. elegan...    44   2e-04
AK057694-1|BAB71547.1|  692|Homo sapiens protein ( Homo sapiens ...    44   2e-04
AF086713-1|AAD09006.1|  804|Homo sapiens rasGAP-activating-like ...    44   3e-04
AF464850-1|AAM90910.1|  757|Homo sapiens Smad-ubiquitin E3 ligas...    44   4e-04
AF199364-1|AAF08298.2|  722|Homo sapiens E3 ubiquitin ligase SMU...    44   4e-04
AB046845-1|BAB13451.1|  859|Homo sapiens KIAA1625 protein protein.     44   4e-04
BC131527-1|AAI31528.1|  823|Homo sapiens MCTP2 protein protein.        43   5e-04
AY656717-1|AAT73060.1|  878|Homo sapiens MCTP2 protein.                43   5e-04
AK023521-1|BAB14597.1|  236|Homo sapiens protein ( Homo sapiens ...    43   7e-04
AF310676-1|AAG45422.1|  748|Homo sapiens E3 ubiquitin ligase SMU...    43   7e-04
Z85996-5|CAD92810.1|  593|Homo sapiens RP3-431A14.5 protein.           42   0.001
AB046819-1|BAB13425.1|  608|Homo sapiens KIAA1599 protein protein.     42   0.001
DQ267935-1|ABB89736.1| 2081|Homo sapiens dysferlin_v1 protein.         42   0.002
AK074104-1|BAB84930.1| 1516|Homo sapiens FLJ00175 protein protein.     42   0.002
AJ007670-1|CAA07603.1| 1413|Homo sapiens LGMD2B protein protein.       42   0.002
AF075575-1|AAC63519.1| 2080|Homo sapiens dysferlin protein.            42   0.002
AC010147-1|AAY14954.1| 1586|Homo sapiens unknown protein.              42   0.002
BC130375-1|AAI30376.1|  553|Homo sapiens copine family member IX...    41   0.003
BC035735-1|AAH35735.2|  503|Homo sapiens CPNE9 protein protein.        41   0.003
AK074977-1|BAC11328.1|  602|Homo sapiens protein ( Homo sapiens ...    41   0.003
BC111024-1|AAI11025.1|  306|Homo sapiens MCTP2 protein protein.        40   0.004
BC041387-1|AAH41387.1|  506|Homo sapiens MCTP2 protein protein.        40   0.004
BC025708-1|AAH25708.1|  306|Homo sapiens MCTP2 protein protein.        40   0.004
AK002037-1|BAA92048.1|  466|Homo sapiens protein ( Homo sapiens ...    40   0.004
AC004893-2|AAC62434.1|  712|Homo sapiens WUGSC:H_DJ0808A01.2 pro...    40   0.004
DQ523800-1|ABF69196.1|  887|Homo sapiens group IVB cytosolic pho...    40   0.005
DQ523799-1|ABF69195.1|  893|Homo sapiens group IVB cytosolic pho...    40   0.005
BC131585-1|AAI31586.1|  752|Homo sapiens SYTL5 protein protein.        40   0.005
BC032597-1|AAH32597.1|  911|Homo sapiens NEDD4L protein protein.       40   0.005
AY312514-1|AAP75706.1|  975|Homo sapiens NEDD4.2 protein.              40   0.005
AY112985-1|AAM76730.1|  947|Homo sapiens ubiquitin ligase NEDD4h...    40   0.005
AY112984-1|AAM76729.1|  967|Homo sapiens ubiquitin ligase NEDD4g...    40   0.005
AF121908-1|AAD32135.1| 1012|Homo sapiens cytosolic phospholipase...    40   0.005
AF065215-1|AAC78836.1| 1012|Homo sapiens cytosolic phospholipase...    40   0.005
AB196633-1|BAE53435.1| 1857|Homo sapiens C8orfK23 protein protein.     40   0.005
AB080222-1|BAB88906.1|  730|Homo sapiens synaptotagmin-like prot...    40   0.005
AB071179-1|BAB69424.1|  955|Homo sapiens NEDD4-like ubiquitin li...    40   0.005
BC067084-1|AAH67084.1| 1090|Homo sapiens unc-13 homolog D (C. el...    40   0.006
AJ578444-1|CAE17516.1| 1090|Homo sapiens mammalian unc13-4 protein.    40   0.006
BC126368-1|AAI26369.1|  802|Homo sapiens fer-1-like 5 (C. elegan...    39   0.011
BC117324-1|AAI17325.1|  801|Homo sapiens fer-1-like 5 (C. elegan...    39   0.011
AL359455-4|CAH73880.1|  602|Homo sapiens regulator of G-protein ...    38   0.015
AL359455-3|CAH73879.1| 1094|Homo sapiens regulator of G-protein ...    38   0.015
AL162727-4|CAH70843.1| 1094|Homo sapiens regulator of G-protein ...    38   0.015
AL137066-8|CAH70103.1|  602|Homo sapiens regulator of G-protein ...    38   0.015
AL137066-7|CAH70102.1| 1094|Homo sapiens regulator of G-protein ...    38   0.015
AK128127-1|BAC87285.1| 1198|Homo sapiens protein ( Homo sapiens ...    38   0.015
AB090876-1|BAC67158.1|  818|Homo sapiens cytosolic phospholipase...    38   0.015
BC064577-1|AAH64577.1|  558|Homo sapiens CPNE7 protein protein.        38   0.026
BC035334-1|AAH35334.1|  558|Homo sapiens copine VII protein.           38   0.026
BC004518-1|AAH04518.1|  474|Homo sapiens synaptotagmin XVII prot...    38   0.026
AJ133799-1|CAB61446.1|  633|Homo sapiens copine VII protein prot...    38   0.026
AJ133798-1|CAB61431.1|  633|Homo sapiens copine VII protein prot...    38   0.026
AF490839-1|AAM33254.1| 1093|Homo sapiens RGS3 isoform C2PA-RGS3 ...    38   0.026
AF220560-1|AAF37825.1|  474|Homo sapiens B/K protein protein.          38   0.026
AC003003-1|AAC05436.1|  361|Homo sapiens Homolog of rat B/K prot...    38   0.026
BC110578-1|AAI10579.1|  564|Homo sapiens CPNE8 protein protein.        37   0.034
BC110577-1|AAI10578.1|  564|Homo sapiens CPNE8 protein protein.        37   0.034
AY177785-1|AAO21123.1|  564|Homo sapiens copine VIII protein.          37   0.034
AK098593-1|BAC05344.1|  268|Homo sapiens protein ( Homo sapiens ...    37   0.034
BC035725-1|AAH35725.1|  562|Homo sapiens SYTL1 protein protein.        37   0.045
BC015764-1|AAH15764.1|  457|Homo sapiens SYTL1 protein protein.        37   0.045
BC009224-1|AAH09224.2|  471|Homo sapiens SYTL1 protein protein.        37   0.045
AL663123-9|CAI14783.1|  550|Homo sapiens synaptotagmin-like 1 pr...    37   0.045
AL663123-8|CAI14782.1|  291|Homo sapiens synaptotagmin-like 1 pr...    37   0.045
AL365364-3|CAI41207.2| 2048|Homo sapiens fer-1-like 3, myoferlin...    37   0.045
AL365364-2|CAI41206.2| 2061|Homo sapiens fer-1-like 3, myoferlin...    37   0.045
AL360229-3|CAH72371.2| 2048|Homo sapiens fer-1-like 3, myoferlin...    37   0.045
AL360229-2|CAH72372.2| 2061|Homo sapiens fer-1-like 3, myoferlin...    37   0.045
AL096713-1|CAB46370.1| 1430|Homo sapiens hypothetical protein pr...    37   0.045
AK091330-1|BAC03637.1|  515|Homo sapiens protein ( Homo sapiens ...    37   0.045
AK027902-1|BAB55444.1|  550|Homo sapiens protein ( Homo sapiens ...    37   0.045
AF207990-1|AAG23737.1| 2048|Homo sapiens fer-1 like protein 3 pr...    37   0.045
AF182317-1|AAF27177.1| 2018|Homo sapiens myoferlin protein.            37   0.045
AF182316-1|AAF27176.1| 2061|Homo sapiens myoferlin protein.            37   0.045
AB033033-1|BAA86521.2| 2061|Homo sapiens KIAA1207 protein protein.     37   0.045
BC037406-1|AAH37406.1|  421|Homo sapiens synaptotagmin XII protein.    36   0.10 
AL833834-1|CAD38694.1|  361|Homo sapiens hypothetical protein pr...    36   0.10 
U83246-1|AAC15920.1|  537|Homo sapiens copine I protein.               35   0.14 
D38522-1|BAA07527.2|  486|Homo sapiens KIAA0080 protein.               35   0.14 
CR456790-1|CAG33071.1|  537|Homo sapiens CPNE1 protein.                35   0.14 
BC116186-1|AAI16187.1| 1721|Homo sapiens intersectin 1 (SH3 doma...    35   0.14 
BC116185-1|AAI16186.1| 1716|Homo sapiens ITSN1 protein protein.        35   0.14 
BC039205-1|AAH39205.1|  431|Homo sapiens synaptotagmin XI protein.     35   0.14 
BC013690-1|AAH13690.1|  431|Homo sapiens synaptotagmin XI protein.     35   0.14 
BC004291-1|AAH04291.1|  431|Homo sapiens synaptotagmin XI protein.     35   0.14 
BC001142-1|AAH01142.1|  537|Homo sapiens copine I protein.             35   0.14 
AL139128-6|CAH69948.1|  431|Homo sapiens synaptotagmin XI protein.     35   0.14 
AL109827-17|CAI20127.1|  209|Homo sapiens copine I protein.            35   0.14 
AL109827-16|CAI20128.1|  202|Homo sapiens copine I protein.            35   0.14 
AL109827-15|CAI20126.1|  231|Homo sapiens copine I protein.            35   0.14 
AL109827-13|CAI20123.1|  304|Homo sapiens copine I protein.            35   0.14 
AL109827-10|CAO72111.1|  481|Homo sapiens copine I protein.            35   0.14 
AL109827-9|CAB87610.2|  537|Homo sapiens copine I protein.             35   0.14 
AK074931-1|BAC11300.1|  431|Homo sapiens protein ( Homo sapiens ...    35   0.14 
AK027540-1|BAB55186.1|  431|Homo sapiens protein ( Homo sapiens ...    35   0.14 
AF114487-1|AAD29952.1| 1721|Homo sapiens intersectin long isofor...    35   0.14 
AF064244-1|AAC78611.1| 1721|Homo sapiens intersectin long form p...    35   0.14 
DQ993201-1|ABJ97706.1|  921|Homo sapiens extended-synaptotagmin ...    35   0.18 
BC013957-1|AAH13957.1|  358|Homo sapiens FAM62B protein protein.       35   0.18 
AY368150-1|AAR89381.1|  893|Homo sapiens KIAA1228 protein protein.     35   0.18 
AK001181-1|BAA91539.1|  358|Homo sapiens protein ( Homo sapiens ...    35   0.18 
AJ303365-1|CAC33887.1|  158|Homo sapiens chr2 synaptotagmin prot...    35   0.18 
AB033054-1|BAA86542.2|  843|Homo sapiens KIAA1228 protein protein.     35   0.18 
AJ007973-1|CAA07800.1|  158|Homo sapiens dysferlin protein.            34   0.24 
BC036538-1|AAH36538.1|  425|Homo sapiens synaptotagmin IV protein.     34   0.32 
AF299075-1|AAG37229.1|  425|Homo sapiens synaptotagmin IV protein.     34   0.32 
AB037763-1|BAA92580.1|  426|Homo sapiens KIAA1342 protein protein.     34   0.32 
BC052617-1|AAH52617.1| 1577|Homo sapiens FER1L3 protein protein.       33   0.55 
AL365364-4|CAI41208.1|  445|Homo sapiens fer-1-like 3, myoferlin...    33   0.55 
AL360229-4|CAH72373.1|  445|Homo sapiens fer-1-like 3, myoferlin...    33   0.55 
AL360229-1|CAH72370.1|  160|Homo sapiens fer-1-like 3, myoferlin...    33   0.55 
Z73900-1|CAI42004.1|  671|Homo sapiens synaptotagmin-like 4 (gra...    33   0.73 
BC139914-1|AAI39915.1|  390|Homo sapiens SYT15 protein protein.        33   0.73 
AL391688-1|CAI41007.1|  671|Homo sapiens synaptotagmin-like 4 (g...    33   0.73 
AL356056-4|CAH73271.1|  474|Homo sapiens synaptotagmin XV protein.     33   0.73 
AK131036-1|BAC85479.1|  348|Homo sapiens protein ( Homo sapiens ...    33   0.73 
AK127436-1|BAC86979.1|  474|Homo sapiens protein ( Homo sapiens ...    33   0.73 
AF302493-1|AAQ14492.1|  673|Homo sapiens endocrine transmitter r...    33   0.73 
AB109023-1|BAC76818.1|  390|Homo sapiens synaptotagmin XV-b prot...    33   0.73 
AB109022-1|BAC76817.1|  421|Homo sapiens synaptotagmin XV-a prot...    33   0.73 
BX537410-1|CAD97652.1|  671|Homo sapiens hypothetical protein pr...    32   0.96 
BC014913-1|AAH14913.1|  671|Homo sapiens synaptotagmin-like 4 (g...    32   0.96 
AK094110-1|BAC04287.1|  671|Homo sapiens protein ( Homo sapiens ...    32   0.96 
AY190519-1|AAO38848.1| 1692|Homo sapiens Rab3A-interacting molec...    32   1.3  
AL590011-1|CAI16961.1| 1039|Homo sapiens regulating synaptic mem...    32   1.3  
AL445256-7|CAI39602.1|  624|Homo sapiens regulating synaptic mem...    32   1.3  
AL445256-6|CAI39600.1|  728|Homo sapiens regulating synaptic mem...    32   1.3  
AL445256-5|CAI39605.1|  544|Homo sapiens regulating synaptic mem...    32   1.3  
AL445256-4|CAI39604.1|  768|Homo sapiens regulating synaptic mem...    32   1.3  
AL445256-3|CAI39601.1|  794|Homo sapiens regulating synaptic mem...    32   1.3  
AL445256-2|CAI39603.1|  595|Homo sapiens regulating synaptic mem...    32   1.3  
AL445256-1|CAI39598.1| 1039|Homo sapiens regulating synaptic mem...    32   1.3  
AL390056-1|CAI21554.1| 1039|Homo sapiens regulating synaptic mem...    32   1.3  
AL035633-7|CAI42137.1|  624|Homo sapiens regulating synaptic mem...    32   1.3  
AL035633-6|CAI42135.1|  728|Homo sapiens regulating synaptic mem...    32   1.3  
AL035633-5|CAI42140.1|  544|Homo sapiens regulating synaptic mem...    32   1.3  
AL035633-4|CAI42139.1|  768|Homo sapiens regulating synaptic mem...    32   1.3  
AL035633-3|CAI42136.1|  794|Homo sapiens regulating synaptic mem...    32   1.3  
AL035633-2|CAI42138.1|  595|Homo sapiens regulating synaptic mem...    32   1.3  
AL034373-1|CAI20558.1| 1039|Homo sapiens regulating synaptic mem...    32   1.3  
AB051866-1|BAB87242.1| 1470|Homo sapiens RIM long form protein.        32   1.3  
AB045726-1|BAB87121.1| 1028|Homo sapiens RIM short form protein.       32   1.3  
AB002338-1|BAA20798.1| 1053|Homo sapiens KIAA0340 protein.             32   1.3  
BC066597-1|AAH66597.1|  537|Homo sapiens copine III protein.           31   2.2  
BC036242-1|AAH36242.1|  537|Homo sapiens copine III protein.           31   2.2  
BC007017-1|AAH07017.1|  262|Homo sapiens Unknown (protein for IM...    31   2.2  
AF077226-1|AAD46074.2|  537|Homo sapiens copine III protein.           31   2.2  
AB014536-1|BAA31611.2|  540|Homo sapiens KIAA0636 protein protein.     31   2.2  
D87074-1|BAA13243.2|  315|Homo sapiens KIAA0237 protein.               31   2.9  
BC003103-1|AAH03103.1|  308|Homo sapiens RIMS3 protein protein.        31   2.9  
AY326956-1|AAQ01683.1|  308|Homo sapiens RIM3 gamma protein.           31   2.9  
AL356056-3|CAH73270.1|  269|Homo sapiens synaptotagmin XV protein.     31   2.9  
AL031289-1|CAA20357.1|  308|Homo sapiens regulating synaptic mem...    31   2.9  
M72393-1|AAB00789.1|  749|Homo sapiens phospholopid-binding prot...    30   5.1  
M68874-1|AAA60105.1|  749|Homo sapiens phosphatidylcholine 2-acy...    30   5.1  
BC114340-1|AAI14341.1|  749|Homo sapiens phospholipase A2, group...    30   5.1  
AY552098-1|AAS45712.1|  749|Homo sapiens phospholipase A2, group...    30   5.1  
AL663123-7|CAI14781.1|  201|Homo sapiens synaptotagmin-like 1 pr...    30   5.1  
AL049797-1|CAI22252.1|  749|Homo sapiens phospholipase A2, group...    30   5.1  
AL022147-1|CAB42689.2|  749|Homo sapiens phospholipase A2, group...    30   5.1  

>X52479-1|CAA36718.1|  672|Homo sapiens protein ( Human PKC alpha
           mRNA for protein kinase C alpha. ).
          Length = 672

 Score = 64.5 bits (150), Expect = 2e-10
 Identities = 31/77 (40%), Positives = 49/77 (63%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           L+V V +A +L+P DPNGLSDP+V + L+    N S +   +++S TLNP W E F+  +
Sbjct: 173 LHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRS-TLNPQWNESFTFKL 231

Query: 433 SGTVNEDSLCLEVWDFD 483
             +  +  L +E+WD+D
Sbjct: 232 KPSDKDRRLSVEIWDWD 248


>M22199-1|AAA60098.1|  431|Homo sapiens PRKACA protein.
          Length = 431

 Score = 64.5 bits (150), Expect = 2e-10
 Identities = 31/77 (40%), Positives = 49/77 (63%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           L+V V +A +L+P DPNGLSDP+V + L+    N S +   +++S TLNP W E F+  +
Sbjct: 159 LHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRS-TLNPQWNESFTFKL 217

Query: 433 SGTVNEDSLCLEVWDFD 483
             +  +  L +E+WD+D
Sbjct: 218 KPSDKDRRLSVEIWDWD 234


>BC109274-1|AAI09275.1|  672|Homo sapiens protein kinase C, alpha
           protein.
          Length = 672

 Score = 64.5 bits (150), Expect = 2e-10
 Identities = 31/77 (40%), Positives = 49/77 (63%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           L+V V +A +L+P DPNGLSDP+V + L+    N S +   +++S TLNP W E F+  +
Sbjct: 173 LHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRS-TLNPQWNESFTFKL 231

Query: 433 SGTVNEDSLCLEVWDFD 483
             +  +  L +E+WD+D
Sbjct: 232 KPSDKDRRLSVEIWDWD 248


>BC109273-1|AAI09274.1|  672|Homo sapiens protein kinase C, alpha
           protein.
          Length = 672

 Score = 64.5 bits (150), Expect = 2e-10
 Identities = 31/77 (40%), Positives = 49/77 (63%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           L+V V +A +L+P DPNGLSDP+V + L+    N S +   +++S TLNP W E F+  +
Sbjct: 173 LHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRS-TLNPQWNESFTFKL 231

Query: 433 SGTVNEDSLCLEVWDFD 483
             +  +  L +E+WD+D
Sbjct: 232 KPSDKDRRLSVEIWDWD 248


>BC053321-1|AAH53321.1|  380|Homo sapiens PRKCA protein protein.
          Length = 380

 Score = 64.5 bits (150), Expect = 2e-10
 Identities = 31/77 (40%), Positives = 49/77 (63%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           L+V V +A +L+P DPNGLSDP+V + L+    N S +   +++S TLNP W E F+  +
Sbjct: 245 LHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRS-TLNPQWNESFTFKL 303

Query: 433 SGTVNEDSLCLEVWDFD 483
             +  +  L +E+WD+D
Sbjct: 304 KPSDKDRRLSVEIWDWD 320


>AY633609-1|AAV33302.1|  672|Homo sapiens aging-associated gene 6
           protein protein.
          Length = 672

 Score = 64.5 bits (150), Expect = 2e-10
 Identities = 31/77 (40%), Positives = 49/77 (63%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           L+V V +A +L+P DPNGLSDP+V + L+    N S +   +++S TLNP W E F+  +
Sbjct: 173 LHVTVRDAENLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRS-TLNPQWNESFTFKL 231

Query: 433 SGTVNEDSLCLEVWDFD 483
             +  +  L +E+WD+D
Sbjct: 232 KPSDKDRRLSVEIWDWD 248


>AB209475-1|BAD92712.1|  461|Homo sapiens protein kinase C, alpha
           variant protein.
          Length = 461

 Score = 64.5 bits (150), Expect = 2e-10
 Identities = 31/77 (40%), Positives = 49/77 (63%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           L+V V +A +L+P DPNGLSDP+V + L+    N S +   +++S TLNP W E F+  +
Sbjct: 84  LHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRS-TLNPQWNESFTFKL 142

Query: 433 SGTVNEDSLCLEVWDFD 483
             +  +  L +E+WD+D
Sbjct: 143 KPSDKDRRLSVEIWDWD 159


>Z15114-1|CAA78820.1|  536|Homo sapiens protein kinase C gamma
           protein.
          Length = 536

 Score = 63.7 bits (148), Expect = 3e-10
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 2/76 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           ++V V EA +L+P DPNGLSDP+V + L+ +  +  +  T     TLNPVW E F   + 
Sbjct: 12  IHVTVGEARNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLK 71

Query: 436 GTVNEDSLCLEVWDFD 483
               E  L +EVWD+D
Sbjct: 72  PGDVERRLSVEVWDWD 87


>M13977-1|AAA60102.1|  317|Homo sapiens protein kinase C-gamma
           protein.
          Length = 317

 Score = 63.7 bits (148), Expect = 3e-10
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 2/76 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           ++V V EA +L+P DPNGLSDP+V + L+ +  +  +  T     TLNPVW E F   + 
Sbjct: 173 IHVTVGEARNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLK 232

Query: 436 GTVNEDSLCLEVWDFD 483
               E  L +EVWD+D
Sbjct: 233 PGDVERRLSVEVWDWD 248


>BC047876-1|AAH47876.1|  697|Homo sapiens protein kinase C, gamma
           protein.
          Length = 697

 Score = 63.7 bits (148), Expect = 3e-10
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 2/76 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           ++V V EA +L+P DPNGLSDP+V + L+ +  +  +  T     TLNPVW E F   + 
Sbjct: 173 IHVTVGEARNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLK 232

Query: 436 GTVNEDSLCLEVWDFD 483
               E  L +EVWD+D
Sbjct: 233 PGDVERRLSVEVWDWD 248


>AF345987-1|AAK13533.1|  697|Homo sapiens protein kinase C gamma
           protein.
          Length = 697

 Score = 63.7 bits (148), Expect = 3e-10
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 2/76 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           ++V V EA +L+P DPNGLSDP+V + L+ +  +  +  T     TLNPVW E F   + 
Sbjct: 173 IHVTVGEARNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLK 232

Query: 436 GTVNEDSLCLEVWDFD 483
               E  L +EVWD+D
Sbjct: 233 PGDVERRLSVEVWDWD 248


>BC031067-1|AAH31067.1|  590|Homo sapiens SYT3 protein protein.
          Length = 590

 Score = 61.7 bits (143), Expect = 1e-09
 Identities = 32/76 (42%), Positives = 47/76 (61%), Gaps = 2/76 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE--HFSLPMS 435
           L V +++A DL  KD NG SDP+V IYL+ +   ++ T V   TLNPV+ E   FS+P++
Sbjct: 316 LVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPVFNETFQFSVPLA 375

Query: 436 GTVNEDSLCLEVWDFD 483
             + +  L   V+DFD
Sbjct: 376 -ELAQRKLHFSVYDFD 390



 Score = 42.7 bits (96), Expect = 7e-04
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           L V +++A++L   D  G SDP+V   L+S      +  TS+K  TLNP + E     ++
Sbjct: 448 LTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVA 507

Query: 436 -GTVNEDSLCLEVWDFD 483
             +V    L + V D+D
Sbjct: 508 PESVENVGLSIAVVDYD 524


>BC028379-1|AAH28379.1|  590|Homo sapiens SYT3 protein protein.
          Length = 590

 Score = 61.7 bits (143), Expect = 1e-09
 Identities = 32/76 (42%), Positives = 47/76 (61%), Gaps = 2/76 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE--HFSLPMS 435
           L V +++A DL  KD NG SDP+V IYL+ +   ++ T V   TLNPV+ E   FS+P++
Sbjct: 316 LVVRILQAMDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPVFNETFQFSVPLA 375

Query: 436 GTVNEDSLCLEVWDFD 483
             + +  L   V+DFD
Sbjct: 376 -ELAQRKLHFSVYDFD 390



 Score = 42.7 bits (96), Expect = 7e-04
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           L V +++A++L   D  G SDP+V   L+S      +  TS+K  TLNP + E     ++
Sbjct: 448 LTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVA 507

Query: 436 -GTVNEDSLCLEVWDFD 483
             +V    L + V D+D
Sbjct: 508 PESVENVGLSIAVVDYD 524


>AB018277-1|BAA34454.2| 1190|Homo sapiens KIAA0734 protein protein.
          Length = 1190

 Score = 49.6 bits (113), Expect = 6e-06
 Identities = 29/62 (46%), Positives = 39/62 (62%), Gaps = 6/62 (9%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYL----MSNSSHRYNTSVKSGTLNPVWEE--HFS 423
            L VEV+ A DL+P D NGLSDPFV + L    +        T VK+ TL+PV++E  +FS
Sbjct: 1030 LAVEVLHAADLLPLDANGLSDPFVIVELGPPHLFPLVRSQRTQVKTRTLHPVYDELFYFS 1089

Query: 424  LP 429
            +P
Sbjct: 1090 VP 1091



 Score = 45.6 bits (103), Expect(2) = 5e-09
 Identities = 20/37 (54%), Positives = 25/37 (67%)
 Frame = +1

Query: 373 TSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
           T VKS TLNPVW+EHF   +   V+ D L L++WD D
Sbjct: 265 TEVKSSTLNPVWKEHFLFEIE-DVSTDQLHLDIWDHD 300



 Score = 33.9 bits (74), Expect(2) = 5e-09
 Identities = 15/38 (39%), Positives = 23/38 (60%)
 Frame = +1

Query: 244 RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNS 357
           +A    L V V+ A +L+ KDPNG SDP+  + ++  S
Sbjct: 194 KAPTYALKVSVMRAKNLLAKDPNGFSDPYCMLGILPAS 231


>BC112129-1|AAI12130.1| 1187|Homo sapiens BAI1-associated protein 3
            protein.
          Length = 1187

 Score = 49.6 bits (113), Expect = 6e-06
 Identities = 29/62 (46%), Positives = 39/62 (62%), Gaps = 6/62 (9%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYL----MSNSSHRYNTSVKSGTLNPVWEE--HFS 423
            L VEV+ A DL+P D NGLSDPFV + L    +        T VK+ TL+PV++E  +FS
Sbjct: 1027 LAVEVLHAADLLPLDANGLSDPFVIVELGPPHLFPLVRSQRTQVKTRTLHPVYDELFYFS 1086

Query: 424  LP 429
            +P
Sbjct: 1087 VP 1088



 Score = 45.6 bits (103), Expect(2) = 5e-09
 Identities = 20/37 (54%), Positives = 25/37 (67%)
 Frame = +1

Query: 373 TSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
           T VKS TLNPVW+EHF   +   V+ D L L++WD D
Sbjct: 262 TEVKSSTLNPVWKEHFLFEIE-DVSTDQLHLDIWDHD 297



 Score = 33.9 bits (74), Expect(2) = 5e-09
 Identities = 15/38 (39%), Positives = 23/38 (60%)
 Frame = +1

Query: 244 RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNS 357
           +A    L V V+ A +L+ KDPNG SDP+  + ++  S
Sbjct: 191 KAPTYALKVSVMRAKNLLAKDPNGFSDPYCMLGILPAS 228


>BC104966-1|AAI04967.1| 1187|Homo sapiens BAI1-associated protein 3
            protein.
          Length = 1187

 Score = 49.6 bits (113), Expect = 6e-06
 Identities = 29/62 (46%), Positives = 39/62 (62%), Gaps = 6/62 (9%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYL----MSNSSHRYNTSVKSGTLNPVWEE--HFS 423
            L VEV+ A DL+P D NGLSDPFV + L    +        T VK+ TL+PV++E  +FS
Sbjct: 1027 LAVEVLHAADLLPLDANGLSDPFVIVELGPPHLFPLVRSQRTQVKTRTLHPVYDELFYFS 1086

Query: 424  LP 429
            +P
Sbjct: 1087 VP 1088



 Score = 45.6 bits (103), Expect(2) = 5e-09
 Identities = 20/37 (54%), Positives = 25/37 (67%)
 Frame = +1

Query: 373 TSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
           T VKS TLNPVW+EHF   +   V+ D L L++WD D
Sbjct: 262 TEVKSSTLNPVWKEHFLFEIE-DVSTDQLHLDIWDHD 297



 Score = 33.9 bits (74), Expect(2) = 5e-09
 Identities = 15/38 (39%), Positives = 23/38 (60%)
 Frame = +1

Query: 244 RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNS 357
           +A    L V V+ A +L+ KDPNG SDP+  + ++  S
Sbjct: 191 KAPTYALKVSVMRAKNLLAKDPNGFSDPYCMLGILPAS 228


>AL031709-3|CAB56182.2| 1187|Homo sapiens BAI1-associated protein 3
            protein.
          Length = 1187

 Score = 49.6 bits (113), Expect = 6e-06
 Identities = 29/62 (46%), Positives = 39/62 (62%), Gaps = 6/62 (9%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYL----MSNSSHRYNTSVKSGTLNPVWEE--HFS 423
            L VEV+ A DL+P D NGLSDPFV + L    +        T VK+ TL+PV++E  +FS
Sbjct: 1027 LAVEVLHAADLLPLDANGLSDPFVIVELGPPHLFPLVRSQRTQVKTRTLHPVYDELFYFS 1086

Query: 424  LP 429
            +P
Sbjct: 1087 VP 1088



 Score = 45.6 bits (103), Expect(2) = 5e-09
 Identities = 20/37 (54%), Positives = 25/37 (67%)
 Frame = +1

Query: 373 TSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
           T VKS TLNPVW+EHF   +   V+ D L L++WD D
Sbjct: 262 TEVKSSTLNPVWKEHFLFEIE-DVSTDQLHLDIWDHD 297



 Score = 33.9 bits (74), Expect(2) = 5e-09
 Identities = 15/38 (39%), Positives = 23/38 (60%)
 Frame = +1

Query: 244 RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNS 357
           +A    L V V+ A +L+ KDPNG SDP+  + ++  S
Sbjct: 191 KAPTYALKVSVMRAKNLLAKDPNGFSDPYCMLGILPAS 228


>AE006467-1|AAK61275.1| 1187|Homo sapiens BAI associated protein 3
            protein.
          Length = 1187

 Score = 49.6 bits (113), Expect = 6e-06
 Identities = 29/62 (46%), Positives = 39/62 (62%), Gaps = 6/62 (9%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYL----MSNSSHRYNTSVKSGTLNPVWEE--HFS 423
            L VEV+ A DL+P D NGLSDPFV + L    +        T VK+ TL+PV++E  +FS
Sbjct: 1027 LAVEVLHAADLLPLDANGLSDPFVIVELGPPHLFPLVRSQRTQVKTRTLHPVYDELFYFS 1086

Query: 424  LP 429
            +P
Sbjct: 1087 VP 1088



 Score = 45.6 bits (103), Expect(2) = 5e-09
 Identities = 20/37 (54%), Positives = 25/37 (67%)
 Frame = +1

Query: 373 TSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
           T VKS TLNPVW+EHF   +   V+ D L L++WD D
Sbjct: 262 TEVKSSTLNPVWKEHFLFEIE-DVSTDQLHLDIWDHD 297



 Score = 33.9 bits (74), Expect(2) = 5e-09
 Identities = 15/38 (39%), Positives = 23/38 (60%)
 Frame = +1

Query: 244 RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNS 357
           +A    L V V+ A +L+ KDPNG SDP+  + ++  S
Sbjct: 191 KAPTYALKVSVMRAKNLLAKDPNGFSDPYCMLGILPAS 228


>AB017111-1|BAA34710.1| 1187|Homo sapiens BAI-associated protein 3
            protein.
          Length = 1187

 Score = 49.6 bits (113), Expect = 6e-06
 Identities = 29/62 (46%), Positives = 39/62 (62%), Gaps = 6/62 (9%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYL----MSNSSHRYNTSVKSGTLNPVWEE--HFS 423
            L VEV+ A DL+P D NGLSDPFV + L    +        T VK+ TL+PV++E  +FS
Sbjct: 1027 LAVEVLHAADLLPLDANGLSDPFVIVELGPPHLFPLVRSQRTQVKTRTLHPVYDELFYFS 1086

Query: 424  LP 429
            +P
Sbjct: 1087 VP 1088



 Score = 45.6 bits (103), Expect(2) = 5e-09
 Identities = 20/37 (54%), Positives = 25/37 (67%)
 Frame = +1

Query: 373 TSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
           T VKS TLNPVW+EHF   +   V+ D L L++WD D
Sbjct: 262 TEVKSSTLNPVWKEHFLFEIE-DVSTDQLHLDIWDHD 297



 Score = 33.9 bits (74), Expect(2) = 5e-09
 Identities = 15/38 (39%), Positives = 23/38 (60%)
 Frame = +1

Query: 244 RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNS 357
           +A    L V V+ A +L+ KDPNG SDP+  + ++  S
Sbjct: 191 KAPTYALKVSVMRAKNLLAKDPNGFSDPYCMLGILPAS 228


>AL031709-4|CAM26362.1| 1169|Homo sapiens BAI1-associated protein 3
            protein.
          Length = 1169

 Score = 49.6 bits (113), Expect = 6e-06
 Identities = 29/62 (46%), Positives = 39/62 (62%), Gaps = 6/62 (9%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYL----MSNSSHRYNTSVKSGTLNPVWEE--HFS 423
            L VEV+ A DL+P D NGLSDPFV + L    +        T VK+ TL+PV++E  +FS
Sbjct: 1009 LAVEVLHAADLLPLDANGLSDPFVIVELGPPHLFPLVRSQRTQVKTRTLHPVYDELFYFS 1068

Query: 424  LP 429
            +P
Sbjct: 1069 VP 1070



 Score = 45.6 bits (103), Expect(2) = 5e-09
 Identities = 20/37 (54%), Positives = 25/37 (67%)
 Frame = +1

Query: 373 TSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
           T VKS TLNPVW+EHF   +   V+ D L L++WD D
Sbjct: 244 TEVKSSTLNPVWKEHFLFEIE-DVSTDQLHLDIWDHD 279



 Score = 33.9 bits (74), Expect(2) = 5e-09
 Identities = 15/38 (39%), Positives = 23/38 (60%)
 Frame = +1

Query: 244 RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNS 357
           +A    L V V+ A +L+ KDPNG SDP+  + ++  S
Sbjct: 173 KAPTYALKVSVMRAKNLLAKDPNGFSDPYCMLGILPAS 210


>X07109-1|CAA30130.1|  673|Homo sapiens protein ( Human mRNA for
           protein kinase C (PKC) type beta II. ).
          Length = 673

 Score = 59.7 bits (138), Expect = 6e-09
 Identities = 30/77 (38%), Positives = 45/77 (58%), Gaps = 2/77 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSN--SSHRYNTSVKSGTLNPVWEEHFSLPM 432
           +L V V +A +LVP DPNGLSDP+V + L+ +  S  +  T     +LNP W E F   +
Sbjct: 172 VLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQL 231

Query: 433 SGTVNEDSLCLEVWDFD 483
             +  +  L +E+WD+D
Sbjct: 232 KESDKDRRLSVEIWDWD 248


>X06318-1|CAA29634.1|  671|Homo sapiens protein ( Human mRNA for
           protein kinase C (PKC) type beta I. ).
          Length = 671

 Score = 59.7 bits (138), Expect = 6e-09
 Identities = 30/77 (38%), Positives = 45/77 (58%), Gaps = 2/77 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSN--SSHRYNTSVKSGTLNPVWEEHFSLPM 432
           +L V V +A +LVP DPNGLSDP+V + L+ +  S  +  T     +LNP W E F   +
Sbjct: 172 VLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQL 231

Query: 433 SGTVNEDSLCLEVWDFD 483
             +  +  L +E+WD+D
Sbjct: 232 KESDKDRRLSVEIWDWD 248


>M13975-1|AAA60095.1|  673|Homo sapiens protein kinase C beta-II
           type protein.
          Length = 673

 Score = 59.7 bits (138), Expect = 6e-09
 Identities = 30/77 (38%), Positives = 45/77 (58%), Gaps = 2/77 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSN--SSHRYNTSVKSGTLNPVWEEHFSLPM 432
           +L V V +A +LVP DPNGLSDP+V + L+ +  S  +  T     +LNP W E F   +
Sbjct: 172 VLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQL 231

Query: 433 SGTVNEDSLCLEVWDFD 483
             +  +  L +E+WD+D
Sbjct: 232 KESDKDRRLSVEIWDWD 248


>BC036472-1|AAH36472.1|  673|Homo sapiens protein kinase C, beta 1
           protein.
          Length = 673

 Score = 59.7 bits (138), Expect = 6e-09
 Identities = 30/77 (38%), Positives = 45/77 (58%), Gaps = 2/77 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSN--SSHRYNTSVKSGTLNPVWEEHFSLPM 432
           +L V V +A +LVP DPNGLSDP+V + L+ +  S  +  T     +LNP W E F   +
Sbjct: 172 VLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQL 231

Query: 433 SGTVNEDSLCLEVWDFD 483
             +  +  L +E+WD+D
Sbjct: 232 KESDKDRRLSVEIWDWD 248


>BC101025-1|AAI01026.1|  342|Homo sapiens SYT10 protein protein.
          Length = 342

 Score = 59.3 bits (137), Expect = 7e-09
 Identities = 28/76 (36%), Positives = 47/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS- 435
           +L V++++A DL  KD  G SDP+V +YL+ +   ++ T V   TLNP+++E F  P++ 
Sbjct: 66  LLVVKIIKALDLPAKDFTGTSDPYVKMYLLPDRKKKFQTRVHRKTLNPLFDETFQFPVAY 125

Query: 436 GTVNEDSLCLEVWDFD 483
             ++   L   V+DFD
Sbjct: 126 DQLSNRKLHFSVYDFD 141



 Score = 42.7 bits (96), Expect = 7e-04
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEH--FSLP 429
           + + V++  +L   D  G SDP+V + LM       +  T+ K  TLNPV+ E   F +P
Sbjct: 199 MTLTVIKCRNLKAMDITGSSDPYVKVSLMCEGRRLKKRKTTTKKNTLNPVYNEAIIFDIP 258

Query: 430 MSGTVNEDSLCLEVWDFD 483
               V++ SL + V D+D
Sbjct: 259 PE-NVDQVSLSIAVMDYD 275


>BC101024-1|AAI01025.1|  523|Homo sapiens synaptotagmin X protein.
          Length = 523

 Score = 59.3 bits (137), Expect = 7e-09
 Identities = 28/76 (36%), Positives = 47/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS- 435
           +L V++++A DL  KD  G SDP+V +YL+ +   ++ T V   TLNP+++E F  P++ 
Sbjct: 247 LLVVKIIKALDLPAKDFTGTSDPYVKMYLLPDRKKKFQTRVHRKTLNPLFDETFQFPVAY 306

Query: 436 GTVNEDSLCLEVWDFD 483
             ++   L   V+DFD
Sbjct: 307 DQLSNRKLHFSVYDFD 322



 Score = 42.7 bits (96), Expect = 7e-04
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEH--FSLP 429
           + + V++  +L   D  G SDP+V + LM       +  T+ K  TLNPV+ E   F +P
Sbjct: 380 MTLTVIKCRNLKAMDITGSSDPYVKVSLMCEGRRLKKRKTTTKKNTLNPVYNEAIIFDIP 439

Query: 430 MSGTVNEDSLCLEVWDFD 483
               V++ SL + V D+D
Sbjct: 440 PE-NVDQVSLSIAVMDYD 456


>AY198413-1|AAP37477.1|  523|Homo sapiens synaptotagmin 10 protein.
          Length = 523

 Score = 59.3 bits (137), Expect = 7e-09
 Identities = 28/76 (36%), Positives = 47/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS- 435
           +L V++++A DL  KD  G SDP+V +YL+ +   ++ T V   TLNP+++E F  P++ 
Sbjct: 247 LLVVKIIKALDLPAKDFTGTSDPYVKMYLLPDRKKKFQTRVHRKTLNPLFDETFQFPVAY 306

Query: 436 GTVNEDSLCLEVWDFD 483
             ++   L   V+DFD
Sbjct: 307 DQLSNRKLHFSVYDFD 322



 Score = 42.7 bits (96), Expect = 7e-04
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEH--FSLP 429
           + + V++  +L   D  G SDP+V + LM       +  T+ K  TLNPV+ E   F +P
Sbjct: 380 MTLTVIKCRNLKAMDITGSSDPYVKVSLMCEGRRLKKRKTTTKKNTLNPVYNEAIIFDIP 439

Query: 430 MSGTVNEDSLCLEVWDFD 483
               V++ SL + V D+D
Sbjct: 440 PE-NVDQVSLSIAVMDYD 456


>BC125170-1|AAI25171.1|  403|Homo sapiens synaptotagmin VII protein.
          Length = 403

 Score = 58.4 bits (135), Expect = 1e-08
 Identities = 32/77 (41%), Positives = 44/77 (57%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF---SLPM 432
           L V++++A +L  KD +G SDPFV IYL+ +  H+  T VK   LNP W E F     P 
Sbjct: 152 LTVKIMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPY 211

Query: 433 SGTVNEDSLCLEVWDFD 483
              V +  L L+V D+D
Sbjct: 212 EKVV-QRILYLQVLDYD 227


>AC002299-2|AAB97934.1|  496|Homo sapiens Protein kinase C beta (5'
           partial) splice form_ protein.
          Length = 496

 Score = 58.0 bits (134), Expect = 2e-08
 Identities = 27/70 (38%), Positives = 41/70 (58%), Gaps = 2/70 (2%)
 Frame = +1

Query: 280 EATDLVPKDPNGLSDPFVTIYLMSN--SSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNED 453
           +A +LVP DPNGLSDP+V + L+ +  S  +  T     +LNP W E F   +  +  + 
Sbjct: 2   DAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDR 61

Query: 454 SLCLEVWDFD 483
            L +E+WD+D
Sbjct: 62  RLSVEIWDWD 71


>AC002299-1|AAB97933.1|  494|Homo sapiens Protein kinase C beta (5'
           partial) splice form_1 protein.
          Length = 494

 Score = 58.0 bits (134), Expect = 2e-08
 Identities = 27/70 (38%), Positives = 41/70 (58%), Gaps = 2/70 (2%)
 Frame = +1

Query: 280 EATDLVPKDPNGLSDPFVTIYLMSN--SSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNED 453
           +A +LVP DPNGLSDP+V + L+ +  S  +  T     +LNP W E F   +  +  + 
Sbjct: 2   DAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDR 61

Query: 454 SLCLEVWDFD 483
            L +E+WD+D
Sbjct: 62  RLSVEIWDWD 71


>AF038535-1|AAB92667.1|  418|Homo sapiens synaptotagmin VII protein.
          Length = 418

 Score = 57.2 bits (132), Expect = 3e-08
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF---SLPM 432
           L +++++A +L  KD +G SDPFV IYL+ +  H+  T VK   LNP W E F     P 
Sbjct: 167 LTLKIMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLKTKVKRKNLNPHWNETFLFEGFPY 226

Query: 433 SGTVNEDSLCLEVWDFD 483
              V +  L L+V D+D
Sbjct: 227 EKVV-QRILYLQVLDYD 242


>BC113663-1|AAI13664.1|  803|Homo sapiens RAS p21 protein activator
           4 protein.
          Length = 803

 Score = 55.2 bits (127), Expect = 1e-07
 Identities = 30/79 (37%), Positives = 39/79 (49%)
 Frame = +1

Query: 247 ASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           A    L   V+EA DL PKD NG SDPFV +     +     TS+   +  P W E F  
Sbjct: 130 ARACRLRCSVLEARDLAPKDRNGTSDPFVRVRYKGRTR---ETSIVKKSCYPRWNETFEF 186

Query: 427 PMSGTVNEDSLCLEVWDFD 483
            +     E +LC+E WD+D
Sbjct: 187 ELQEGAME-ALCVEAWDWD 204



 Score = 31.1 bits (67), Expect = 2.2
 Identities = 19/60 (31%), Positives = 29/60 (48%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L + +VE  +L  KD  G SDP+  + + +    R  T  K  TL P W E + + +  T
Sbjct: 7   LYIRIVEGKNLPAKDITGSSDPYCIVKVDNEPIIRTATVWK--TLCPFWGEEYQVHLPPT 64


>BC110873-1|AAI10874.1|  803|Homo sapiens RAS p21 protein activator
           4 protein.
          Length = 803

 Score = 55.2 bits (127), Expect = 1e-07
 Identities = 30/79 (37%), Positives = 39/79 (49%)
 Frame = +1

Query: 247 ASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           A    L   V+EA DL PKD NG SDPFV +     +     TS+   +  P W E F  
Sbjct: 130 ARACRLRCSVLEARDLAPKDRNGTSDPFVRVRYKGRTR---ETSIVKKSCYPRWNETFEF 186

Query: 427 PMSGTVNEDSLCLEVWDFD 483
            +     E +LC+E WD+D
Sbjct: 187 ELQEGAME-ALCVEAWDWD 204



 Score = 31.1 bits (67), Expect = 2.2
 Identities = 19/60 (31%), Positives = 29/60 (48%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L + +VE  +L  KD  G SDP+  + + +    R  T  K  TL P W E + + +  T
Sbjct: 7   LYIRIVEGKNLPAKDITGSSDPYCIVKVDNEPIIRTATVWK--TLCPFWGEEYQVHLPPT 64


>AY029206-1|AAK31582.1|  803|Homo sapiens calcium-promoted Ras
           inactivator protein.
          Length = 803

 Score = 55.2 bits (127), Expect = 1e-07
 Identities = 30/79 (37%), Positives = 39/79 (49%)
 Frame = +1

Query: 247 ASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           A    L   V+EA DL PKD NG SDPFV +     +     TS+   +  P W E F  
Sbjct: 130 ARACRLRCSVLEARDLAPKDRNGTSDPFVRVRYKGRTR---ETSIVKKSCYPRWNETFEF 186

Query: 427 PMSGTVNEDSLCLEVWDFD 483
            +     E +LC+E WD+D
Sbjct: 187 ELQEGAME-ALCVEAWDWD 204



 Score = 31.1 bits (67), Expect = 2.2
 Identities = 19/60 (31%), Positives = 29/60 (48%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L + +VE  +L  KD  G SDP+  + + +    R  T  K  TL P W E + + +  T
Sbjct: 7   LYIRIVEGKNLPAKDITGSSDPYCIVKVDNEPIIRTATVWK--TLCPFWGEEYQVHLPPT 64


>AC105052-1|AAP22345.1|  724|Homo sapiens unknown protein.
          Length = 724

 Score = 55.2 bits (127), Expect = 1e-07
 Identities = 30/79 (37%), Positives = 39/79 (49%)
 Frame = +1

Query: 247 ASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           A    L   V+EA DL PKD NG SDPFV +     +     TS+   +  P W E F  
Sbjct: 153 ARACRLRCSVLEARDLAPKDRNGTSDPFVRVRYKGRTR---ETSIVKKSCYPRWNETFEF 209

Query: 427 PMSGTVNEDSLCLEVWDFD 483
            +     E +LC+E WD+D
Sbjct: 210 ELQEGAME-ALCVEAWDWD 227


>AB011110-1|BAA25464.2|  816|Homo sapiens KIAA0538 protein protein.
          Length = 816

 Score = 55.2 bits (127), Expect = 1e-07
 Identities = 30/79 (37%), Positives = 39/79 (49%)
 Frame = +1

Query: 247 ASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           A    L   V+EA DL PKD NG SDPFV +     +     TS+   +  P W E F  
Sbjct: 143 ARACRLRCSVLEARDLAPKDRNGTSDPFVRVRYKGRTR---ETSIVKKSCYPRWNETFEF 199

Query: 427 PMSGTVNEDSLCLEVWDFD 483
            +     E +LC+E WD+D
Sbjct: 200 ELQEGAME-ALCVEAWDWD 217



 Score = 31.1 bits (67), Expect = 2.2
 Identities = 19/60 (31%), Positives = 29/60 (48%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L + +VE  +L  KD  G SDP+  + + +    R  T  K  TL P W E + + +  T
Sbjct: 20  LYIRIVEGKNLPAKDITGSSDPYCIVKVDNEPIIRTATVWK--TLCPFWGEEYQVHLPPT 77


>BC046367-1|AAH46367.1|  491|Homo sapiens synaptotagmin IX protein.
          Length = 491

 Score = 54.4 bits (125), Expect = 2e-07
 Identities = 29/75 (38%), Positives = 44/75 (58%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V++ +A +L  KD +G SDP+V IYL+ +   ++ T V   TLNPV++E F  P+   
Sbjct: 237 LIVKIHKAVNLPAKDFSGTSDPYVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVPYN 296

Query: 439 TVNEDSLCLEVWDFD 483
            +    L   V+DFD
Sbjct: 297 DLEARKLHFSVYDFD 311



 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEH--FSLP 429
           L + +++A +L   D  G SDP+V + LM +     +  TS K  TLNPV+ E   F +P
Sbjct: 369 LTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIVFDVP 428

Query: 430 MSGTVNEDSLCLEVWDFD 483
               +++  L + V D+D
Sbjct: 429 PE-NIDQIHLSIAVMDYD 445


>BC029605-1|AAH29605.1|  319|Homo sapiens SYT9 protein protein.
          Length = 319

 Score = 54.4 bits (125), Expect = 2e-07
 Identities = 29/75 (38%), Positives = 44/75 (58%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V++ +A +L  KD +G SDP+V IYL+ +   ++ T V   TLNPV++E F  P+   
Sbjct: 205 LIVKIHKAVNLPAKDFSGTSDPYVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVPYN 264

Query: 439 TVNEDSLCLEVWDFD 483
            +    L   V+DFD
Sbjct: 265 DLEARKLHFSVYDFD 279


>BC044948-1|AAH44948.1|  425|Homo sapiens synaptotagmin VI protein.
          Length = 425

 Score = 54.0 bits (124), Expect = 3e-07
 Identities = 30/75 (40%), Positives = 44/75 (58%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V +++A DL  KD  G SDP+V IYL+ +   +  T V   TLNP ++E+F  P+   
Sbjct: 161 LIVRILKAFDLPAKDFCGSSDPYVKIYLLPDRKCKLQTRVHRKTLNPTFDENFHFPVPYE 220

Query: 439 TVNEDSLCLEVWDFD 483
            + +  L L V+DFD
Sbjct: 221 ELADRKLHLSVFDFD 235



 Score = 43.6 bits (98), Expect = 4e-04
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEH--FSLP 429
           L + V++  +L   D  G SDP+V + L+ +     +  T++K  TLNPV+ E   F +P
Sbjct: 293 LTLTVIKCRNLKAMDITGYSDPYVKVSLLCDGRRLKKKKTTIKKNTLNPVYNEAIIFDIP 352

Query: 430 MSGTVNEDSLCLEVWDFD 483
               +++ SL + V D+D
Sbjct: 353 PE-NMDQVSLLISVMDYD 369


>AL162594-4|CAM27152.1|  510|Homo sapiens synaptotagmin VI protein.
          Length = 510

 Score = 54.0 bits (124), Expect = 3e-07
 Identities = 30/75 (40%), Positives = 44/75 (58%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V +++A DL  KD  G SDP+V IYL+ +   +  T V   TLNP ++E+F  P+   
Sbjct: 246 LIVRILKAFDLPAKDFCGSSDPYVKIYLLPDRKCKLQTRVHRKTLNPTFDENFHFPVPYE 305

Query: 439 TVNEDSLCLEVWDFD 483
            + +  L L V+DFD
Sbjct: 306 ELADRKLHLSVFDFD 320



 Score = 43.6 bits (98), Expect = 4e-04
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEH--FSLP 429
           L + V++  +L   D  G SDP+V + L+ +     +  T++K  TLNPV+ E   F +P
Sbjct: 378 LTLTVIKCRNLKAMDITGYSDPYVKVSLLCDGRRLKKKKTTIKKNTLNPVYNEAIIFDIP 437

Query: 430 MSGTVNEDSLCLEVWDFD 483
               +++ SL + V D+D
Sbjct: 438 PE-NMDQVSLLISVMDYD 454


>AL162594-2|CAI18964.1|  425|Homo sapiens synaptotagmin VI protein.
          Length = 425

 Score = 54.0 bits (124), Expect = 3e-07
 Identities = 30/75 (40%), Positives = 44/75 (58%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V +++A DL  KD  G SDP+V IYL+ +   +  T V   TLNP ++E+F  P+   
Sbjct: 161 LIVRILKAFDLPAKDFCGSSDPYVKIYLLPDRKCKLQTRVHRKTLNPTFDENFHFPVPYE 220

Query: 439 TVNEDSLCLEVWDFD 483
            + +  L L V+DFD
Sbjct: 221 ELADRKLHLSVFDFD 235



 Score = 43.6 bits (98), Expect = 4e-04
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEH--FSLP 429
           L + V++  +L   D  G SDP+V + L+ +     +  T++K  TLNPV+ E   F +P
Sbjct: 293 LTLTVIKCRNLKAMDITGYSDPYVKVSLLCDGRRLKKKKTTIKKNTLNPVYNEAIIFDIP 352

Query: 430 MSGTVNEDSLCLEVWDFD 483
               +++ SL + V D+D
Sbjct: 353 PE-NMDQVSLLISVMDYD 369


>AB209671-1|BAD92908.1|  239|Homo sapiens protein kinase C, gamma
           variant protein.
          Length = 239

 Score = 53.6 bits (123), Expect = 4e-07
 Identities = 26/57 (45%), Positives = 36/57 (63%), Gaps = 2/57 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSL 426
           ++V V EA +L+P DPNGLSDP+V + L+ +  +  +  T     TLNPVW E F L
Sbjct: 183 IHVTVGEARNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVL 239


>M55047-1|AAA60609.1|  422|Homo sapiens synaptotagmin p65 protein.
          Length = 422

 Score = 53.2 bits (122), Expect = 5e-07
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V +++A +L   D  G SDP+V ++L+ +   ++ T V   TLNPV+ E F+  +   
Sbjct: 159 LLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYS 218

Query: 439 TVNEDSLCLEVWDFD 483
            +   +L + V+DFD
Sbjct: 219 ELGGKTLVMAVYDFD 233



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           L V ++EA +L   D  GLSDP+V I+LM N     +  T++K  TLNP + E FS  + 
Sbjct: 290 LTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVP 349

Query: 436 -GTVNEDSLCLEVWDFD 483
              + +  + + V D+D
Sbjct: 350 FEQIQKVQVVVTVLDYD 366


>BC108289-1|AAI08290.1|  423|Homo sapiens PCLO protein protein.
          Length = 423

 Score = 53.2 bits (122), Expect = 5e-07
 Identities = 28/79 (35%), Positives = 45/79 (56%), Gaps = 5/79 (6%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVK--SGTLNPVWEE---HFSL 426
           L + +++A +LVP+D NG SDPFV +YL+      Y    K    +LNP W +   + S+
Sbjct: 206 LIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGAEYKRRTKHVQKSLNPEWNQTVIYKSI 265

Query: 427 PMSGTVNEDSLCLEVWDFD 483
            M   + + +L + VWD+D
Sbjct: 266 SME-QLKKKTLEVTVWDYD 283


>BC058917-1|AAH58917.1|  422|Homo sapiens SYT1 protein protein.
          Length = 422

 Score = 53.2 bits (122), Expect = 5e-07
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V +++A +L   D  G SDP+V ++L+ +   ++ T V   TLNPV+ E F+  +   
Sbjct: 159 LLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYS 218

Query: 439 TVNEDSLCLEVWDFD 483
            +   +L + V+DFD
Sbjct: 219 ELGGKTLVMAVYDFD 233



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           L V ++EA +L   D  GLSDP+V I+LM N     +  T++K  TLNP + E FS  + 
Sbjct: 290 LTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVP 349

Query: 436 -GTVNEDSLCLEVWDFD 483
              + +  + + V D+D
Sbjct: 350 FEQIQKVQVVVTVLDYD 366


>BC001304-1|AAH01304.2|  356|Homo sapiens PCLO protein protein.
          Length = 356

 Score = 53.2 bits (122), Expect = 5e-07
 Identities = 28/79 (35%), Positives = 45/79 (56%), Gaps = 5/79 (6%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVK--SGTLNPVWEE---HFSL 426
           L + +++A +LVP+D NG SDPFV +YL+      Y    K    +LNP W +   + S+
Sbjct: 139 LIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGAEYKRRTKHVQKSLNPEWNQTVIYKSI 198

Query: 427 PMSGTVNEDSLCLEVWDFD 483
            M   + + +L + VWD+D
Sbjct: 199 SME-QLKKKTLEVTVWDYD 216


>AC004082-1|AAB97937.1|  743|Homo sapiens WUGSC:H_DJ0897G10.1
           protein.
          Length = 743

 Score = 53.2 bits (122), Expect = 5e-07
 Identities = 28/79 (35%), Positives = 45/79 (56%), Gaps = 5/79 (6%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVK--SGTLNPVWEE---HFSL 426
           L + +++A +LVP+D NG SDPFV +YL+      Y    K    +LNP W +   + S+
Sbjct: 140 LIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGAEYKRRTKHVQKSLNPEWNQTVIYKSI 199

Query: 427 PMSGTVNEDSLCLEVWDFD 483
            M   + + +L + VWD+D
Sbjct: 200 SME-QLKKKTLEVTVWDYD 217


>BC100817-1|AAI00818.1|  419|Homo sapiens synaptotagmin II protein.
          Length = 419

 Score = 52.0 bits (119), Expect = 1e-06
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V V++A +L   D  G SDP+V ++L+ +   +Y T V   TLNP + E F+  +   
Sbjct: 156 LTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQ 215

Query: 439 TVNEDSLCLEVWDFD 483
            +   +L + ++DFD
Sbjct: 216 ELGGKTLVMAIYDFD 230



 Score = 50.0 bits (114), Expect = 4e-06
 Identities = 29/77 (37%), Positives = 43/77 (55%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           L V ++EA +L   D  GLSDP+V I+LM N     +  T+VK  TLNP + E FS  + 
Sbjct: 287 LTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIP 346

Query: 436 -GTVNEDSLCLEVWDFD 483
              + +  + + V D+D
Sbjct: 347 FEQIQKVQVVVTVLDYD 363


>BC100816-1|AAI00817.1|  317|Homo sapiens SYT2 protein protein.
          Length = 317

 Score = 52.0 bits (119), Expect = 1e-06
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V V++A +L   D  G SDP+V ++L+ +   +Y T V   TLNP + E F+  +   
Sbjct: 54  LTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQ 113

Query: 439 TVNEDSLCLEVWDFD 483
            +   +L + ++DFD
Sbjct: 114 ELGGKTLVMAIYDFD 128



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 30/77 (38%), Positives = 44/77 (57%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           L V ++EA +L   D  GLSDP+V I+LM N     +  T+VK  TLNP + E FSL + 
Sbjct: 185 LTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSLEIP 244

Query: 436 -GTVNEDSLCLEVWDFD 483
              + +  + + V D+D
Sbjct: 245 FEQIQKVQVVVTVLDYD 261


>BC100815-1|AAI00816.1|  419|Homo sapiens synaptotagmin II protein.
          Length = 419

 Score = 52.0 bits (119), Expect = 1e-06
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V V++A +L   D  G SDP+V ++L+ +   +Y T V   TLNP + E F+  +   
Sbjct: 156 LTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQ 215

Query: 439 TVNEDSLCLEVWDFD 483
            +   +L + ++DFD
Sbjct: 216 ELGGKTLVMAIYDFD 230



 Score = 50.0 bits (114), Expect = 4e-06
 Identities = 29/77 (37%), Positives = 43/77 (55%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           L V ++EA +L   D  GLSDP+V I+LM N     +  T+VK  TLNP + E FS  + 
Sbjct: 287 LTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIP 346

Query: 436 -GTVNEDSLCLEVWDFD 483
              + +  + + V D+D
Sbjct: 347 FEQIQKVQVVVTVLDYD 363


>BC100814-1|AAI00815.1|  419|Homo sapiens synaptotagmin II protein.
          Length = 419

 Score = 52.0 bits (119), Expect = 1e-06
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V V++A +L   D  G SDP+V ++L+ +   +Y T V   TLNP + E F+  +   
Sbjct: 156 LTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQ 215

Query: 439 TVNEDSLCLEVWDFD 483
            +   +L + ++DFD
Sbjct: 216 ELGGKTLVMAIYDFD 230



 Score = 50.0 bits (114), Expect = 4e-06
 Identities = 29/77 (37%), Positives = 43/77 (55%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           L V ++EA +L   D  GLSDP+V I+LM N     +  T+VK  TLNP + E FS  + 
Sbjct: 287 LTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIP 346

Query: 436 -GTVNEDSLCLEVWDFD 483
              + +  + + V D+D
Sbjct: 347 FEQIQKVQVVVTVLDYD 363


>AK094430-1|BAC04354.1|  419|Homo sapiens protein ( Homo sapiens
           cDNA FLJ37111 fis, clone BRACE2021254, highly similar to
           SYNAPTOTAGMIN II. ).
          Length = 419

 Score = 52.0 bits (119), Expect = 1e-06
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V V++A +L   D  G SDP+V ++L+ +   +Y T V   TLNP + E F+  +   
Sbjct: 156 LTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQ 215

Query: 439 TVNEDSLCLEVWDFD 483
            +   +L + ++DFD
Sbjct: 216 ELGGKTLVMAIYDFD 230



 Score = 47.2 bits (107), Expect = 3e-05
 Identities = 28/77 (36%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           L V ++EA +L   D  GLSDP+  I+LM N     +  T+VK  TLNP + E FS  + 
Sbjct: 287 LTVCILEAKNLKKMDVGGLSDPYGKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIP 346

Query: 436 -GTVNEDSLCLEVWDFD 483
              + +  + + V D+D
Sbjct: 347 FEQIQKVQVVVTVLDYD 363


>AK090672-1|BAC03500.1|  419|Homo sapiens protein ( Homo sapiens
           cDNA FLJ33353 fis, clone BRACE2005118, highly similar to
           SYNAPTOTAGMIN II. ).
          Length = 419

 Score = 52.0 bits (119), Expect = 1e-06
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS-G 438
           L V V++A +L   D  G SDP+V ++L+ +   +Y T V   TLNP + E F+  +   
Sbjct: 156 LTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQ 215

Query: 439 TVNEDSLCLEVWDFD 483
            +   +L + ++DFD
Sbjct: 216 ELGGKTLVMAIYDFD 230



 Score = 50.0 bits (114), Expect = 4e-06
 Identities = 29/77 (37%), Positives = 43/77 (55%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMS 435
           L V ++EA +L   D  GLSDP+V I+LM N     +  T+VK  TLNP + E FS  + 
Sbjct: 287 LTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIP 346

Query: 436 -GTVNEDSLCLEVWDFD 483
              + +  + + V D+D
Sbjct: 347 FEQIQKVQVVVTVLDYD 363


>X96783-1|CAA65579.1|  386|Homo sapiens synaptotagmin V protein.
          Length = 386

 Score = 49.2 bits (112), Expect = 8e-06
 Identities = 29/79 (36%), Positives = 43/79 (54%), Gaps = 1/79 (1%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
           SG +L V +++A  L   D  G SDP+V +YL+ +   RY T V   TLNP + E F+  
Sbjct: 122 SGQLL-VGILQAMGLAALDLGGSSDPYVRVYLLXDKRRRYETKVHRQTLNPHFGETFAFK 180

Query: 430 MSGT-VNEDSLCLEVWDFD 483
           +    +    L + V+DFD
Sbjct: 181 VPYVELGGRVLVMAVYDFD 199



 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 28/77 (36%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSS--HRYNTSVKSGTLNPVWEEHFSLPM- 432
           L V V+EA +L   D  GLSDP+V ++L+       +  T++K  TLNP + E FS  + 
Sbjct: 256 LTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKNTLNPYYNEAFSFEVP 315

Query: 433 SGTVNEDSLCLEVWDFD 483
              V +  + L V D+D
Sbjct: 316 CDQVQKVQVELTVLDYD 332


>DQ090951-1|AAY99640.1|  385|Homo sapiens synaptotagmin V protein.
          Length = 385

 Score = 49.2 bits (112), Expect = 8e-06
 Identities = 29/79 (36%), Positives = 43/79 (54%), Gaps = 1/79 (1%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
           SG +L V +++A  L   D  G SDP+V +YL+ +   RY T V   TLNP + E F+  
Sbjct: 122 SGQLL-VGILQAMGLAALDLGGSSDPYVRVYLLPDKRRRYETKVHRQTLNPHFGETFAFK 180

Query: 430 MSGT-VNEDSLCLEVWDFD 483
           +    +    L + V+DFD
Sbjct: 181 VPYVELGGRVLVMAVYDFD 199



 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 28/77 (36%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSS--HRYNTSVKSGTLNPVWEEHFSLPM- 432
           L V V+EA +L   D  GLSDP+V ++L+       +  T++K  TLNP + E FS  + 
Sbjct: 255 LTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKNTLNPYYNEAFSFEVP 314

Query: 433 SGTVNEDSLCLEVWDFD 483
              V +  + L V D+D
Sbjct: 315 CDQVQKVQVELTVLDYD 331


>BC046157-1|AAH46157.1|  386|Homo sapiens synaptotagmin V protein.
          Length = 386

 Score = 49.2 bits (112), Expect = 8e-06
 Identities = 29/79 (36%), Positives = 43/79 (54%), Gaps = 1/79 (1%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
           SG +L V +++A  L   D  G SDP+V +YL+ +   RY T V   TLNP + E F+  
Sbjct: 122 SGQLL-VGILQAMGLAALDLGGSSDPYVRVYLLPDKRRRYETKVHRQTLNPHFGETFAFK 180

Query: 430 MSGT-VNEDSLCLEVWDFD 483
           +    +    L + V+DFD
Sbjct: 181 VPYVELGGRVLVMAVYDFD 199



 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 28/77 (36%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSS--HRYNTSVKSGTLNPVWEEHFSLPM- 432
           L V V+EA +L   D  GLSDP+V ++L+       +  T++K  TLNP + E FS  + 
Sbjct: 256 LTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKNTLNPYYNEAFSFEVP 315

Query: 433 SGTVNEDSLCLEVWDFD 483
              V +  + L V D+D
Sbjct: 316 CDQVQKVQVELTVLDYD 332


>BC033683-1|AAH33683.1|  344|Homo sapiens SYT5 protein protein.
          Length = 344

 Score = 49.2 bits (112), Expect = 8e-06
 Identities = 29/79 (36%), Positives = 43/79 (54%), Gaps = 1/79 (1%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
           SG +L V +++A  L   D  G SDP+V +YL+ +   RY T V   TLNP + E F+  
Sbjct: 122 SGQLL-VGILQAMGLAALDLGGSSDPYVRVYLLPDKRRRYETKVHRQTLNPHFGETFAFK 180

Query: 430 MSGT-VNEDSLCLEVWDFD 483
           +    +    L + V+DFD
Sbjct: 181 VPYVELGGRVLVMAVYDFD 199



 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 28/77 (36%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSS--HRYNTSVKSGTLNPVWEEHFSLPM- 432
           L V V+EA +L   D  GLSDP+V ++L+       +  T++K  TLNP + E FS  + 
Sbjct: 255 LTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKNTLNPYYNEAFSFEVP 314

Query: 433 SGTVNEDSLCLEVWDFD 483
              V +  + L V D+D
Sbjct: 315 CDQVQKVQVELTVLDYD 331


>D31897-1|BAA06695.1|  400|Homo sapiens Doc2 protein.
          Length = 400

 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 25/66 (37%), Positives = 40/66 (60%), Gaps = 2/66 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNS--SHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L+V ++ A  L P D NGL+DP+V ++L+  +  +++  T  +  TLNPVW E   L  S
Sbjct: 106 LHVCILRAKGLKPMDFNGLADPYVKLHLLPGACKANKLKTKTQRNTLNPVWNE--DLTYS 163

Query: 436 GTVNED 453
           G  ++D
Sbjct: 164 GITDDD 169


>BC146779-1|AAI46780.1| 1669|Homo sapiens intersectin 2 protein.
          Length = 1669

 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 32/88 (36%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 223  SYQSGG*RASGL-MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLN 399
            +YQ+   + SG+  L V V+EAT+L    PNG S+P+  I   S  S  Y T     TLN
Sbjct: 1529 AYQARSQKTSGIGRLMVHVIEATELKACKPNGKSNPYCEI---SMGSQSYTTRTIQDTLN 1585

Query: 400  PVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
            P W  +    +   + +D LCL ++D D
Sbjct: 1586 PKWNFNCQFFIK-DLYQDVLCLTLFDRD 1612


>AK091491-1|BAC03675.1|  891|Homo sapiens protein ( Homo sapiens
           cDNA FLJ34172 fis, clone FCBBF3015758, highly similar to
           Rattus norvegicus Munc13-3 mRNA. ).
          Length = 891

 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 27/74 (36%), Positives = 37/74 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + + VV A  L  KD  G SDP+VT+ +  N   +  T    G LNPVW+E F      +
Sbjct: 188 ITITVVSAQGLQAKDKTGSSDPYVTVQVGKN---KRRTKTIFGNLNPVWDEKFYFECHNS 244

Query: 442 VNEDSLCLEVWDFD 483
              D + + VWD D
Sbjct: 245 T--DRIKVRVWDED 256


>AK000302-1|BAA91068.1|  436|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20295 fis, clone HEP05888. ).
          Length = 436

 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 32/88 (36%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 223 SYQSGG*RASGL-MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLN 399
           +YQ+   + SG+  L V V+EAT+L    PNG S+P+  I   S  S  Y T     TLN
Sbjct: 296 AYQARSQKTSGIGRLMVHVIEATELKACKPNGKSNPYCEI---SMGSQSYTTRTIQDTLN 352

Query: 400 PVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
           P W  +    +   + +D LCL ++D D
Sbjct: 353 PKWNFNCQFFIK-DLYQDVLCLTLFDRD 379


>AF248540-1|AAF63600.1| 1681|Homo sapiens intersectin 2 protein.
          Length = 1681

 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 32/88 (36%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 223  SYQSGG*RASGL-MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLN 399
            +YQ+   + SG+  L V V+EAT+L    PNG S+P+  I   S  S  Y T     TLN
Sbjct: 1541 AYQARSQKTSGIGRLMVHVIEATELKACKPNGKSNPYCEI---SMGSQSYTTRTIQDTLN 1597

Query: 400  PVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
            P W  +    +   + +D LCL ++D D
Sbjct: 1598 PKWNFNCQFFIK-DLYQDVLCLTLFDRD 1624


>AF182198-1|AAF59903.1| 1696|Homo sapiens intersectin 2 long isoform
            protein.
          Length = 1696

 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 32/88 (36%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 223  SYQSGG*RASGL-MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLN 399
            +YQ+   + SG+  L V V+EAT+L    PNG S+P+  I   S  S  Y T     TLN
Sbjct: 1556 AYQARSQKTSGIGRLMVHVIEATELKACKPNGKSNPYCEI---SMGSQSYTTRTIQDTLN 1612

Query: 400  PVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
            P W  +    +   + +D LCL ++D D
Sbjct: 1613 PKWNFNCQFFIK-DLYQDVLCLTLFDRD 1639


>AC008073-6|AAY14668.1|  367|Homo sapiens unknown protein.
          Length = 367

 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 32/88 (36%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 223 SYQSGG*RASGL-MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLN 399
           +YQ+   + SG+  L V V+EAT+L    PNG S+P+  I   S  S  Y T     TLN
Sbjct: 227 AYQARSQKTSGIGRLMVHVIEATELKACKPNGKSNPYCEI---SMGSQSYTTRTIQDTLN 283

Query: 400 PVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
           P W  +    +   + +D LCL ++D D
Sbjct: 284 PKWNFNCQFFIK-DLYQDVLCLTLFDRD 310


>AB033082-1|BAA86570.1| 1676|Homo sapiens KIAA1256 protein protein.
          Length = 1676

 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 32/88 (36%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 223  SYQSGG*RASGL-MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLN 399
            +YQ+   + SG+  L V V+EAT+L    PNG S+P+  I   S  S  Y T     TLN
Sbjct: 1536 AYQARSQKTSGIGRLMVHVIEATELKACKPNGKSNPYCEI---SMGSQSYTTRTIQDTLN 1592

Query: 400  PVWEEHFSLPMSGTVNEDSLCLEVWDFD 483
            P W  +    +   + +D LCL ++D D
Sbjct: 1593 PKWNFNCQFFIK-DLYQDVLCLTLFDRD 1619


>BC111800-1|AAI11801.1| 1197|Homo sapiens UNC13B protein protein.
          Length = 1197

 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 28/74 (37%), Positives = 37/74 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + + VV A  L  KD  G SDP+VT+ +   S  +  T    G LNPVWEE F       
Sbjct: 189 ITITVVCAQGLQAKDKTGSSDPYVTVQV---SKTKKRTKTIFGNLNPVWEEKFHFECHN- 244

Query: 442 VNEDSLCLEVWDFD 483
            + D + + VWD D
Sbjct: 245 -SSDRIKVRVWDED 257


>BC111781-1|AAI11782.1| 1610|Homo sapiens UNC13B protein protein.
          Length = 1610

 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 28/74 (37%), Positives = 37/74 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + + VV A  L  KD  G SDP+VT+ +   S  +  T    G LNPVWEE F       
Sbjct: 602 ITITVVCAQGLQAKDKTGSSDPYVTVQV---SKTKKRTKTIFGNLNPVWEEKFHFECHN- 657

Query: 442 VNEDSLCLEVWDFD 483
            + D + + VWD D
Sbjct: 658 -SSDRIKVRVWDED 670


>BC063436-1|AAH63436.1|  400|Homo sapiens DOC2A protein protein.
          Length = 400

 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 24/66 (36%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNS--SHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L+  ++ A  L P D NGL+DP+V ++L+  +  +++  T  +  TLNPVW E   L  S
Sbjct: 106 LHCSILRAKGLKPMDFNGLADPYVKLHLLPGACKANKLKTKTQRNTLNPVWNE--DLTYS 163

Query: 436 GTVNED 453
           G  ++D
Sbjct: 164 GITDDD 169


>BC055284-1|AAH55284.1|  400|Homo sapiens double C2-like domains,
           alpha protein.
          Length = 400

 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 24/66 (36%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNS--SHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L+  ++ A  L P D NGL+DP+V ++L+  +  +++  T  +  TLNPVW E   L  S
Sbjct: 106 LHCSILRAKGLKPMDFNGLADPYVKLHLLPGACKANKLKTKTQRNTLNPVWNE--DLTYS 163

Query: 436 GTVNED 453
           G  ++D
Sbjct: 164 GITDDD 169


>BC041769-1|AAH41769.2|  400|Homo sapiens DOC2A protein protein.
          Length = 400

 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 24/66 (36%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNS--SHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L+  ++ A  L P D NGL+DP+V ++L+  +  +++  T  +  TLNPVW E   L  S
Sbjct: 106 LHCSILRAKGLKPMDFNGLADPYVKLHLLPGACKANKLKTKTQRNTLNPVWNE--DLTYS 163

Query: 436 GTVNED 453
           G  ++D
Sbjct: 164 GITDDD 169


>AL354669-2|CAH71207.1| 1622|Homo sapiens unc-13 homolog B (C.
           elegans) protein.
          Length = 1622

 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 28/74 (37%), Positives = 37/74 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + + VV A  L  KD  G SDP+VT+ +   S  +  T    G LNPVWEE F       
Sbjct: 614 ITITVVCAQGLQAKDKTGSSDPYVTVQV---SKTKKRTKTIFGNLNPVWEEKFHFECHN- 669

Query: 442 VNEDSLCLEVWDFD 483
            + D + + VWD D
Sbjct: 670 -SSDRIKVRVWDED 682


>AL354669-1|CAH71208.1| 1591|Homo sapiens unc-13 homolog B (C.
           elegans) protein.
          Length = 1591

 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 28/74 (37%), Positives = 37/74 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + + VV A  L  KD  G SDP+VT+ +   S  +  T    G LNPVWEE F       
Sbjct: 602 ITITVVCAQGLQAKDKTGSSDPYVTVQV---SKTKKRTKTIFGNLNPVWEEKFHFECHN- 657

Query: 442 VNEDSLCLEVWDFD 483
            + D + + VWD D
Sbjct: 658 -SSDRIKVRVWDED 670


>AL353795-12|CAH71003.1| 1622|Homo sapiens unc-13 homolog B (C.
           elegans) protein.
          Length = 1622

 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 28/74 (37%), Positives = 37/74 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + + VV A  L  KD  G SDP+VT+ +   S  +  T    G LNPVWEE F       
Sbjct: 614 ITITVVCAQGLQAKDKTGSSDPYVTVQV---SKTKKRTKTIFGNLNPVWEEKFHFECHN- 669

Query: 442 VNEDSLCLEVWDFD 483
            + D + + VWD D
Sbjct: 670 -SSDRIKVRVWDED 682


>AL353795-11|CAH71004.1| 1591|Homo sapiens unc-13 homolog B (C.
           elegans) protein.
          Length = 1591

 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 28/74 (37%), Positives = 37/74 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + + VV A  L  KD  G SDP+VT+ +   S  +  T    G LNPVWEE F       
Sbjct: 602 ITITVVCAQGLQAKDKTGSSDPYVTVQV---SKTKKRTKTIFGNLNPVWEEKFHFECHN- 657

Query: 442 VNEDSLCLEVWDFD 483
            + D + + VWD D
Sbjct: 658 -SSDRIKVRVWDED 670


>AL160274-2|CAH73362.1| 1622|Homo sapiens unc-13 homolog B (C.
           elegans) protein.
          Length = 1622

 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 28/74 (37%), Positives = 37/74 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + + VV A  L  KD  G SDP+VT+ +   S  +  T    G LNPVWEE F       
Sbjct: 614 ITITVVCAQGLQAKDKTGSSDPYVTVQV---SKTKKRTKTIFGNLNPVWEEKFHFECHN- 669

Query: 442 VNEDSLCLEVWDFD 483
            + D + + VWD D
Sbjct: 670 -SSDRIKVRVWDED 682


>AL160274-1|CAH73361.1| 1591|Homo sapiens unc-13 homolog B (C.
           elegans) protein.
          Length = 1591

 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 28/74 (37%), Positives = 37/74 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + + VV A  L  KD  G SDP+VT+ +   S  +  T    G LNPVWEE F       
Sbjct: 602 ITITVVCAQGLQAKDKTGSSDPYVTVQV---SKTKKRTKTIFGNLNPVWEEKFHFECHN- 657

Query: 442 VNEDSLCLEVWDFD 483
            + D + + VWD D
Sbjct: 658 -SSDRIKVRVWDED 670


>AF020202-1|AAC19406.1| 1591|Homo sapiens Munc13 protein.
          Length = 1591

 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 28/74 (37%), Positives = 37/74 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + + VV A  L  KD  G SDP+VT+ +   S  +  T    G LNPVWEE F       
Sbjct: 602 ITITVVCAQGLQAKDKTGSSDPYVTVQV---SKTKKRTKTIFGNLNPVWEEKFHFECHN- 657

Query: 442 VNEDSLCLEVWDFD 483
            + D + + VWD D
Sbjct: 658 -SSDRIKVRVWDED 670


>AB209998-1|BAE06080.1| 1620|Homo sapiens UNC13B variant protein
           protein.
          Length = 1620

 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 28/74 (37%), Positives = 37/74 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + + VV A  L  KD  G SDP+VT+ +   S  +  T    G LNPVWEE F       
Sbjct: 631 ITITVVCAQGLQAKDKTGSSDPYVTVQV---SKTKKRTKTIFGNLNPVWEEKFHFECHN- 686

Query: 442 VNEDSLCLEVWDFD 483
            + D + + VWD D
Sbjct: 687 -SSDRIKVRVWDED 699


>AB028955-1|BAA82984.2| 1702|Homo sapiens KIAA1032 protein protein.
          Length = 1702

 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 27/74 (36%), Positives = 38/74 (51%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           +++ VV A  L  KD  G SDP+VT+ +      +  T    G LNPVWEE+F       
Sbjct: 677 ISITVVCAQGLQAKDKTGSSDPYVTVQV---GKTKKRTKTIYGNLNPVWEENFHFECHN- 732

Query: 442 VNEDSLCLEVWDFD 483
            + D + + VWD D
Sbjct: 733 -SSDRIKVRVWDED 745


>AB011131-1|BAA25485.1| 1212|Homo sapiens KIAA0559 protein protein.
          Length = 1212

 Score = 47.6 bits (108), Expect = 2e-05
 Identities = 30/88 (34%), Positives = 48/88 (54%), Gaps = 14/88 (15%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLM---------SNSSHRYNTSVK--SGTLNPVW 408
            L + +++A +LVP+D NG SDPFV +YL+          N+S  Y    K    +LNP W
Sbjct: 986  LIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGQVMVVQNASAEYKRRTKHVQKSLNPEW 1045

Query: 409  EE---HFSLPMSGTVNEDSLCLEVWDFD 483
             +   + S+ M   + + +L + VWD+D
Sbjct: 1046 NQTVIYKSISME-QLKKKTLEVTVWDYD 1072


>BC017259-1|AAH17259.1|  690|Homo sapiens rabphilin 3A homolog
           (mouse) protein.
          Length = 690

 Score = 47.2 bits (107), Expect = 3e-05
 Identities = 23/66 (34%), Positives = 38/66 (57%), Gaps = 2/66 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L   +++A  L P D NGL+DP+V ++L+  ++ S++  T     T NP+W E  +L   
Sbjct: 405 LQCTIIKAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPIWNE--TLVYH 462

Query: 436 GTVNED 453
           G  +ED
Sbjct: 463 GITDED 468


>BC009843-1|AAH09843.1|  621|Homo sapiens Unknown (protein for
           IMAGE:3944479) protein.
          Length = 621

 Score = 47.2 bits (107), Expect = 3e-05
 Identities = 23/66 (34%), Positives = 38/66 (57%), Gaps = 2/66 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L   +++A  L P D NGL+DP+V ++L+  ++ S++  T     T NP+W E  +L   
Sbjct: 405 LQCTIIKAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPIWNE--TLVYH 462

Query: 436 GTVNED 453
           G  +ED
Sbjct: 463 GITDED 468


>BC002605-1|AAH02605.1|  607|Homo sapiens Unknown (protein for
           IMAGE:3160482) protein.
          Length = 607

 Score = 47.2 bits (107), Expect = 3e-05
 Identities = 23/66 (34%), Positives = 38/66 (57%), Gaps = 2/66 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L   +++A  L P D NGL+DP+V ++L+  ++ S++  T     T NP+W E  +L   
Sbjct: 405 LQCTIIKAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPIWNE--TLVYH 462

Query: 436 GTVNED 453
           G  +ED
Sbjct: 463 GITDED 468


>AB023202-1|BAA76829.2|  697|Homo sapiens KIAA0985 protein protein.
          Length = 697

 Score = 47.2 bits (107), Expect = 3e-05
 Identities = 23/66 (34%), Positives = 38/66 (57%), Gaps = 2/66 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L   +++A  L P D NGL+DP+V ++L+  ++ S++  T     T NP+W E  +L   
Sbjct: 412 LQCTIIKAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPIWNE--TLVYH 469

Query: 436 GTVNED 453
           G  +ED
Sbjct: 470 GITDED 475


>D70830-1|BAA11107.1|  412|Homo sapiens Doc2 beta protein.
          Length = 412

 Score = 46.8 bits (106), Expect = 4e-05
 Identities = 24/68 (35%), Positives = 38/68 (55%), Gaps = 2/68 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSS--HRYNTSVKSGTLNPVWEEHFSLPMS 435
           L+  + +A  L P D NGL+DP+V ++L+  +S  ++  T     TLNP W E  +L   
Sbjct: 143 LHCTITKAKGLKPMDHNGLADPYVKLHLLPGASKANKLRTKTLRNTLNPTWNE--TLTYY 200

Query: 436 GTVNEDSL 459
           G  +ED +
Sbjct: 201 GITDEDMI 208


>DQ013303-1|AAY67796.1|  532|Homo sapiens RAB11-FIP2 long isoform
           protein.
          Length = 532

 Score = 46.4 bits (105), Expect = 6e-05
 Identities = 24/65 (36%), Positives = 36/65 (55%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + V V++A DL PK  +G +D +  I L      +Y+TSV   TL PVW+E  S  + G 
Sbjct: 15  VQVTVLQAKDLKPKGKSGTNDTYTIIQL---GKEKYSTSVAEKTLEPVWKEEASFELPGL 71

Query: 442 VNEDS 456
           + + S
Sbjct: 72  LIQGS 76


>BC075074-1|AAH75074.1|  512|Homo sapiens RAB11 family interacting
           protein 2 (class I) protein.
          Length = 512

 Score = 46.4 bits (105), Expect = 6e-05
 Identities = 24/65 (36%), Positives = 36/65 (55%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + V V++A DL PK  +G +D +  I L      +Y+TSV   TL PVW+E  S  + G 
Sbjct: 15  VQVTVLQAKDLKPKGKSGTNDTYTIIQL---GKEKYSTSVAEKTLEPVWKEEASFELPGL 71

Query: 442 VNEDS 456
           + + S
Sbjct: 72  LIQGS 76


>BC075073-1|AAH75073.1|  512|Homo sapiens RAB11 family interacting
           protein 2 (class I) protein.
          Length = 512

 Score = 46.4 bits (105), Expect = 6e-05
 Identities = 24/65 (36%), Positives = 36/65 (55%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + V V++A DL PK  +G +D +  I L      +Y+TSV   TL PVW+E  S  + G 
Sbjct: 15  VQVTVLQAKDLKPKGKSGTNDTYTIIQL---GKEKYSTSVAEKTLEPVWKEEASFELPGL 71

Query: 442 VNEDS 456
           + + S
Sbjct: 72  LIQGS 76


>AY037299-1|AAK68635.1|  512|Homo sapiens nRip11 protein.
          Length = 512

 Score = 46.4 bits (105), Expect = 6e-05
 Identities = 24/65 (36%), Positives = 36/65 (55%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + V V++A DL PK  +G +D +  I L      +Y+TSV   TL PVW+E  S  + G 
Sbjct: 15  VQVTVLQAKDLKPKGKSGTNDTYTIIQL---GKEKYSTSVAEKTLEPVWKEEASFELPGL 71

Query: 442 VNEDS 456
           + + S
Sbjct: 72  LIQGS 76


>AB023158-1|BAA76785.2|  533|Homo sapiens KIAA0941 protein protein.
          Length = 533

 Score = 46.4 bits (105), Expect = 6e-05
 Identities = 24/65 (36%), Positives = 36/65 (55%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + V V++A DL PK  +G +D +  I L      +Y+TSV   TL PVW+E  S  + G 
Sbjct: 36  VQVTVLQAKDLKPKGKSGTNDTYTIIQL---GKEKYSTSVAEKTLEPVWKEEASFELPGL 92

Query: 442 VNEDS 456
           + + S
Sbjct: 93  LIQGS 97


>BC111945-1|AAI11946.1|  748|Homo sapiens SMAD specific E3 ubiquitin
           protein ligase 2 protein.
          Length = 748

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 26/81 (32%), Positives = 42/81 (51%)
 Frame = +1

Query: 235 GG*RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           GG R   + L + V+ A +LV KD   L DPF  + ++  S   ++T     TL+P W +
Sbjct: 5   GGRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKV-VVDGSGQCHSTDTVKNTLDPKWNQ 63

Query: 415 HFSLPMSGTVNEDSLCLEVWD 477
           H+ L +      DS+ + VW+
Sbjct: 64  HYDLYIG---KSDSVTISVWN 81


>BC093876-1|AAH93876.1|  748|Homo sapiens SMAD specific E3 ubiquitin
           protein ligase 2 protein.
          Length = 748

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 26/81 (32%), Positives = 42/81 (51%)
 Frame = +1

Query: 235 GG*RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           GG R   + L + V+ A +LV KD   L DPF  + ++  S   ++T     TL+P W +
Sbjct: 5   GGRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKV-VVDGSGQCHSTDTVKNTLDPKWNQ 63

Query: 415 HFSLPMSGTVNEDSLCLEVWD 477
           H+ L +      DS+ + VW+
Sbjct: 64  HYDLYIG---KSDSVTISVWN 81


>AY014180-1|AAG50421.1|  748|Homo sapiens E3 ubiquitin ligase Smurf2
           protein.
          Length = 748

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 26/81 (32%), Positives = 42/81 (51%)
 Frame = +1

Query: 235 GG*RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           GG R   + L + V+ A +LV KD   L DPF  + ++  S   ++T     TL+P W +
Sbjct: 5   GGRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKV-VVDGSGQCHSTDTVKNTLDPKWNQ 63

Query: 415 HFSLPMSGTVNEDSLCLEVWD 477
           H+ L +      DS+ + VW+
Sbjct: 64  HYDLYIG---KSDSVTISVWN 81


>AF301463-1|AAG25641.1|  748|Homo sapiens ubiquitin E3 ligase SMURF2
           protein.
          Length = 748

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 26/81 (32%), Positives = 42/81 (51%)
 Frame = +1

Query: 235 GG*RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           GG R   + L + V+ A +LV KD   L DPF  + ++  S   ++T     TL+P W +
Sbjct: 5   GGRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKV-VVDGSGQCHSTDTVKNTLDPKWNQ 63

Query: 415 HFSLPMSGTVNEDSLCLEVWD 477
           H+ L +      DS+ + VW+
Sbjct: 64  HYDLYIG---KSDSVTISVWN 81


>AF183187-1|AAG17468.1| 1230|Homo sapiens heart/fetal otoferlin
           protein.
          Length = 1230

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 28/76 (36%), Positives = 43/76 (56%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           +++ V VV ATDL P D NG +DP++ I L   +  R   +  S  LNPV+ + F +  S
Sbjct: 725 VLVRVYVVRATDLHPADINGKADPYIAIRL-GKTDIRDKENYISKQLNPVFGKSFDIEAS 783

Query: 436 GTVNEDSLCLEVWDFD 483
             + E  L + V+D+D
Sbjct: 784 FPM-ESMLTVAVYDWD 798



 Score = 35.1 bits (77), Expect = 0.14
 Identities = 17/57 (29%), Positives = 28/57 (49%)
 Frame = +1

Query: 244 RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           +     L   + +A  L   D +GLSDPF  ++ ++ S     T V + TL P W++
Sbjct: 209 KKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQ---CTEVLNETLCPTWDQ 262


>AF183186-1|AAG12992.1| 1307|Homo sapiens brain otoferlin short
            isoform protein.
          Length = 1307

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 28/76 (36%), Positives = 43/76 (56%)
 Frame = +1

Query: 256  LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
            +++ V VV ATDL P D NG +DP++ I L   +  R   +  S  LNPV+ + F +  S
Sbjct: 802  VLVRVYVVRATDLHPADINGKADPYIAIRL-GKTDIRDKENYISKQLNPVFGKSFDIEAS 860

Query: 436  GTVNEDSLCLEVWDFD 483
              + E  L + V+D+D
Sbjct: 861  FPM-ESMLTVAVYDWD 875



 Score = 35.1 bits (77), Expect = 0.14
 Identities = 17/57 (29%), Positives = 28/57 (49%)
 Frame = +1

Query: 244 RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           +     L   + +A  L   D +GLSDPF  ++ ++ S     T V + TL P W++
Sbjct: 266 KKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQ---CTEVLNETLCPTWDQ 319


>AF183185-1|AAG12991.1| 1997|Homo sapiens brain otoferlin long isoform
            protein.
          Length = 1997

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 28/76 (36%), Positives = 43/76 (56%)
 Frame = +1

Query: 256  LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
            +++ V VV ATDL P D NG +DP++ I L   +  R   +  S  LNPV+ + F +  S
Sbjct: 1492 VLVRVYVVRATDLHPADINGKADPYIAIRL-GKTDIRDKENYISKQLNPVFGKSFDIEAS 1550

Query: 436  GTVNEDSLCLEVWDFD 483
              + E  L + V+D+D
Sbjct: 1551 FPM-ESMLTVAVYDWD 1565



 Score = 35.1 bits (77), Expect = 0.14
 Identities = 17/57 (29%), Positives = 28/57 (49%)
 Frame = +1

Query: 244  RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
            +     L   + +A  L   D +GLSDPF  ++ ++ S     T V + TL P W++
Sbjct: 956  KKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQ---CTEVLNETLCPTWDQ 1009


>AF107403-1|AAD26117.1| 1230|Homo sapiens otoferlin protein.
          Length = 1230

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 28/76 (36%), Positives = 43/76 (56%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           +++ V VV ATDL P D NG +DP++ I L   +  R   +  S  LNPV+ + F +  S
Sbjct: 725 VLVRVYVVRATDLHPADINGKADPYIAIRL-GKTDIRDKENYISKQLNPVFGKSFDIEAS 783

Query: 436 GTVNEDSLCLEVWDFD 483
             + E  L + V+D+D
Sbjct: 784 FPM-ESMLTVAVYDWD 798



 Score = 35.1 bits (77), Expect = 0.14
 Identities = 17/57 (29%), Positives = 28/57 (49%)
 Frame = +1

Query: 244 RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           +     L   + +A  L   D +GLSDPF  ++ ++ S     T V + TL P W++
Sbjct: 209 KKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQ---CTEVLNETLCPTWDQ 262


>AC093378-2|AAY15083.1| 1230|Homo sapiens unknown protein.
          Length = 1230

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 28/76 (36%), Positives = 43/76 (56%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           +++ V VV ATDL P D NG +DP++ I L   +  R   +  S  LNPV+ + F +  S
Sbjct: 725 VLVRVYVVRATDLHPADINGKADPYIAIRL-GKTDIRDKENYISKQLNPVFGKSFDIEAS 783

Query: 436 GTVNEDSLCLEVWDFD 483
             + E  L + V+D+D
Sbjct: 784 FPM-ESMLTVAVYDWD 798



 Score = 35.1 bits (77), Expect = 0.14
 Identities = 17/57 (29%), Positives = 28/57 (49%)
 Frame = +1

Query: 244 RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           +     L   + +A  L   D +GLSDPF  ++ ++ S     T V + TL P W++
Sbjct: 209 KKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQ---CTEVLNETLCPTWDQ 262


>BC093724-1|AAH93724.1|  804|Homo sapiens RAS protein activator like
           1 (GAP1 like) protein.
          Length = 804

 Score = 44.8 bits (101), Expect = 2e-04
 Identities = 29/78 (37%), Positives = 39/78 (50%), Gaps = 1/78 (1%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL-P 429
           G  L   V++A DL P+D +G SDPF  ++  S S     TS    T  P W+E   L  
Sbjct: 132 GRCLRCHVLQARDLAPRDISGTSDPFARVFWGSQS---LETSTIKKTRFPHWDEVLELRE 188

Query: 430 MSGTVNEDSLCLEVWDFD 483
           M G      L +E+WD+D
Sbjct: 189 MPGA--PSPLRVELWDWD 204



 Score = 33.9 bits (74), Expect = 0.32
 Identities = 21/60 (35%), Positives = 29/60 (48%)
 Frame = +1

Query: 247 ASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           A    LNV VVE   L  KD +G SDP+  + +      R  T  +S  L P W E +++
Sbjct: 2   AKSSSLNVRVVEGRALPAKDVSGSSDPYCLVKVDDEVVARTATVWRS--LGPFWGEEYTV 59


>BC014420-1|AAH14420.1|  776|Homo sapiens RASAL1 protein protein.
          Length = 776

 Score = 44.8 bits (101), Expect = 2e-04
 Identities = 29/78 (37%), Positives = 39/78 (50%), Gaps = 1/78 (1%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL-P 429
           G  L   V++A DL P+D +G SDPF  ++  S S     TS    T  P W+E   L  
Sbjct: 132 GRCLRCHVLQARDLAPRDISGTSDPFARVFWGSQS---LETSTIKKTRFPHWDEVLELRE 188

Query: 430 MSGTVNEDSLCLEVWDFD 483
           M G      L +E+WD+D
Sbjct: 189 MPGA--PSPLRVELWDWD 204



 Score = 33.9 bits (74), Expect = 0.32
 Identities = 21/60 (35%), Positives = 29/60 (48%)
 Frame = +1

Query: 247 ASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           A    LNV VVE   L  KD +G SDP+  + +      R  T  +S  L P W E +++
Sbjct: 2   AKSSSLNVRVVEGRALPAKDVSGSSDPYCLVKVDDEVVARTATVWRS--LGPFWGEEYTV 59


>AB208935-1|BAD92172.1|  818|Homo sapiens RasGAP-activating-like
           protein 1 variant protein.
          Length = 818

 Score = 44.8 bits (101), Expect = 2e-04
 Identities = 29/78 (37%), Positives = 39/78 (50%), Gaps = 1/78 (1%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL-P 429
           G  L   V++A DL P+D +G SDPF  ++  S S     TS    T  P W+E   L  
Sbjct: 144 GRCLRCHVLQARDLAPRDISGTSDPFARVFWGSQS---LETSTIKKTRFPHWDEVLELRE 200

Query: 430 MSGTVNEDSLCLEVWDFD 483
           M G      L +E+WD+D
Sbjct: 201 MPGA--PSPLRVELWDWD 216



 Score = 34.3 bits (75), Expect = 0.24
 Identities = 22/63 (34%), Positives = 30/63 (47%)
 Frame = +1

Query: 238 G*RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEH 417
           G  A    LNV VVE   L  KD +G SDP+  + +      R  T  +S  L P W E 
Sbjct: 11  GAMAKSSSLNVRVVEGRALPAKDVSGSSDPYCLVKVDDEVVARTATVWRS--LGPFWGEE 68

Query: 418 FSL 426
           +++
Sbjct: 69  YTV 71


>BC030005-1|AAH30005.1|  600|Homo sapiens MCTP1 protein protein.
          Length = 600

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 20/54 (37%), Positives = 30/54 (55%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
           ++++ ++E  DL   D NGLSDP+V   L      +Y + +   TLNP W E F
Sbjct: 250 IVSITLIEGRDLKAMDSNGLSDPYVKFRL---GHQKYKSKIMPKTLNPQWREQF 300



 Score = 33.9 bits (74), Expect = 0.32
 Identities = 19/74 (25%), Positives = 35/74 (47%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L++ +     L  +D  G SDP+V   +       + + +    LNPVWEE   + +   
Sbjct: 42  LDITLRRGQSLAARDRGGTSDPYVKFKI--GGKEVFRSKIIHKNLNPVWEEKACILVDHL 99

Query: 442 VNEDSLCLEVWDFD 483
              + L ++V+D+D
Sbjct: 100 --REPLYIKVFDYD 111


>AY656716-1|AAT73059.1|  778|Homo sapiens MCTP1S protein.
          Length = 778

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 20/54 (37%), Positives = 30/54 (55%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
           ++++ ++E  DL   D NGLSDP+V   L      +Y + +   TLNP W E F
Sbjct: 250 IVSITLIEGRDLKAMDSNGLSDPYVKFRL---GHQKYKSKIMPKTLNPQWREQF 300



 Score = 33.9 bits (74), Expect = 0.32
 Identities = 19/74 (25%), Positives = 35/74 (47%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L++ +     L  +D  G SDP+V   +       + + +    LNPVWEE   + +   
Sbjct: 42  LDITLRRGQSLAARDRGGTSDPYVKFKI--GGKEVFRSKIIHKNLNPVWEEKACILVDHL 99

Query: 442 VNEDSLCLEVWDFD 483
              + L ++V+D+D
Sbjct: 100 --REPLYIKVFDYD 111


>AY656715-1|AAT73058.1|  999|Homo sapiens MCTP1L protein.
          Length = 999

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 20/54 (37%), Positives = 30/54 (55%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
           ++++ ++E  DL   D NGLSDP+V   L      +Y + +   TLNP W E F
Sbjct: 471 IVSITLIEGRDLKAMDSNGLSDPYVKFRL---GHQKYKSKIMPKTLNPQWREQF 521



 Score = 33.9 bits (74), Expect = 0.32
 Identities = 19/74 (25%), Positives = 35/74 (47%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L++ +     L  +D  G SDP+V   +       + + +    LNPVWEE   + +   
Sbjct: 263 LDITLRRGQSLAARDRGGTSDPYVKFKI--GGKEVFRSKIIHKNLNPVWEEKACILVDHL 320

Query: 442 VNEDSLCLEVWDFD 483
              + L ++V+D+D
Sbjct: 321 --REPLYIKVFDYD 332


>AL389875-2|CAO03392.1| 1794|Homo sapiens fer-1-like 4 (C. elegans)
            protein.
          Length = 1794

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 2/78 (2%)
 Frame = +1

Query: 256  LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVK--SGTLNPVWEEHFSLP 429
            L++ V VV+AT+L P DPNG +DP+V +   S    R +T  +     LNP++ E   L 
Sbjct: 1249 LLVRVYVVKATNLAPADPNGKADPYVVV---SAGRERQDTKERYIPKQLNPIFGEILELS 1305

Query: 430  MSGTVNEDSLCLEVWDFD 483
            +S    E  L + V+D D
Sbjct: 1306 IS-LPAETELTVAVFDHD 1322



 Score = 35.1 bits (77), Expect = 0.14
 Identities = 18/55 (32%), Positives = 29/55 (52%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           S   L   + +A  ++  D +GLSDPF  + +   S+    T V   TL+P+W+E
Sbjct: 759 SYFQLRAHLYQARGVLAADDSGLSDPFARVLI---STQCQTTRVLEQTLSPLWDE 810


>AL121586-1|CAB89410.2| 1794|Homo sapiens fer-1-like 4 (C. elegans)
            protein.
          Length = 1794

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 2/78 (2%)
 Frame = +1

Query: 256  LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVK--SGTLNPVWEEHFSLP 429
            L++ V VV+AT+L P DPNG +DP+V +   S    R +T  +     LNP++ E   L 
Sbjct: 1249 LLVRVYVVKATNLAPADPNGKADPYVVV---SAGRERQDTKERYIPKQLNPIFGEILELS 1305

Query: 430  MSGTVNEDSLCLEVWDFD 483
            +S    E  L + V+D D
Sbjct: 1306 IS-LPAETELTVAVFDHD 1322



 Score = 35.1 bits (77), Expect = 0.14
 Identities = 18/55 (32%), Positives = 29/55 (52%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           S   L   + +A  ++  D +GLSDPF  + +   S+    T V   TL+P+W+E
Sbjct: 759 SYFQLRAHLYQARGVLAADDSGLSDPFARVLI---STQCQTTRVLEQTLSPLWDE 810


>AL109827-5|CAI20117.2| 1794|Homo sapiens fer-1-like 4 (C. elegans)
            protein.
          Length = 1794

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 2/78 (2%)
 Frame = +1

Query: 256  LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVK--SGTLNPVWEEHFSLP 429
            L++ V VV+AT+L P DPNG +DP+V +   S    R +T  +     LNP++ E   L 
Sbjct: 1249 LLVRVYVVKATNLAPADPNGKADPYVVV---SAGRERQDTKERYIPKQLNPIFGEILELS 1305

Query: 430  MSGTVNEDSLCLEVWDFD 483
            +S    E  L + V+D D
Sbjct: 1306 IS-LPAETELTVAVFDHD 1322



 Score = 35.1 bits (77), Expect = 0.14
 Identities = 18/55 (32%), Positives = 29/55 (52%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           S   L   + +A  ++  D +GLSDPF  + +   S+    T V   TL+P+W+E
Sbjct: 759 SYFQLRAHLYQARGVLAADDSGLSDPFARVLI---STQCQTTRVLEQTLSPLWDE 810


>AK057694-1|BAB71547.1|  692|Homo sapiens protein ( Homo sapiens
           cDNA FLJ33132 fis, clone UMVEN2000133, weakly similar to
           RABPHILIN-3A. ).
          Length = 692

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 20/54 (37%), Positives = 30/54 (55%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
           ++++ ++E  DL   D NGLSDP+V   L      +Y + +   TLNP W E F
Sbjct: 204 IVSITLIEGRDLKAMDSNGLSDPYVKFRL---GHQKYKSKIMPKTLNPQWREQF 254



 Score = 33.9 bits (74), Expect = 0.32
 Identities = 19/74 (25%), Positives = 35/74 (47%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L++ +     L  +D  G SDP+V   +       + + +    LNPVWEE   + +   
Sbjct: 42  LDITLRRGQSLAARDRGGTSDPYVKFKI--GGKEVFRSKIIHKNLNPVWEEKACILVDHL 99

Query: 442 VNEDSLCLEVWDFD 483
              + L ++V+D+D
Sbjct: 100 --REPLYIKVFDYD 111


>AF086713-1|AAD09006.1|  804|Homo sapiens rasGAP-activating-like
           protein protein.
          Length = 804

 Score = 44.0 bits (99), Expect = 3e-04
 Identities = 29/78 (37%), Positives = 38/78 (48%), Gaps = 1/78 (1%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL-P 429
           G  L   V+ A DL P+D +G SDPF  ++  S S     TS    T  P W+E   L  
Sbjct: 132 GRCLRCHVLHARDLAPRDISGTSDPFARVFWGSQS---LETSTIKKTRFPHWDEVLELRE 188

Query: 430 MSGTVNEDSLCLEVWDFD 483
           M G      L +E+WD+D
Sbjct: 189 MPGA--PSPLRVELWDWD 204



 Score = 33.9 bits (74), Expect = 0.32
 Identities = 21/60 (35%), Positives = 29/60 (48%)
 Frame = +1

Query: 247 ASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           A    LNV VVE   L  KD +G SDP+  + +      R  T  +S  L P W E +++
Sbjct: 2   AKSSSLNVRVVEGRALPAKDVSGSSDPYCLVKVDDEVVARTATVWRS--LGPFWGEEYTV 59


>AF464850-1|AAM90910.1|  757|Homo sapiens Smad-ubiquitin E3 ligase
           Smurf1-beta protein.
          Length = 757

 Score = 43.6 bits (98), Expect = 4e-04
 Identities = 24/76 (31%), Positives = 40/76 (52%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
           S + + + V+ A +L  KD   L DPF  I ++  S   ++T     TL+P W +H+ L 
Sbjct: 11  SSIKIRLTVLCAKNLAKKDFFRLPDPFAKI-VVDGSGQCHSTDTVKNTLDPKWNQHYDLY 69

Query: 430 MSGTVNEDSLCLEVWD 477
           +  T   DS+ + VW+
Sbjct: 70  VGKT---DSITISVWN 82


>AF199364-1|AAF08298.2|  722|Homo sapiens E3 ubiquitin ligase SMURF1
           protein.
          Length = 722

 Score = 43.6 bits (98), Expect = 4e-04
 Identities = 24/76 (31%), Positives = 40/76 (52%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
           S + + + V+ A +L  KD   L DPF  I ++  S   ++T     TL+P W +H+ L 
Sbjct: 2   SSIKIRLTVLCAKNLAKKDFFRLPDPFAKI-VVDGSGQCHSTDTVKNTLDPKWNQHYDLY 60

Query: 430 MSGTVNEDSLCLEVWD 477
           +  T   DS+ + VW+
Sbjct: 61  VGKT---DSITISVWN 73


>AB046845-1|BAB13451.1|  859|Homo sapiens KIAA1625 protein protein.
          Length = 859

 Score = 43.6 bits (98), Expect = 4e-04
 Identities = 24/76 (31%), Positives = 40/76 (52%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
           S + + + V+ A +L  KD   L DPF  I ++  S   ++T     TL+P W +H+ L 
Sbjct: 113 SSIKIRLTVLCAKNLAKKDFFRLPDPFAKI-VVDGSGQCHSTDTVKNTLDPKWNQHYDLY 171

Query: 430 MSGTVNEDSLCLEVWD 477
           +  T   DS+ + VW+
Sbjct: 172 VGKT---DSITISVWN 184


>BC131527-1|AAI31528.1|  823|Homo sapiens MCTP2 protein protein.
          Length = 823

 Score = 43.2 bits (97), Expect = 5e-04
 Identities = 26/75 (34%), Positives = 39/75 (52%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L + + E  +LV +D  G SDP+V   L  N    Y + V    LNPVW+E   LP+  
Sbjct: 195 LLTIHLKEGRNLVVRDRCGTSDPYVKFKL--NGKTLYKSKVIYKNLNPVWDEIVVLPIQS 252

Query: 439 TVNEDSLCLEVWDFD 483
              +  L ++V+D D
Sbjct: 253 L--DQKLRVKVYDRD 265



 Score = 40.3 bits (90), Expect = 0.004
 Identities = 26/75 (34%), Positives = 39/75 (52%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L V+V++A DL+  D +G SDPF  + L    + R  T      LNP W + F+ P+  
Sbjct: 510 ILQVKVLKAADLLAADFSGKSDPFCLLEL---GNDRLQTHTVYKNLNPEWNKVFTFPIKD 566

Query: 439 TVNEDSLCLEVWDFD 483
               D L + V+D D
Sbjct: 567 I--HDVLEVTVFDED 579


>AY656717-1|AAT73060.1|  878|Homo sapiens MCTP2 protein.
          Length = 878

 Score = 43.2 bits (97), Expect = 5e-04
 Identities = 26/75 (34%), Positives = 39/75 (52%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L + + E  +LV +D  G SDP+V   L  N    Y + V    LNPVW+E   LP+  
Sbjct: 195 LLTIHLKEGRNLVVRDRCGTSDPYVKFKL--NGKTLYKSKVIYKNLNPVWDEIVVLPIQS 252

Query: 439 TVNEDSLCLEVWDFD 483
              +  L ++V+D D
Sbjct: 253 L--DQKLRVKVYDRD 265



 Score = 40.3 bits (90), Expect = 0.004
 Identities = 26/75 (34%), Positives = 39/75 (52%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L V+V++A DL+  D +G SDPF  + L    + R  T      LNP W + F+ P+  
Sbjct: 510 ILQVKVLKAADLLAADFSGKSDPFCLLEL---GNDRLQTHTVYKNLNPEWNKVFTFPIKD 566

Query: 439 TVNEDSLCLEVWDFD 483
               D L + V+D D
Sbjct: 567 I--HDVLEVTVFDED 579


>AK023521-1|BAB14597.1|  236|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13459 fis, clone PLACE1003366, weakly similar to
           Homo sapiens otoferlin (OTOF) mRNA. ).
          Length = 236

 Score = 42.7 bits (96), Expect = 7e-04
 Identities = 28/78 (35%), Positives = 43/78 (55%), Gaps = 2/78 (2%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVK--SGTLNPVWEEHFSLP 429
           L++ V VV+AT+L P DPNG +DP+V +   S    R +T  +     LNP++ E   L 
Sbjct: 118 LLVRVYVVKATNLAPADPNGKADPYVVV---SAGRERQDTKERYIPKQLNPIFGEILELS 174

Query: 430 MSGTVNEDSLCLEVWDFD 483
           +S    E  L + V++ D
Sbjct: 175 IS-LPAETELTVAVFEHD 191


>AF310676-1|AAG45422.1|  748|Homo sapiens E3 ubiquitin ligase SMURF2
           protein.
          Length = 748

 Score = 42.7 bits (96), Expect = 7e-04
 Identities = 26/81 (32%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = +1

Query: 238 G*RASG-LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           G R +G + L + V+ A +LV KD   L DPF  + ++  S   ++T     TL+P W +
Sbjct: 5   GRRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKV-VVDGSGQCHSTDTVKNTLDPKWNQ 63

Query: 415 HFSLPMSGTVNEDSLCLEVWD 477
           H+ L +      DS+ + VW+
Sbjct: 64  HYDLYIG---KSDSVTISVWN 81


>Z85996-5|CAD92810.1|  593|Homo sapiens RP3-431A14.5 protein.
          Length = 593

 Score = 42.3 bits (95), Expect = 0.001
 Identities = 29/74 (39%), Positives = 39/74 (52%), Gaps = 7/74 (9%)
 Frame = +1

Query: 283 ATDLVPKDPNGLSDPFVTIYLMSNSSHRYN----TSVKSGTLNPVWEEHFSLPMSGTVNE 450
           A  L  KD  G SDPF+  Y  SN    +     T V   TLNPVW+  FS+P+    N 
Sbjct: 185 ANKLDKKDFFGKSDPFLVFY-RSNEDGTFTICHKTEVMKNTLNPVWQT-FSIPVRALCNG 242

Query: 451 D---SLCLEVWDFD 483
           D   ++ +EV+D+D
Sbjct: 243 DYDRTIKVEVYDWD 256


>AB046819-1|BAB13425.1|  608|Homo sapiens KIAA1599 protein protein.
          Length = 608

 Score = 42.3 bits (95), Expect = 0.001
 Identities = 29/74 (39%), Positives = 39/74 (52%), Gaps = 7/74 (9%)
 Frame = +1

Query: 283 ATDLVPKDPNGLSDPFVTIYLMSNSSHRYN----TSVKSGTLNPVWEEHFSLPMSGTVNE 450
           A  L  KD  G SDPF+  Y  SN    +     T V   TLNPVW+  FS+P+    N 
Sbjct: 200 ANKLDKKDFFGKSDPFLVFY-RSNEDGTFTICHKTEVMKNTLNPVWQT-FSIPVRALCNG 257

Query: 451 D---SLCLEVWDFD 483
           D   ++ +EV+D+D
Sbjct: 258 DYDRTIKVEVYDWD 271


>DQ267935-1|ABB89736.1| 2081|Homo sapiens dysferlin_v1 protein.
          Length = 2081

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 23/75 (30%), Positives = 41/75 (54%)
 Frame = +1

Query: 259  MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
            ++ + +V A  L PKDPNG  DP++ I +   S    +  +   TL PV+ + F L  + 
Sbjct: 1580 LVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPC-TLEPVFGKMFELTCTL 1638

Query: 439  TVNEDSLCLEVWDFD 483
             + +D L + ++D+D
Sbjct: 1639 PLEKD-LKITLYDYD 1652



 Score = 34.3 bits (75), Expect = 0.24
 Identities = 23/82 (28%), Positives = 35/82 (42%), Gaps = 8/82 (9%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWE--------EH 417
            L   + +A DL   D +  SDP+  +  +  S     T V   TLNP W+        E 
Sbjct: 1155 LRCYMYQARDLAAMDKDSFSDPYAIVSFLHQSQ---KTVVVKNTLNPTWDQTLIFYEIEI 1211

Query: 418  FSLPMSGTVNEDSLCLEVWDFD 483
            F  P +      S+ +E++D D
Sbjct: 1212 FGEPATVAEQPPSIVVELYDHD 1233


>AK074104-1|BAB84930.1| 1516|Homo sapiens FLJ00175 protein protein.
          Length = 1516

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 23/75 (30%), Positives = 41/75 (54%)
 Frame = +1

Query: 259  MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
            ++ + +V A  L PKDPNG  DP++ I +   S    +  +   TL PV+ + F L  + 
Sbjct: 1127 LVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPC-TLEPVFGKMFELTCTL 1185

Query: 439  TVNEDSLCLEVWDFD 483
             + +D L + ++D+D
Sbjct: 1186 PLEKD-LKITLYDYD 1199



 Score = 34.3 bits (75), Expect = 0.24
 Identities = 23/82 (28%), Positives = 35/82 (42%), Gaps = 8/82 (9%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWE--------EH 417
           L   + +A DL   D +  SDP+  +  +  S     T V   TLNP W+        E 
Sbjct: 702 LRCYMYQARDLAAMDKDSFSDPYAIVSFLHQSQ---KTVVVKNTLNPTWDQTLIFYEIEI 758

Query: 418 FSLPMSGTVNEDSLCLEVWDFD 483
           F  P +      S+ +E++D D
Sbjct: 759 FGEPATVAEQPPSIVVELYDHD 780


>AJ007670-1|CAA07603.1| 1413|Homo sapiens LGMD2B protein protein.
          Length = 1413

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 23/75 (30%), Positives = 41/75 (54%)
 Frame = +1

Query: 259  MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
            ++ + +V A  L PKDPNG  DP++ I +   S    +  +   TL PV+ + F L  + 
Sbjct: 1016 LVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPC-TLEPVFGKMFELTCTL 1074

Query: 439  TVNEDSLCLEVWDFD 483
             + +D L + ++D+D
Sbjct: 1075 PLEKD-LKITLYDYD 1088



 Score = 34.3 bits (75), Expect = 0.24
 Identities = 23/82 (28%), Positives = 35/82 (42%), Gaps = 8/82 (9%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWE--------EH 417
           L   + +A DL   D +  SDP+  +  +  S     T V   TLNP W+        E 
Sbjct: 591 LRCYMYQARDLAAMDKDSFSDPYAIVSFLHQSQ---KTVVVKNTLNPTWDQTLIFYEIEI 647

Query: 418 FSLPMSGTVNEDSLCLEVWDFD 483
           F  P +      S+ +E++D D
Sbjct: 648 FGEPATVAEQPPSIVVELYDHD 669


>AF075575-1|AAC63519.1| 2080|Homo sapiens dysferlin protein.
          Length = 2080

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 23/75 (30%), Positives = 41/75 (54%)
 Frame = +1

Query: 259  MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
            ++ + +V A  L PKDPNG  DP++ I +   S    +  +   TL PV+ + F L  + 
Sbjct: 1579 LVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPC-TLEPVFGKMFELTCTL 1637

Query: 439  TVNEDSLCLEVWDFD 483
             + +D L + ++D+D
Sbjct: 1638 PLEKD-LKITLYDYD 1651



 Score = 34.3 bits (75), Expect = 0.24
 Identities = 23/82 (28%), Positives = 35/82 (42%), Gaps = 8/82 (9%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWE--------EH 417
            L   + +A DL   D +  SDP+  +  +  S     T V   TLNP W+        E 
Sbjct: 1154 LRCYMYQARDLAAMDKDSFSDPYAIVSFLHQSQ---KTVVVKNTLNPTWDQTLIFYEIEI 1210

Query: 418  FSLPMSGTVNEDSLCLEVWDFD 483
            F  P +      S+ +E++D D
Sbjct: 1211 FGEPATVAEQPPSIVVELYDHD 1232


>AC010147-1|AAY14954.1| 1586|Homo sapiens unknown protein.
          Length = 1586

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 23/75 (30%), Positives = 41/75 (54%)
 Frame = +1

Query: 259  MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
            ++ + +V A  L PKDPNG  DP++ I +   S    +  +   TL PV+ + F L  + 
Sbjct: 1085 LVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPC-TLEPVFGKMFELTCTL 1143

Query: 439  TVNEDSLCLEVWDFD 483
             + +D L + ++D+D
Sbjct: 1144 PLEKD-LKITLYDYD 1157



 Score = 34.3 bits (75), Expect = 0.24
 Identities = 23/82 (28%), Positives = 35/82 (42%), Gaps = 8/82 (9%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWE--------EH 417
           L   + +A DL   D +  SDP+  +  +  S     T V   TLNP W+        E 
Sbjct: 660 LRCYMYQARDLAAMDKDSFSDPYAIVSFLHQSQ---KTVVVKNTLNPTWDQTLIFYEIEI 716

Query: 418 FSLPMSGTVNEDSLCLEVWDFD 483
           F  P +      S+ +E++D D
Sbjct: 717 FGEPATVAEQPPSIVVELYDHD 738


>BC130375-1|AAI30376.1|  553|Homo sapiens copine family member IX
           protein.
          Length = 553

 Score = 40.7 bits (91), Expect = 0.003
 Identities = 28/74 (37%), Positives = 39/74 (52%), Gaps = 7/74 (9%)
 Frame = +1

Query: 283 ATDLVPKDPNGLSDPFVTIYLMSNSSHRYN----TSVKSGTLNPVWEEHFSLPMSGTVNE 450
           A  L  KD  G SDPF+  Y  SN    +     T V   TLNPVW+  FS+P+    N 
Sbjct: 156 ANKLDKKDFFGKSDPFLVFY-RSNEDGTFTICHKTEVVKNTLNPVWQP-FSIPVRALCNG 213

Query: 451 D---SLCLEVWDFD 483
           D   ++ ++V+D+D
Sbjct: 214 DYDRTVKIDVYDWD 227


>BC035735-1|AAH35735.2|  503|Homo sapiens CPNE9 protein protein.
          Length = 503

 Score = 40.7 bits (91), Expect = 0.003
 Identities = 28/74 (37%), Positives = 39/74 (52%), Gaps = 7/74 (9%)
 Frame = +1

Query: 283 ATDLVPKDPNGLSDPFVTIYLMSNSSHRYN----TSVKSGTLNPVWEEHFSLPMSGTVNE 450
           A  L  KD  G SDPF+  Y  SN    +     T V   TLNPVW+  FS+P+    N 
Sbjct: 156 ANKLDKKDFFGKSDPFLVFY-RSNEDGTFTICHKTEVVKNTLNPVWQP-FSIPVRALCNG 213

Query: 451 D---SLCLEVWDFD 483
           D   ++ ++V+D+D
Sbjct: 214 DYDRTVKIDVYDWD 227


>AK074977-1|BAC11328.1|  602|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90496 fis, clone NT2RP3003849, weakly similar to
           PROTEIN KINASE C, BRAIN ISOZYME (EC 2.7.1.-). ).
          Length = 602

 Score = 40.7 bits (91), Expect = 0.003
 Identities = 23/79 (29%), Positives = 37/79 (46%), Gaps = 2/79 (2%)
 Frame = +1

Query: 247 ASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHF 420
           A   +L + ++E   L+ K P G  DP+V I L+   S      T       +P + EHF
Sbjct: 35  AQDRVLLLHIIEGKGLISKQP-GTCDPYVKISLIPEDSRLRHQKTQTVPDCRDPAFHEHF 93

Query: 421 SLPMSGTVNEDSLCLEVWD 477
           S P+    ++  L + VW+
Sbjct: 94  SFPVQEEDDQKRLLVTVWN 112


>BC111024-1|AAI11025.1|  306|Homo sapiens MCTP2 protein protein.
          Length = 306

 Score = 40.3 bits (90), Expect = 0.004
 Identities = 26/75 (34%), Positives = 39/75 (52%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L V+V++A DL+  D +G SDPF  + L    + R  T      LNP W + F+ P+  
Sbjct: 98  ILQVKVLKAADLLAADFSGKSDPFCLLEL---GNDRLQTHTVYKNLNPEWNKVFTFPIKD 154

Query: 439 TVNEDSLCLEVWDFD 483
               D L + V+D D
Sbjct: 155 I--HDVLEVTVFDED 167


>BC041387-1|AAH41387.1|  506|Homo sapiens MCTP2 protein protein.
          Length = 506

 Score = 40.3 bits (90), Expect = 0.004
 Identities = 26/75 (34%), Positives = 39/75 (52%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L V+V++A DL+  D +G SDPF  + L    + R  T      LNP W + F+ P+  
Sbjct: 239 ILQVKVLKAADLLAADFSGKSDPFCLLEL---GNDRLQTHTVYKNLNPEWNKVFTFPIKD 295

Query: 439 TVNEDSLCLEVWDFD 483
               D L + V+D D
Sbjct: 296 I--HDVLEVTVFDED 308


>BC025708-1|AAH25708.1|  306|Homo sapiens MCTP2 protein protein.
          Length = 306

 Score = 40.3 bits (90), Expect = 0.004
 Identities = 26/75 (34%), Positives = 39/75 (52%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L V+V++A DL+  D +G SDPF  + L    + R  T      LNP W + F+ P+  
Sbjct: 98  ILQVKVLKAADLLAADFSGKSDPFCLLEL---GNDRLQTHTVYKNLNPEWNKVFTFPIKD 154

Query: 439 TVNEDSLCLEVWDFD 483
               D L + V+D D
Sbjct: 155 I--HDVLEVTVFDED 167


>AK002037-1|BAA92048.1|  466|Homo sapiens protein ( Homo sapiens
           cDNA FLJ11175 fis, clone PLACE1007375, weakly similar to
           PHORBOL ESTER/DIACYLGLYCEROL-BINDING PROTEIN UNC-13. ).
          Length = 466

 Score = 40.3 bits (90), Expect = 0.004
 Identities = 26/75 (34%), Positives = 39/75 (52%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L V+V++A DL+  D +G SDPF  + L    + R  T      LNP W + F+ P+  
Sbjct: 98  ILQVKVLKAADLLAADFSGKSDPFCLLEL---GNDRLQTHTVYKNLNPEWNKVFTFPIKD 154

Query: 439 TVNEDSLCLEVWDFD 483
               D L + V+D D
Sbjct: 155 I--HDVLEVTVFDED 167


>AC004893-2|AAC62434.1|  712|Homo sapiens WUGSC:H_DJ0808A01.2
           protein.
          Length = 712

 Score = 40.3 bits (90), Expect = 0.004
 Identities = 22/65 (33%), Positives = 34/65 (52%)
 Frame = +1

Query: 283 ATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNEDSLC 462
           A +L  KD   L DPF  I ++  S   ++T     TL+P W +H+ L +  T   DS+ 
Sbjct: 3   AKNLAKKDFFRLPDPFAKI-VVDGSGQCHSTDTVKNTLDPKWNQHYDLYVGKT---DSIT 58

Query: 463 LEVWD 477
           + VW+
Sbjct: 59  ISVWN 63


>DQ523800-1|ABF69196.1|  887|Homo sapiens group IVB cytosolic
           phospholipase A2 beta splice variant 3 protein.
          Length = 887

 Score = 39.9 bits (89), Expect = 0.005
 Identities = 24/75 (32%), Positives = 41/75 (54%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L V V++A  L  KD    SD +VT++L +  SHR  T     + +PVW + F   +  
Sbjct: 242 LLTVRVLQAHRLPSKDLVTPSDCYVTLWLPTACSHRLQTRTVKNSSSPVWNQSFHFRIHR 301

Query: 439 TVNEDSLCLEVWDFD 483
            + ++ + L+V+D D
Sbjct: 302 QL-KNVMELKVFDQD 315


>DQ523799-1|ABF69195.1|  893|Homo sapiens group IVB cytosolic
           phospholipase A2 beta splice variant 2 protein.
          Length = 893

 Score = 39.9 bits (89), Expect = 0.005
 Identities = 24/75 (32%), Positives = 41/75 (54%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L V V++A  L  KD    SD +VT++L +  SHR  T     + +PVW + F   +  
Sbjct: 242 LLTVRVLQAHRLPSKDLVTPSDCYVTLWLPTACSHRLQTRTVKNSSSPVWNQSFHFRIHR 301

Query: 439 TVNEDSLCLEVWDFD 483
            + ++ + L+V+D D
Sbjct: 302 QL-KNVMELKVFDQD 315


>BC131585-1|AAI31586.1|  752|Homo sapiens SYTL5 protein protein.
          Length = 752

 Score = 39.9 bits (89), Expect = 0.005
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 4/80 (5%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFS 423
           SG +L V + EA +L      G SD FV  YL+ + S   ++ T V   ++NP W   F 
Sbjct: 607 SGGILEVFIKEAKNLTAVKSGGTSDSFVKGYLLPDDSKATKHKTLVIKKSVNPQWNHTFM 666

Query: 424 LPMSGTVNEDSLCLE--VWD 477
                  +  ++CLE  +WD
Sbjct: 667 FSGIHPQDIKNVCLELTIWD 686


>BC032597-1|AAH32597.1|  911|Homo sapiens NEDD4L protein protein.
          Length = 911

 Score = 39.9 bits (89), Expect = 0.005
 Identities = 27/77 (35%), Positives = 36/77 (46%), Gaps = 4/77 (5%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHR----YNTSVKSGTLNPVWEEHFSL 426
           +L V+VV   DL  KD  G SDP+V + L     +R      T     TLNP W E F  
Sbjct: 21  ILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYF 80

Query: 427 PMSGTVNEDSLCLEVWD 477
            ++   +   L  EV+D
Sbjct: 81  RVN--PSNHRLLFEVFD 95


>AY312514-1|AAP75706.1|  975|Homo sapiens NEDD4.2 protein.
          Length = 975

 Score = 39.9 bits (89), Expect = 0.005
 Identities = 27/77 (35%), Positives = 36/77 (46%), Gaps = 4/77 (5%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHR----YNTSVKSGTLNPVWEEHFSL 426
           +L V+VV   DL  KD  G SDP+V + L     +R      T     TLNP W E F  
Sbjct: 21  ILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYF 80

Query: 427 PMSGTVNEDSLCLEVWD 477
            ++   +   L  EV+D
Sbjct: 81  RVN--PSNHRLLFEVFD 95


>AY112985-1|AAM76730.1|  947|Homo sapiens ubiquitin ligase NEDD4h
           protein.
          Length = 947

 Score = 39.9 bits (89), Expect = 0.005
 Identities = 27/77 (35%), Positives = 36/77 (46%), Gaps = 4/77 (5%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHR----YNTSVKSGTLNPVWEEHFSL 426
           +L V+VV   DL  KD  G SDP+V + L     +R      T     TLNP W E F  
Sbjct: 13  ILRVKVVSGIDLAKKDIFGASDPYVKLSLYVPDENRELALVQTKTIKKTLNPKWNEEFYF 72

Query: 427 PMSGTVNEDSLCLEVWD 477
            ++   +   L  EV+D
Sbjct: 73  RVN--PSNHRLLFEVFD 87


>AY112984-1|AAM76729.1|  967|Homo sapiens ubiquitin ligase NEDD4g
           protein.
          Length = 967

 Score = 39.9 bits (89), Expect = 0.005
 Identities = 27/77 (35%), Positives = 36/77 (46%), Gaps = 4/77 (5%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHR----YNTSVKSGTLNPVWEEHFSL 426
           +L V+VV   DL  KD  G SDP+V + L     +R      T     TLNP W E F  
Sbjct: 13  ILRVKVVSGIDLAKKDIFGASDPYVKLSLYVPDENRELALVQTKTIKKTLNPKWNEEFYF 72

Query: 427 PMSGTVNEDSLCLEVWD 477
            ++   +   L  EV+D
Sbjct: 73  RVN--PSNHRLLFEVFD 87


>AF121908-1|AAD32135.1| 1012|Homo sapiens cytosolic phospholipase A2
           beta protein.
          Length = 1012

 Score = 39.9 bits (89), Expect = 0.005
 Identities = 24/75 (32%), Positives = 41/75 (54%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L V V++A  L  KD    SD +VT++L +  SHR  T     + +PVW + F   +  
Sbjct: 242 LLTVRVLQAHRLPSKDLVTPSDCYVTLWLPTACSHRLQTRTVKNSSSPVWNQSFHFRIHR 301

Query: 439 TVNEDSLCLEVWDFD 483
            + ++ + L+V+D D
Sbjct: 302 QL-KNVMELKVFDQD 315


>AF065215-1|AAC78836.1| 1012|Homo sapiens cytosolic phospholipase A2
           beta protein.
          Length = 1012

 Score = 39.9 bits (89), Expect = 0.005
 Identities = 24/75 (32%), Positives = 41/75 (54%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L V V++A  L  KD    SD +VT++L +  SHR  T     + +PVW + F   +  
Sbjct: 242 LLTVRVLQAHRLPSKDLVTPSDCYVTLWLPTACSHRLQTRTVKNSSSPVWNQSFHFRIHR 301

Query: 439 TVNEDSLCLEVWDFD 483
            + ++ + L+V+D D
Sbjct: 302 QL-KNVMELKVFDQD 315


>AB196633-1|BAE53435.1| 1857|Homo sapiens C8orfK23 protein protein.
          Length = 1857

 Score = 39.9 bits (89), Expect = 0.005
 Identities = 19/51 (37%), Positives = 27/51 (52%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           L   + +A  L+  D NGLSDPF  +  +   SH   T + S TL+P W +
Sbjct: 828 LRAHMYQARGLIAADSNGLSDPFAKVTFL---SHCQTTKIISQTLSPTWNQ 875



 Score = 36.7 bits (81), Expect = 0.045
 Identities = 22/76 (28%), Positives = 38/76 (50%)
 Frame = +1

Query: 256  LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
            +++ V +V A +L P DP+G SDP++ I L        +  +    LNPV+   F +  +
Sbjct: 1356 VLIRVYIVAAFNLSPADPDGKSDPYIVIKLGKTEIKDRDKYIPK-QLNPVFGRSFEI-QA 1413

Query: 436  GTVNEDSLCLEVWDFD 483
                E  L + ++D D
Sbjct: 1414 TFPKESLLSILIYDHD 1429


>AB080222-1|BAB88906.1|  730|Homo sapiens synaptotagmin-like protein
           5 protein.
          Length = 730

 Score = 39.9 bits (89), Expect = 0.005
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 4/80 (5%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFS 423
           SG +L V + EA +L      G SD FV  YL+ + S   ++ T V   ++NP W   F 
Sbjct: 585 SGGILEVFIKEAKNLTAVKSGGTSDSFVKGYLLPDDSKATKHKTLVIKKSVNPQWNHTFM 644

Query: 424 LPMSGTVNEDSLCLE--VWD 477
                  +  ++CLE  +WD
Sbjct: 645 FSGIHPQDIKNVCLELTIWD 664


>AB071179-1|BAB69424.1|  955|Homo sapiens NEDD4-like ubiquitin
           ligase 3 protein.
          Length = 955

 Score = 39.9 bits (89), Expect = 0.005
 Identities = 27/77 (35%), Positives = 36/77 (46%), Gaps = 4/77 (5%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHR----YNTSVKSGTLNPVWEEHFSL 426
           +L V+VV   DL  KD  G SDP+V + L     +R      T     TLNP W E F  
Sbjct: 21  ILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYF 80

Query: 427 PMSGTVNEDSLCLEVWD 477
            ++   +   L  EV+D
Sbjct: 81  RVN--PSNHRLLFEVFD 95


>BC067084-1|AAH67084.1| 1090|Homo sapiens unc-13 homolog D (C.
           elegans) protein.
          Length = 1090

 Score = 39.5 bits (88), Expect = 0.006
 Identities = 19/44 (43%), Positives = 25/44 (56%)
 Frame = +1

Query: 367 YNTSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFDPAETV 498
           + T V + TLNPVW+E F L      N  S  L++WD D  E+V
Sbjct: 171 HRTQVITQTLNPVWDETFILEFEDITNA-SFHLDMWDLDTVESV 213



 Score = 37.5 bits (83), Expect = 0.026
 Identities = 18/34 (52%), Positives = 23/34 (67%)
 Frame = +1

Query: 244  RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYL 345
            RAS   L VE++ A+ L+P D NG SDPFV + L
Sbjct: 921  RASEQKLRVELLSASSLLPLDSNGSSDPFVQLTL 954


>AJ578444-1|CAE17516.1| 1090|Homo sapiens mammalian unc13-4 protein.
          Length = 1090

 Score = 39.5 bits (88), Expect = 0.006
 Identities = 19/44 (43%), Positives = 25/44 (56%)
 Frame = +1

Query: 367 YNTSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFDPAETV 498
           + T V + TLNPVW+E F L      N  S  L++WD D  E+V
Sbjct: 171 HRTQVITQTLNPVWDETFILEFEDITNA-SFHLDMWDLDTVESV 213



 Score = 37.5 bits (83), Expect = 0.026
 Identities = 18/34 (52%), Positives = 23/34 (67%)
 Frame = +1

Query: 244  RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYL 345
            RAS   L VE++ A+ L+P D NG SDPFV + L
Sbjct: 921  RASEQKLRVELLSASSLLPLDSNGSSDPFVQLTL 954


>BC126368-1|AAI26369.1|  802|Homo sapiens fer-1-like 5 (C. elegans)
           protein.
          Length = 802

 Score = 38.7 bits (86), Expect = 0.011
 Identities = 23/75 (30%), Positives = 42/75 (56%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           ++ V +V A +L P+D NGL DP+V I  +  +        +  TL+P++   F L  + 
Sbjct: 232 LVRVYMVRAINLQPQDYNGLCDPYV-ILKLGKTELGNRDMYQPNTLDPIFGMMFELTCNI 290

Query: 439 TVNEDSLCLEVWDFD 483
            + +D L ++++DFD
Sbjct: 291 PLEKD-LEIQLYDFD 304


>BC117324-1|AAI17325.1|  801|Homo sapiens fer-1-like 5 (C. elegans)
           protein.
          Length = 801

 Score = 38.7 bits (86), Expect = 0.011
 Identities = 23/75 (30%), Positives = 42/75 (56%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           ++ V +V A +L P+D NGL DP+V I  +  +        +  TL+P++   F L  + 
Sbjct: 231 LVRVYMVRAINLQPQDYNGLCDPYV-ILKLGKTELGNRDMYQPNTLDPIFGMMFELTCNI 289

Query: 439 TVNEDSLCLEVWDFD 483
            + +D L ++++DFD
Sbjct: 290 PLEKD-LEIQLYDFD 303


>AL359455-4|CAH73880.1|  602|Homo sapiens regulator of G-protein
           signalling 3 protein.
          Length = 602

 Score = 38.3 bits (85), Expect = 0.015
 Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 2/79 (2%)
 Frame = +1

Query: 247 ASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHF 420
           A   +L + ++E   L+ K P G  DP+V I L+   S      T       +P + EHF
Sbjct: 35  AQDRVLLLHIIEGKGLISKQP-GTCDPYVKISLIPEDSRLRHQKTQTVPDCRDPAFHEHF 93

Query: 421 SLPMSGTVNEDSLCLEVWD 477
             P+    ++  L + VW+
Sbjct: 94  FFPVQEEDDQKRLLVTVWN 112


>AL359455-3|CAH73879.1| 1094|Homo sapiens regulator of G-protein
           signalling 3 protein.
          Length = 1094

 Score = 38.3 bits (85), Expect = 0.015
 Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 2/79 (2%)
 Frame = +1

Query: 247 ASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHF 420
           A   +L + ++E   L+ K P G  DP+V I L+   S      T       +P + EHF
Sbjct: 43  AQDRVLLLHIIEGKGLISKQP-GTCDPYVKISLIPEDSRLRHQKTQTVPDCRDPAFHEHF 101

Query: 421 SLPMSGTVNEDSLCLEVWD 477
             P+    ++  L + VW+
Sbjct: 102 FFPVQEEDDQKRLLVTVWN 120


>AL162727-4|CAH70843.1| 1094|Homo sapiens regulator of G-protein
           signalling 3 protein.
          Length = 1094

 Score = 38.3 bits (85), Expect = 0.015
 Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 2/79 (2%)
 Frame = +1

Query: 247 ASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHF 420
           A   +L + ++E   L+ K P G  DP+V I L+   S      T       +P + EHF
Sbjct: 43  AQDRVLLLHIIEGKGLISKQP-GTCDPYVKISLIPEDSRLRHQKTQTVPDCRDPAFHEHF 101

Query: 421 SLPMSGTVNEDSLCLEVWD 477
             P+    ++  L + VW+
Sbjct: 102 FFPVQEEDDQKRLLVTVWN 120


>AL137066-8|CAH70103.1|  602|Homo sapiens regulator of G-protein
           signalling 3 protein.
          Length = 602

 Score = 38.3 bits (85), Expect = 0.015
 Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 2/79 (2%)
 Frame = +1

Query: 247 ASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHF 420
           A   +L + ++E   L+ K P G  DP+V I L+   S      T       +P + EHF
Sbjct: 35  AQDRVLLLHIIEGKGLISKQP-GTCDPYVKISLIPEDSRLRHQKTQTVPDCRDPAFHEHF 93

Query: 421 SLPMSGTVNEDSLCLEVWD 477
             P+    ++  L + VW+
Sbjct: 94  FFPVQEEDDQKRLLVTVWN 112


>AL137066-7|CAH70102.1| 1094|Homo sapiens regulator of G-protein
           signalling 3 protein.
          Length = 1094

 Score = 38.3 bits (85), Expect = 0.015
 Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 2/79 (2%)
 Frame = +1

Query: 247 ASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHF 420
           A   +L + ++E   L+ K P G  DP+V I L+   S      T       +P + EHF
Sbjct: 43  AQDRVLLLHIIEGKGLISKQP-GTCDPYVKISLIPEDSRLRHQKTQTVPDCRDPAFHEHF 101

Query: 421 SLPMSGTVNEDSLCLEVWD 477
             P+    ++  L + VW+
Sbjct: 102 FFPVQEEDDQKRLLVTVWN 120


>AK128127-1|BAC87285.1| 1198|Homo sapiens protein ( Homo sapiens
           cDNA FLJ46248 fis, clone TESTI4021197, highly  similar
           to Regulator of G-protein signaling 3. ).
          Length = 1198

 Score = 38.3 bits (85), Expect = 0.015
 Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 2/79 (2%)
 Frame = +1

Query: 247 ASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHF 420
           A   +L + ++E   L+ K P G  DP+V I L+   S      T       +P + EHF
Sbjct: 147 AQDRVLLLHIIEGKGLISKQP-GTCDPYVKISLIPEDSRLRHQKTQTVPDCRDPAFHEHF 205

Query: 421 SLPMSGTVNEDSLCLEVWD 477
             P+    ++  L + VW+
Sbjct: 206 FFPVQEEDDQKRLLVTVWN 224


>AB090876-1|BAC67158.1|  818|Homo sapiens cytosolic phospholipase A2
           delta protein.
          Length = 818

 Score = 38.3 bits (85), Expect = 0.015
 Identities = 23/74 (31%), Positives = 38/74 (51%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V V+EA +L   D    +DP+V + L +    ++ T   + T +PVW E F   +   
Sbjct: 24  LTVRVLEARNLRWADLLSEADPYVILQLSTAPGMKFKTKTLTDTSHPVWNEAFRFLIQSQ 83

Query: 442 VNEDSLCLEVWDFD 483
           V ++ L L ++D D
Sbjct: 84  V-KNVLELSIYDED 96


>BC064577-1|AAH64577.1|  558|Homo sapiens CPNE7 protein protein.
          Length = 558

 Score = 37.5 bits (83), Expect = 0.026
 Identities = 26/73 (35%), Positives = 38/73 (52%), Gaps = 6/73 (8%)
 Frame = +1

Query: 283 ATDLVPKDPNGLSDPFVTIYLMSNSSHR---YNTSVKSGTLNPVWEEHFSLPMSGTVN-E 450
           A  L  KD    SDPF+ +Y +++       Y T V    LNPVWE  F + +S   + E
Sbjct: 163 ARKLDDKDLFSKSDPFLELYRVNDDQGLQLVYRTEVVKNNLNPVWEA-FKVSLSSLCSCE 221

Query: 451 DSLCLE--VWDFD 483
           ++  L+  VWD+D
Sbjct: 222 ETRPLKCLVWDYD 234


>BC035334-1|AAH35334.1|  558|Homo sapiens copine VII protein.
          Length = 558

 Score = 37.5 bits (83), Expect = 0.026
 Identities = 26/73 (35%), Positives = 38/73 (52%), Gaps = 6/73 (8%)
 Frame = +1

Query: 283 ATDLVPKDPNGLSDPFVTIYLMSNSSHR---YNTSVKSGTLNPVWEEHFSLPMSGTVN-E 450
           A  L  KD    SDPF+ +Y +++       Y T V    LNPVWE  F + +S   + E
Sbjct: 163 ARKLDDKDLFSKSDPFLELYRVNDDQGLQLVYRTEVVKNNLNPVWEA-FKVSLSSLCSCE 221

Query: 451 DSLCLE--VWDFD 483
           ++  L+  VWD+D
Sbjct: 222 ETRPLKCLVWDYD 234


>BC004518-1|AAH04518.1|  474|Homo sapiens synaptotagmin XVII
           protein.
          Length = 474

 Score = 37.5 bits (83), Expect = 0.026
 Identities = 29/83 (34%), Positives = 39/83 (46%), Gaps = 9/83 (10%)
 Frame = +1

Query: 262 LNVEVVEATDLVP-------KDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEH- 417
           L V V+EA DL P       +     S+P+V I L+ +  +   T VK  T  PV+EE  
Sbjct: 201 LTVRVIEARDLPPPISHDGSRQDMAHSNPYVKICLLPDQKNSKQTGVKRKTQKPVFEERY 260

Query: 418 -FSLPMSGTVNEDSLCLEVWDFD 483
            F +P        +L L V DFD
Sbjct: 261 TFEIPFL-EAQRRTLLLTVVDFD 282



 Score = 37.5 bits (83), Expect = 0.026
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 2/56 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSS--HRYNTSVKSGTLNPVWEEHFS 423
           LNV+V+ A  L+  D +  SDPFV I L+          TS   GT++P + E FS
Sbjct: 338 LNVDVIRAKQLLQTDVSQGSDPFVKIQLVHGLKLVKTKKTSFLRGTIDPFYNESFS 393


>AJ133799-1|CAB61446.1|  633|Homo sapiens copine VII protein
           protein.
          Length = 633

 Score = 37.5 bits (83), Expect = 0.026
 Identities = 26/73 (35%), Positives = 38/73 (52%), Gaps = 6/73 (8%)
 Frame = +1

Query: 283 ATDLVPKDPNGLSDPFVTIYLMSNSSHR---YNTSVKSGTLNPVWEEHFSLPMSGTVN-E 450
           A  L  KD    SDPF+ +Y +++       Y T V    LNPVWE  F + +S   + E
Sbjct: 238 ARKLDDKDLFSKSDPFLELYRVNDDQGLQLVYRTEVVKNNLNPVWEA-FKVSLSSLCSCE 296

Query: 451 DSLCLE--VWDFD 483
           ++  L+  VWD+D
Sbjct: 297 ETRPLKCLVWDYD 309


>AJ133798-1|CAB61431.1|  633|Homo sapiens copine VII protein
           protein.
          Length = 633

 Score = 37.5 bits (83), Expect = 0.026
 Identities = 26/73 (35%), Positives = 38/73 (52%), Gaps = 6/73 (8%)
 Frame = +1

Query: 283 ATDLVPKDPNGLSDPFVTIYLMSNSSHR---YNTSVKSGTLNPVWEEHFSLPMSGTVN-E 450
           A  L  KD    SDPF+ +Y +++       Y T V    LNPVWE  F + +S   + E
Sbjct: 238 ARKLDDKDLFSKSDPFLELYRVNDDQGLQLVYRTEVVKNNLNPVWEA-FKVSLSSLCSCE 296

Query: 451 DSLCLE--VWDFD 483
           ++  L+  VWD+D
Sbjct: 297 ETRPLKCLVWDYD 309


>AF490839-1|AAM33254.1| 1093|Homo sapiens RGS3 isoform C2PA-RGS3
           protein.
          Length = 1093

 Score = 37.5 bits (83), Expect = 0.026
 Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 2/79 (2%)
 Frame = +1

Query: 247 ASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHF 420
           A   +L + ++E   L+ K P G  DP+V I L+   S      T       +P + EHF
Sbjct: 43  AQDRVLLLHIIEGKGLISKQP-GTWDPYVKISLIPEDSRLRHQKTQTVPDCRDPAFHEHF 101

Query: 421 SLPMSGTVNEDSLCLEVWD 477
             P+    ++  L + VW+
Sbjct: 102 FFPVQEEDDQKRLLVTVWN 120


>AF220560-1|AAF37825.1|  474|Homo sapiens B/K protein protein.
          Length = 474

 Score = 37.5 bits (83), Expect = 0.026
 Identities = 29/83 (34%), Positives = 39/83 (46%), Gaps = 9/83 (10%)
 Frame = +1

Query: 262 LNVEVVEATDLVP-------KDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEH- 417
           L V V+EA DL P       +     S+P+V I L+ +  +   T VK  T  PV+EE  
Sbjct: 201 LTVRVIEARDLPPPISHDGSRQDMAHSNPYVKICLLPDQKNSKQTGVKRKTQKPVFEERY 260

Query: 418 -FSLPMSGTVNEDSLCLEVWDFD 483
            F +P        +L L V DFD
Sbjct: 261 TFEIPFL-EAQRRTLLLTVVDFD 282



 Score = 37.5 bits (83), Expect = 0.026
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 2/56 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSS--HRYNTSVKSGTLNPVWEEHFS 423
           LNV+V+ A  L+  D +  SDPFV I L+          TS   GT++P + E FS
Sbjct: 338 LNVDVIRAKQLLQTDVSQGSDPFVKIQLVHGLKLVKTKKTSFLRGTIDPFYNESFS 393


>AC003003-1|AAC05436.1|  361|Homo sapiens Homolog of rat B/K protein
           product protein.
          Length = 361

 Score = 37.5 bits (83), Expect = 0.026
 Identities = 29/83 (34%), Positives = 39/83 (46%), Gaps = 9/83 (10%)
 Frame = +1

Query: 262 LNVEVVEATDLVP-------KDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEH- 417
           L V V+EA DL P       +     S+P+V I L+ +  +   T VK  T  PV+EE  
Sbjct: 88  LTVRVIEARDLPPPISHDGSRQDMAHSNPYVKICLLPDQKNSKQTGVKRKTQKPVFEERY 147

Query: 418 -FSLPMSGTVNEDSLCLEVWDFD 483
            F +P        +L L V DFD
Sbjct: 148 TFEIPFL-EAQRRTLLLTVVDFD 169



 Score = 37.5 bits (83), Expect = 0.026
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 2/56 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSS--HRYNTSVKSGTLNPVWEEHFS 423
           LNV+V+ A  L+  D +  SDPFV I L+          TS   GT++P + E FS
Sbjct: 225 LNVDVIRAKQLLQTDVSQGSDPFVKIQLVHGLKLVKTKKTSFLRGTIDPFYNESFS 280


>BC110578-1|AAI10579.1|  564|Homo sapiens CPNE8 protein protein.
          Length = 564

 Score = 37.1 bits (82), Expect = 0.034
 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 6/73 (8%)
 Frame = +1

Query: 283 ATDLVPKDPNGLSDPFVTIYLMSNSSHR---YNTSVKSGTLNPVWEEHFSLPMSGTVNED 453
           A  L  KD  G SDPF+  Y  +        + T V   TLNPVW+  F + +    N D
Sbjct: 166 ANKLDKKDFFGKSDPFLVFYRSNEDGSFTICHKTEVVKNTLNPVWQA-FKISVRALCNGD 224

Query: 454 ---SLCLEVWDFD 483
              ++ +EV+D+D
Sbjct: 225 YDRTIKVEVYDWD 237


>BC110577-1|AAI10578.1|  564|Homo sapiens CPNE8 protein protein.
          Length = 564

 Score = 37.1 bits (82), Expect = 0.034
 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 6/73 (8%)
 Frame = +1

Query: 283 ATDLVPKDPNGLSDPFVTIYLMSNSSHR---YNTSVKSGTLNPVWEEHFSLPMSGTVNED 453
           A  L  KD  G SDPF+  Y  +        + T V   TLNPVW+  F + +    N D
Sbjct: 166 ANKLDKKDFFGKSDPFLVFYRSNEDGSFTICHKTEVVKNTLNPVWQA-FKISVRALCNGD 224

Query: 454 ---SLCLEVWDFD 483
              ++ +EV+D+D
Sbjct: 225 YDRTIKVEVYDWD 237


>AY177785-1|AAO21123.1|  564|Homo sapiens copine VIII protein.
          Length = 564

 Score = 37.1 bits (82), Expect = 0.034
 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 6/73 (8%)
 Frame = +1

Query: 283 ATDLVPKDPNGLSDPFVTIYLMSNSSHR---YNTSVKSGTLNPVWEEHFSLPMSGTVNED 453
           A  L  KD  G SDPF+  Y  +        + T V   TLNPVW+  F + +    N D
Sbjct: 166 ANKLDKKDFFGKSDPFLVFYRSNEDGSFTICHKTEVVKNTLNPVWQA-FKISVRALCNGD 224

Query: 454 ---SLCLEVWDFD 483
              ++ +EV+D+D
Sbjct: 225 YDRTIKVEVYDWD 237


>AK098593-1|BAC05344.1|  268|Homo sapiens protein ( Homo sapiens
           cDNA FLJ25727 fis, clone TST05479. ).
          Length = 268

 Score = 37.1 bits (82), Expect = 0.034
 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 6/73 (8%)
 Frame = +1

Query: 283 ATDLVPKDPNGLSDPFVTIYLMSNSSHR---YNTSVKSGTLNPVWEEHFSLPMSGTVNED 453
           A  L  KD  G SDPF+  Y  +        + T V   TLNPVW+  F + +    N D
Sbjct: 154 ANKLDKKDFFGKSDPFLVFYRSNEDGSFTICHKTEVVKNTLNPVWQA-FKISVRALCNGD 212

Query: 454 ---SLCLEVWDFD 483
              ++ +EV+D+D
Sbjct: 213 YDRTIKVEVYDWD 225


>BC035725-1|AAH35725.1|  562|Homo sapiens SYTL1 protein protein.
          Length = 562

 Score = 36.7 bits (81), Expect = 0.045
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE--HFSLPMSGTVNEDSLCLEVW 474
           SDP+V  YL+ +   +  T+VK   LNPV+ E   +S+P +  +    L L VW
Sbjct: 301 SDPYVKSYLLPDKQSKRKTAVKKRNLNPVFNETLRYSVPQA-ELQGRVLSLSVW 353


>BC015764-1|AAH15764.1|  457|Homo sapiens SYTL1 protein protein.
          Length = 457

 Score = 36.7 bits (81), Expect = 0.045
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE--HFSLPMSGTVNEDSLCLEVW 474
           SDP+V  YL+ +   +  T+VK   LNPV+ E   +S+P +  +    L L VW
Sbjct: 196 SDPYVKSYLLPDKQSKRKTAVKKRNLNPVFNETLRYSVPQA-ELQGRVLSLSVW 248


>BC009224-1|AAH09224.2|  471|Homo sapiens SYTL1 protein protein.
          Length = 471

 Score = 36.7 bits (81), Expect = 0.045
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE--HFSLPMSGTVNEDSLCLEVW 474
           SDP+V  YL+ +   +  T+VK   LNPV+ E   +S+P +  +    L L VW
Sbjct: 210 SDPYVKSYLLPDKQSKRKTAVKKRNLNPVFNETLRYSVPQA-ELQGRVLSLSVW 262


>AL663123-9|CAI14783.1|  550|Homo sapiens synaptotagmin-like 1
           protein.
          Length = 550

 Score = 36.7 bits (81), Expect = 0.045
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE--HFSLPMSGTVNEDSLCLEVW 474
           SDP+V  YL+ +   +  T+VK   LNPV+ E   +S+P +  +    L L VW
Sbjct: 289 SDPYVKSYLLPDKQSKRKTAVKKRNLNPVFNETLRYSVPQA-ELQGRVLSLSVW 341


>AL663123-8|CAI14782.1|  291|Homo sapiens synaptotagmin-like 1
           protein.
          Length = 291

 Score = 36.7 bits (81), Expect = 0.045
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE--HFSLPMSGTVNEDSLCLEVW 474
           SDP+V  YL+ +   +  T+VK   LNPV+ E   +S+P +  +    L L VW
Sbjct: 148 SDPYVKSYLLPDKQSKRKTAVKKRNLNPVFNETLRYSVPQA-ELQGRVLSLSVW 200


>AL365364-3|CAI41207.2| 2048|Homo sapiens fer-1-like 3, myoferlin (C.
            elegans) protein.
          Length = 2048

 Score = 36.7 bits (81), Expect = 0.045
 Identities = 22/74 (29%), Positives = 37/74 (50%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            + + +V   +L P+D NGL DP++ I L        +  + + TLNPV+   + L     
Sbjct: 1542 VRIYIVRGLELQPQDNNGLCDPYIKITLGKKVIEDRDHYIPN-TLNPVFGRMYELSCY-L 1599

Query: 442  VNEDSLCLEVWDFD 483
              E  L + V+D+D
Sbjct: 1600 PQEKDLKISVYDYD 1613



 Score = 33.1 bits (72), Expect = 0.55
 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 2/77 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           ML V +VE+   +PK   G  DP V++        +  T      LNPVW E     + G
Sbjct: 1   MLRV-IVESASNIPKTKFGKPDPIVSVIF---KDEKKKTKKVDNELNPVWNEILEFDLRG 56

Query: 439 TVNE--DSLCLEVWDFD 483
              +   SL + V DF+
Sbjct: 57  IPLDFSSSLGIIVKDFE 73



 Score = 31.9 bits (69), Expect = 1.3
 Identities = 16/51 (31%), Positives = 25/51 (49%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
            L   V +A +L+  D +  SDP+  I  +  S     T +   TLNP W++
Sbjct: 1128 LRCYVYQARNLLALDKDSFSDPYAHICFLHRSK---TTEIIHSTLNPTWDQ 1175


>AL365364-2|CAI41206.2| 2061|Homo sapiens fer-1-like 3, myoferlin (C.
            elegans) protein.
          Length = 2061

 Score = 36.7 bits (81), Expect = 0.045
 Identities = 22/74 (29%), Positives = 37/74 (50%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            + + +V   +L P+D NGL DP++ I L        +  + + TLNPV+   + L     
Sbjct: 1555 VRIYIVRGLELQPQDNNGLCDPYIKITLGKKVIEDRDHYIPN-TLNPVFGRMYELSCY-L 1612

Query: 442  VNEDSLCLEVWDFD 483
              E  L + V+D+D
Sbjct: 1613 PQEKDLKISVYDYD 1626



 Score = 33.1 bits (72), Expect = 0.55
 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 2/77 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           ML V +VE+   +PK   G  DP V++        +  T      LNPVW E     + G
Sbjct: 1   MLRV-IVESASNIPKTKFGKPDPIVSVIF---KDEKKKTKKVDNELNPVWNEILEFDLRG 56

Query: 439 TVNE--DSLCLEVWDFD 483
              +   SL + V DF+
Sbjct: 57  IPLDFSSSLGIIVKDFE 73



 Score = 31.9 bits (69), Expect = 1.3
 Identities = 16/51 (31%), Positives = 25/51 (49%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
            L   V +A +L+  D +  SDP+  I  +  S     T +   TLNP W++
Sbjct: 1141 LRCYVYQARNLLALDKDSFSDPYAHICFLHRSK---TTEIIHSTLNPTWDQ 1188


>AL360229-3|CAH72371.2| 2048|Homo sapiens fer-1-like 3, myoferlin (C.
            elegans) protein.
          Length = 2048

 Score = 36.7 bits (81), Expect = 0.045
 Identities = 22/74 (29%), Positives = 37/74 (50%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            + + +V   +L P+D NGL DP++ I L        +  + + TLNPV+   + L     
Sbjct: 1542 VRIYIVRGLELQPQDNNGLCDPYIKITLGKKVIEDRDHYIPN-TLNPVFGRMYELSCY-L 1599

Query: 442  VNEDSLCLEVWDFD 483
              E  L + V+D+D
Sbjct: 1600 PQEKDLKISVYDYD 1613



 Score = 33.1 bits (72), Expect = 0.55
 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 2/77 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           ML V +VE+   +PK   G  DP V++        +  T      LNPVW E     + G
Sbjct: 1   MLRV-IVESASNIPKTKFGKPDPIVSVIF---KDEKKKTKKVDNELNPVWNEILEFDLRG 56

Query: 439 TVNE--DSLCLEVWDFD 483
              +   SL + V DF+
Sbjct: 57  IPLDFSSSLGIIVKDFE 73



 Score = 31.9 bits (69), Expect = 1.3
 Identities = 16/51 (31%), Positives = 25/51 (49%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
            L   V +A +L+  D +  SDP+  I  +  S     T +   TLNP W++
Sbjct: 1128 LRCYVYQARNLLALDKDSFSDPYAHICFLHRSK---TTEIIHSTLNPTWDQ 1175


>AL360229-2|CAH72372.2| 2061|Homo sapiens fer-1-like 3, myoferlin (C.
            elegans) protein.
          Length = 2061

 Score = 36.7 bits (81), Expect = 0.045
 Identities = 22/74 (29%), Positives = 37/74 (50%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            + + +V   +L P+D NGL DP++ I L        +  + + TLNPV+   + L     
Sbjct: 1555 VRIYIVRGLELQPQDNNGLCDPYIKITLGKKVIEDRDHYIPN-TLNPVFGRMYELSCY-L 1612

Query: 442  VNEDSLCLEVWDFD 483
              E  L + V+D+D
Sbjct: 1613 PQEKDLKISVYDYD 1626



 Score = 33.1 bits (72), Expect = 0.55
 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 2/77 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           ML V +VE+   +PK   G  DP V++        +  T      LNPVW E     + G
Sbjct: 1   MLRV-IVESASNIPKTKFGKPDPIVSVIF---KDEKKKTKKVDNELNPVWNEILEFDLRG 56

Query: 439 TVNE--DSLCLEVWDFD 483
              +   SL + V DF+
Sbjct: 57  IPLDFSSSLGIIVKDFE 73



 Score = 31.9 bits (69), Expect = 1.3
 Identities = 16/51 (31%), Positives = 25/51 (49%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
            L   V +A +L+  D +  SDP+  I  +  S     T +   TLNP W++
Sbjct: 1141 LRCYVYQARNLLALDKDSFSDPYAHICFLHRSK---TTEIIHSTLNPTWDQ 1188


>AL096713-1|CAB46370.1| 1430|Homo sapiens hypothetical protein
            protein.
          Length = 1430

 Score = 36.7 bits (81), Expect = 0.045
 Identities = 22/74 (29%), Positives = 37/74 (50%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            + + +V   +L P+D NGL DP++ I L        +  + + TLNPV+   + L     
Sbjct: 954  VRIYIVRGLELQPQDNNGLRDPYIKITLGKKVIEDRDHYIPN-TLNPVFGRMYELSCY-L 1011

Query: 442  VNEDSLCLEVWDFD 483
              E  L + V+D+D
Sbjct: 1012 PQEKDLKISVYDYD 1025



 Score = 33.1 bits (72), Expect = 0.55
 Identities = 17/51 (33%), Positives = 25/51 (49%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           L   V +A +L+  D +  SDPF  I  +  S     T +   TLNP W++
Sbjct: 521 LRCYVYQARNLLALDKDSFSDPFAHICFLHRSK---TTEIIHSTLNPTWDQ 568


>AK091330-1|BAC03637.1|  515|Homo sapiens protein ( Homo sapiens
           cDNA FLJ34011 fis, clone FCBBF2001868, weakly similar to
           RABPHILIN-3A. ).
          Length = 515

 Score = 36.7 bits (81), Expect = 0.045
 Identities = 17/39 (43%), Positives = 21/39 (53%)
 Frame = +1

Query: 304 DPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
           D NGLSDP+V   L      +Y + +   TLNP W E F
Sbjct: 2   DSNGLSDPYVKFRL---GHQKYKSKIMPKTLNPQWREQF 37


>AK027902-1|BAB55444.1|  550|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14996 fis, clone Y79AA1002246, weakly similar to
           SYNAPTOTAGMIN V. ).
          Length = 550

 Score = 36.7 bits (81), Expect = 0.045
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE--HFSLPMSGTVNEDSLCLEVW 474
           SDP+V  YL+ +   +  T+VK   LNPV+ E   +S+P +  +    L L VW
Sbjct: 289 SDPYVKSYLLPDKQSKRKTAVKKRNLNPVFNETLRYSVPQA-ELQGRVLSLSVW 341


>AF207990-1|AAG23737.1| 2048|Homo sapiens fer-1 like protein 3
            protein.
          Length = 2048

 Score = 36.7 bits (81), Expect = 0.045
 Identities = 22/74 (29%), Positives = 37/74 (50%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            + + +V   +L P+D NGL DP++ I L        +  + + TLNPV+   + L     
Sbjct: 1542 VRIYIVRGLELQPQDNNGLCDPYIKITLGKKVIEDRDHYIPN-TLNPVFGRMYELSCY-L 1599

Query: 442  VNEDSLCLEVWDFD 483
              E  L + V+D+D
Sbjct: 1600 PQEKDLKISVYDYD 1613



 Score = 33.1 bits (72), Expect = 0.55
 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 2/77 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           ML V +VE+   +PK   G  DP V++        +  T      LNPVW E     + G
Sbjct: 1   MLRV-IVESASNIPKTKFGKPDPIVSVIF---KDEKKKTKKVDNELNPVWNEILEFDLRG 56

Query: 439 TVNE--DSLCLEVWDFD 483
              +   SL + V DF+
Sbjct: 57  IPLDFSSSLGIIVKDFE 73



 Score = 31.9 bits (69), Expect = 1.3
 Identities = 16/51 (31%), Positives = 25/51 (49%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
            L   V +A +L+  D +  SDP+  I  +  S     T +   TLNP W++
Sbjct: 1128 LRCYVYQARNLLALDKDSFSDPYAHICFLHRSK---TTEIIHSTLNPTWDQ 1175


>AF182317-1|AAF27177.1| 2018|Homo sapiens myoferlin protein.
          Length = 2018

 Score = 36.7 bits (81), Expect = 0.045
 Identities = 22/74 (29%), Positives = 37/74 (50%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            + + +V   +L P+D NGL DP++ I L        +  + + TLNPV+   + L     
Sbjct: 1513 VRIYIVRGLELQPQDNNGLCDPYIKITLGKKVIEDRDHYIPN-TLNPVFGRMYELSCY-L 1570

Query: 442  VNEDSLCLEVWDFD 483
              E  L + V+D+D
Sbjct: 1571 PQEKDLKISVYDYD 1584



 Score = 31.9 bits (69), Expect = 1.3
 Identities = 16/51 (31%), Positives = 25/51 (49%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
            L   V +A +L+  D +  SDP+  I  +  S     T +   TLNP W++
Sbjct: 1099 LRCYVYQARNLLALDKDSFSDPYAHICFLHRSK---TTEIIHSTLNPTWDQ 1146


>AF182316-1|AAF27176.1| 2061|Homo sapiens myoferlin protein.
          Length = 2061

 Score = 36.7 bits (81), Expect = 0.045
 Identities = 22/74 (29%), Positives = 37/74 (50%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            + + +V   +L P+D NGL DP++ I L        +  + + TLNPV+   + L     
Sbjct: 1555 VRIYIVRGLELQPQDNNGLCDPYIKITLGKKVIEDRDHYIPN-TLNPVFGRMYELSCY-L 1612

Query: 442  VNEDSLCLEVWDFD 483
              E  L + V+D+D
Sbjct: 1613 PQEKDLKISVYDYD 1626



 Score = 33.1 bits (72), Expect = 0.55
 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 2/77 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           ML V +VE+   +PK   G  DP V++        +  T      LNPVW E     + G
Sbjct: 1   MLRV-IVESASNIPKTKFGKPDPIVSVIF---KDEKKKTKKVDNELNPVWNEILEFDLRG 56

Query: 439 TVNE--DSLCLEVWDFD 483
              +   SL + V DF+
Sbjct: 57  IPLDFSSSLGIIVKDFE 73



 Score = 31.9 bits (69), Expect = 1.3
 Identities = 16/51 (31%), Positives = 25/51 (49%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
            L   V +A +L+  D +  SDP+  I  +  S     T +   TLNP W++
Sbjct: 1141 LRCYVYQARNLLALDKDSFSDPYAHICFLHRSK---TTEIIHSTLNPTWDQ 1188


>AB033033-1|BAA86521.2| 2061|Homo sapiens KIAA1207 protein protein.
          Length = 2061

 Score = 36.7 bits (81), Expect = 0.045
 Identities = 22/74 (29%), Positives = 37/74 (50%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
            + + +V   +L P+D NGL DP++ I L        +  + + TLNPV+   + L     
Sbjct: 1555 VRIYIVRGLELQPQDNNGLCDPYIKITLGKKVIEDRDHYIPN-TLNPVFGRMYELSCY-L 1612

Query: 442  VNEDSLCLEVWDFD 483
              E  L + V+D+D
Sbjct: 1613 PQEKDLKISVYDYD 1626



 Score = 33.1 bits (72), Expect = 0.55
 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 2/77 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           ML V +VE+   +PK   G  DP V++        +  T      LNPVW E     + G
Sbjct: 1   MLRV-IVESASNIPKTKFGKPDPIVSVIF---KDEKKKTKKVDNELNPVWNEILEFDLRG 56

Query: 439 TVNE--DSLCLEVWDFD 483
              +   SL + V DF+
Sbjct: 57  IPLDFSSSLGIIVKDFE 73



 Score = 31.9 bits (69), Expect = 1.3
 Identities = 16/51 (31%), Positives = 25/51 (49%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
            L   V +A +L+  D +  SDP+  I  +  S     T +   TLNP W++
Sbjct: 1141 LRCYVYQARNLLALDKDSFSDPYAHICFLHRSK---TTEIIHSTLNPTWDQ 1188


>BC037406-1|AAH37406.1|  421|Homo sapiens synaptotagmin XII protein.
          Length = 421

 Score = 35.5 bits (78), Expect = 0.10
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 4/60 (6%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSN--SSHRYNTSVKSGTLNPVWEEH--FSLP 429
           L V VV+A +L+  +    +DPFV +YL+ +     +  T+VK    NPV+ E   FS+P
Sbjct: 300 LTVVVVKAKNLIWTNDKTTADPFVKVYLLQDGRKMSKKKTAVKRDDPNPVFNEAMIFSVP 359


>AL833834-1|CAD38694.1|  361|Homo sapiens hypothetical protein
           protein.
          Length = 361

 Score = 35.5 bits (78), Expect = 0.10
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 4/60 (6%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSN--SSHRYNTSVKSGTLNPVWEEH--FSLP 429
           L V VV+A +L+  +    +DPFV +YL+ +     +  T+VK    NPV+ E   FS+P
Sbjct: 240 LTVVVVKAKNLIWTNDKTTADPFVKVYLLQDGRKMSKKKTAVKRDDPNPVFNEAMIFSVP 299


>U83246-1|AAC15920.1|  537|Homo sapiens copine I protein.
          Length = 537

 Score = 35.1 bits (77), Expect = 0.14
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 2/54 (3%)
 Frame = +1

Query: 277 VEATDLVPKDPNGLSDPFVTIYLMSNSSHR--YNTSVKSGTLNPVWEEHFSLPM 432
           VEA +L  KD  G SDPF+  +   +      Y + V    LNP W + FS+P+
Sbjct: 144 VEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTW-KRFSVPV 196


>D38522-1|BAA07527.2|  486|Homo sapiens KIAA0080 protein.
          Length = 486

 Score = 35.1 bits (77), Expect = 0.14
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = +1

Query: 262 LNVEVVEATDL-VPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
           L V + EA  L V  D    SDP++ + ++ +  HR  T V   TL+PV++E F+
Sbjct: 229 LVVTIQEAHGLPVMDDQTQGSDPYIKMTILPDKRHRVKTRVLRKTLDPVFDETFT 283


>CR456790-1|CAG33071.1|  537|Homo sapiens CPNE1 protein.
          Length = 537

 Score = 35.1 bits (77), Expect = 0.14
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 2/54 (3%)
 Frame = +1

Query: 277 VEATDLVPKDPNGLSDPFVTIYLMSNSSHR--YNTSVKSGTLNPVWEEHFSLPM 432
           VEA +L  KD  G SDPF+  +   +      Y + V    LNP W + FS+P+
Sbjct: 144 VEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTW-KRFSVPV 196


>BC116186-1|AAI16187.1| 1721|Homo sapiens intersectin 1 (SH3 domain
            protein) protein.
          Length = 1721

 Score = 35.1 bits (77), Expect = 0.14
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 1/81 (1%)
 Frame = +1

Query: 244  RASGL-MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
            RA+G+  L V VVE  +L P   +G S+P+  + +    S  + T     TLNP W  + 
Sbjct: 1591 RATGIGRLMVNVVEGIELKPCRSHGKSNPYCEVTM---GSQCHITKTIQDTLNPKWNSNC 1647

Query: 421  SLPMSGTVNEDSLCLEVWDFD 483
                   + ++ LC+ V++ D
Sbjct: 1648 QF-FIRDLEQEVLCITVFERD 1667


>BC116185-1|AAI16186.1| 1716|Homo sapiens ITSN1 protein protein.
          Length = 1716

 Score = 35.1 bits (77), Expect = 0.14
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 1/81 (1%)
 Frame = +1

Query: 244  RASGL-MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
            RA+G+  L V VVE  +L P   +G S+P+  + +    S  + T     TLNP W  + 
Sbjct: 1586 RATGIGRLMVNVVEGIELKPCRSHGKSNPYCEVTM---GSQCHITKTIQDTLNPKWNSNC 1642

Query: 421  SLPMSGTVNEDSLCLEVWDFD 483
                   + ++ LC+ V++ D
Sbjct: 1643 QF-FIRDLEQEVLCITVFERD 1662


>BC039205-1|AAH39205.1|  431|Homo sapiens synaptotagmin XI protein.
          Length = 431

 Score = 35.1 bits (77), Expect = 0.14
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = +1

Query: 262 LNVEVVEATDL-VPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
           L V + EA  L V  D    SDP++ + ++ +  HR  T V   TL+PV++E F+
Sbjct: 174 LVVTIQEAHGLPVMDDQTQGSDPYIKMTILPDKRHRVKTRVLRKTLDPVFDETFT 228


>BC013690-1|AAH13690.1|  431|Homo sapiens synaptotagmin XI protein.
          Length = 431

 Score = 35.1 bits (77), Expect = 0.14
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = +1

Query: 262 LNVEVVEATDL-VPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
           L V + EA  L V  D    SDP++ + ++ +  HR  T V   TL+PV++E F+
Sbjct: 174 LVVTIQEAHGLPVMDDQTQGSDPYIKMTILPDKRHRVKTRVLRKTLDPVFDETFT 228


>BC004291-1|AAH04291.1|  431|Homo sapiens synaptotagmin XI protein.
          Length = 431

 Score = 35.1 bits (77), Expect = 0.14
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = +1

Query: 262 LNVEVVEATDL-VPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
           L V + EA  L V  D    SDP++ + ++ +  HR  T V   TL+PV++E F+
Sbjct: 174 LVVTIQEAHGLPVMDDQTQGSDPYIKMTILPDKRHRVKTRVLRKTLDPVFDETFT 228


>BC001142-1|AAH01142.1|  537|Homo sapiens copine I protein.
          Length = 537

 Score = 35.1 bits (77), Expect = 0.14
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 2/54 (3%)
 Frame = +1

Query: 277 VEATDLVPKDPNGLSDPFVTIYLMSNSSHR--YNTSVKSGTLNPVWEEHFSLPM 432
           VEA +L  KD  G SDPF+  +   +      Y + V    LNP W + FS+P+
Sbjct: 144 VEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTW-KRFSVPV 196


>AL139128-6|CAH69948.1|  431|Homo sapiens synaptotagmin XI protein.
          Length = 431

 Score = 35.1 bits (77), Expect = 0.14
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = +1

Query: 262 LNVEVVEATDL-VPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
           L V + EA  L V  D    SDP++ + ++ +  HR  T V   TL+PV++E F+
Sbjct: 174 LVVTIQEAHGLPVMDDQTQGSDPYIKMTILPDKRHRVKTRVLRKTLDPVFDETFT 228


>AL109827-17|CAI20127.1|  209|Homo sapiens copine I protein.
          Length = 209

 Score = 35.1 bits (77), Expect = 0.14
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 2/54 (3%)
 Frame = +1

Query: 277 VEATDLVPKDPNGLSDPFVTIYLMSNSSHR--YNTSVKSGTLNPVWEEHFSLPM 432
           VEA +L  KD  G SDPF+  +   +      Y + V    LNP W + FS+P+
Sbjct: 144 VEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTW-KRFSVPV 196


>AL109827-16|CAI20128.1|  202|Homo sapiens copine I protein.
          Length = 202

 Score = 35.1 bits (77), Expect = 0.14
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 2/54 (3%)
 Frame = +1

Query: 277 VEATDLVPKDPNGLSDPFVTIYLMSNSSHR--YNTSVKSGTLNPVWEEHFSLPM 432
           VEA +L  KD  G SDPF+  +   +      Y + V    LNP W + FS+P+
Sbjct: 144 VEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTW-KRFSVPV 196


>AL109827-15|CAI20126.1|  231|Homo sapiens copine I protein.
          Length = 231

 Score = 35.1 bits (77), Expect = 0.14
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 2/54 (3%)
 Frame = +1

Query: 277 VEATDLVPKDPNGLSDPFVTIYLMSNSSHR--YNTSVKSGTLNPVWEEHFSLPM 432
           VEA +L  KD  G SDPF+  +   +      Y + V    LNP W + FS+P+
Sbjct: 144 VEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTW-KRFSVPV 196


>AL109827-13|CAI20123.1|  304|Homo sapiens copine I protein.
          Length = 304

 Score = 35.1 bits (77), Expect = 0.14
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 2/54 (3%)
 Frame = +1

Query: 277 VEATDLVPKDPNGLSDPFVTIYLMSNSSHR--YNTSVKSGTLNPVWEEHFSLPM 432
           VEA +L  KD  G SDPF+  +   +      Y + V    LNP W + FS+P+
Sbjct: 144 VEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTW-KRFSVPV 196


>AL109827-10|CAO72111.1|  481|Homo sapiens copine I protein.
          Length = 481

 Score = 35.1 bits (77), Expect = 0.14
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 2/54 (3%)
 Frame = +1

Query: 277 VEATDLVPKDPNGLSDPFVTIYLMSNSSHR--YNTSVKSGTLNPVWEEHFSLPM 432
           VEA +L  KD  G SDPF+  +   +      Y + V    LNP W + FS+P+
Sbjct: 144 VEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTW-KRFSVPV 196


>AL109827-9|CAB87610.2|  537|Homo sapiens copine I protein.
          Length = 537

 Score = 35.1 bits (77), Expect = 0.14
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 2/54 (3%)
 Frame = +1

Query: 277 VEATDLVPKDPNGLSDPFVTIYLMSNSSHR--YNTSVKSGTLNPVWEEHFSLPM 432
           VEA +L  KD  G SDPF+  +   +      Y + V    LNP W + FS+P+
Sbjct: 144 VEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTW-KRFSVPV 196


>AK074931-1|BAC11300.1|  431|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90450 fis, clone NT2RP3001388, highly similar to
           Synaptotagmin XI (SytXI). ).
          Length = 431

 Score = 35.1 bits (77), Expect = 0.14
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = +1

Query: 262 LNVEVVEATDL-VPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
           L V + EA  L V  D    SDP++ + ++ +  HR  T V   TL+PV++E F+
Sbjct: 174 LVVTIQEAHGLPVMDDQTQGSDPYIKMTILPDKRHRVKTRVLRKTLDPVFDETFT 228


>AK027540-1|BAB55186.1|  431|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14634 fis, clone NT2RP2001081, moderately
           similar to SYNAPTOTAGMIN IV. ).
          Length = 431

 Score = 35.1 bits (77), Expect = 0.14
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = +1

Query: 262 LNVEVVEATDL-VPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
           L V + EA  L V  D    SDP++ + ++ +  HR  T V   TL+PV++E F+
Sbjct: 174 LVVTIQEAHGLPVMDDQTQGSDPYIKMTILPDKRHRVKTRVLRKTLDPVFDETFT 228


>AF114487-1|AAD29952.1| 1721|Homo sapiens intersectin long isoform
            protein.
          Length = 1721

 Score = 35.1 bits (77), Expect = 0.14
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 1/81 (1%)
 Frame = +1

Query: 244  RASGL-MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
            RA+G+  L V VVE  +L P   +G S+P+  + +    S  + T     TLNP W  + 
Sbjct: 1591 RATGIGRLMVNVVEGIELKPCRSHGKSNPYCEVTM---GSQCHITKTIQDTLNPKWNSNC 1647

Query: 421  SLPMSGTVNEDSLCLEVWDFD 483
                   + ++ LC+ V++ D
Sbjct: 1648 QF-FIRDLEQEVLCITVFERD 1667


>AF064244-1|AAC78611.1| 1721|Homo sapiens intersectin long form
            protein.
          Length = 1721

 Score = 35.1 bits (77), Expect = 0.14
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 1/81 (1%)
 Frame = +1

Query: 244  RASGL-MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
            RA+G+  L V VVE  +L P   +G S+P+  + +    S  + T     TLNP W  + 
Sbjct: 1591 RATGIGRLMVNVVEGIELKPCRSHGKSNPYCEVTM---GSQCHITKTIQDTLNPKWNSNC 1647

Query: 421  SLPMSGTVNEDSLCLEVWDFD 483
                   + ++ LC+ V++ D
Sbjct: 1648 QF-FIRDLEQEVLCITVFERD 1667


>DQ993201-1|ABJ97706.1|  921|Homo sapiens extended-synaptotagmin 2
           protein.
          Length = 921

 Score = 34.7 bits (76), Expect = 0.18
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 2/60 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNS--SHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L V V    +L+    +G SDP+V +YL+ +   S R  T V   TLNPV+++ F   +S
Sbjct: 803 LIVVVHACRNLIAFSEDG-SDPYVRMYLLPDKRRSGRRKTHVSKKTLNPVFDQSFDFSVS 861


>BC013957-1|AAH13957.1|  358|Homo sapiens FAM62B protein protein.
          Length = 358

 Score = 34.7 bits (76), Expect = 0.18
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 2/60 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNS--SHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L V V    +L+    +G SDP+V +YL+ +   S R  T V   TLNPV+++ F   +S
Sbjct: 240 LIVVVHACRNLIAFSEDG-SDPYVRMYLLPDKRRSGRRKTHVSKKTLNPVFDQSFDFSVS 298


>AY368150-1|AAR89381.1|  893|Homo sapiens KIAA1228 protein protein.
          Length = 893

 Score = 34.7 bits (76), Expect = 0.18
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 2/60 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNS--SHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L V V    +L+    +G SDP+V +YL+ +   S R  T V   TLNPV+++ F   +S
Sbjct: 775 LIVVVHACRNLIAFSEDG-SDPYVRMYLLPDKRRSGRRKTHVSKKTLNPVFDQSFDFSVS 833


>AK001181-1|BAA91539.1|  358|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10319 fis, clone NT2RM2000490, weakly similar to
           SYNAPTOTAGMIN. ).
          Length = 358

 Score = 34.7 bits (76), Expect = 0.18
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 2/60 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNS--SHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L V V    +L+    +G SDP+V +YL+ +   S R  T V   TLNPV+++ F   +S
Sbjct: 240 LIVVVHACRNLIAFSEDG-SDPYVRMYLLPDKRRSGRRKTHVSKKTLNPVFDQSFDFSVS 298


>AJ303365-1|CAC33887.1|  158|Homo sapiens chr2 synaptotagmin
           protein.
          Length = 158

 Score = 34.7 bits (76), Expect = 0.18
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 2/60 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNS--SHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L V V    +L+    +G SDP+V +YL+ +   S R  T V   TLNPV+++ F   +S
Sbjct: 57  LIVVVHACRNLIAFSEDG-SDPYVRMYLLPDKRRSGRRKTHVSKKTLNPVFDQSFDFSVS 115


>AB033054-1|BAA86542.2|  843|Homo sapiens KIAA1228 protein protein.
          Length = 843

 Score = 34.7 bits (76), Expect = 0.18
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 2/60 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNS--SHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L V V    +L+    +G SDP+V +YL+ +   S R  T V   TLNPV+++ F   +S
Sbjct: 725 LIVVVHACRNLIAFSEDG-SDPYVRMYLLPDKRRSGRRKTHVSKKTLNPVFDQSFDFSVS 783


>AJ007973-1|CAA07800.1|  158|Homo sapiens dysferlin protein.
          Length = 158

 Score = 34.3 bits (75), Expect = 0.24
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVW 408
           ++ + +V A  L PKDPNG  DP++ I +   S    +  +   TL PV+
Sbjct: 109 LVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPC-TLEPVF 157


>BC036538-1|AAH36538.1|  425|Homo sapiens synaptotagmin IV protein.
          Length = 425

 Score = 33.9 bits (74), Expect = 0.32
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 1/53 (1%)
 Frame = +1

Query: 268 VEVVEATDLVPKDPNGL-SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
           V + EA  L   D   + SDP++ + ++    H+  T V   TL+P ++E F+
Sbjct: 172 VNIKEARGLPAMDEQSMTSDPYIKMTILPEKKHKVKTRVLRKTLDPAFDETFT 224



 Score = 33.5 bits (73), Expect = 0.42
 Identities = 23/63 (36%), Positives = 31/63 (49%), Gaps = 4/63 (6%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPF--VTIYLMSNSSHRYNTSVKSGTLNPVWEE--HFSLP 429
           L V V++A  L   D +GLSDP+  V +Y       +  T VK  T N V+ E   F +P
Sbjct: 304 LTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIP 363

Query: 430 MSG 438
             G
Sbjct: 364 CEG 366


>AF299075-1|AAG37229.1|  425|Homo sapiens synaptotagmin IV protein.
          Length = 425

 Score = 33.9 bits (74), Expect = 0.32
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 1/53 (1%)
 Frame = +1

Query: 268 VEVVEATDLVPKDPNGL-SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
           V + EA  L   D   + SDP++ + ++    H+  T V   TL+P ++E F+
Sbjct: 172 VNIKEARGLPAMDEQSMTSDPYIKMTILPEKKHKVKTRVLRKTLDPAFDETFT 224



 Score = 33.5 bits (73), Expect = 0.42
 Identities = 23/63 (36%), Positives = 31/63 (49%), Gaps = 4/63 (6%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPF--VTIYLMSNSSHRYNTSVKSGTLNPVWEE--HFSLP 429
           L V V++A  L   D +GLSDP+  V +Y       +  T VK  T N V+ E   F +P
Sbjct: 304 LTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIP 363

Query: 430 MSG 438
             G
Sbjct: 364 CEG 366


>AB037763-1|BAA92580.1|  426|Homo sapiens KIAA1342 protein protein.
          Length = 426

 Score = 33.9 bits (74), Expect = 0.32
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 1/53 (1%)
 Frame = +1

Query: 268 VEVVEATDLVPKDPNGL-SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
           V + EA  L   D   + SDP++ + ++    H+  T V   TL+P ++E F+
Sbjct: 173 VNIKEARGLPAMDEQSMTSDPYIKMTILPEKKHKVKTRVLRKTLDPAFDETFT 225



 Score = 33.5 bits (73), Expect = 0.42
 Identities = 23/63 (36%), Positives = 31/63 (49%), Gaps = 4/63 (6%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPF--VTIYLMSNSSHRYNTSVKSGTLNPVWEE--HFSLP 429
           L V V++A  L   D +GLSDP+  V +Y       +  T VK  T N V+ E   F +P
Sbjct: 305 LTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIP 364

Query: 430 MSG 438
             G
Sbjct: 365 CEG 367


>BC052617-1|AAH52617.1| 1577|Homo sapiens FER1L3 protein protein.
          Length = 1577

 Score = 33.1 bits (72), Expect = 0.55
 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 2/77 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           ML V +VE+   +PK   G  DP V++        +  T      LNPVW E     + G
Sbjct: 1   MLRV-IVESASNIPKTKFGKPDPIVSVIF---KDEKKKTKKVDNELNPVWNEILEFDLRG 56

Query: 439 TVNE--DSLCLEVWDFD 483
              +   SL + V DF+
Sbjct: 57  IPLDFSSSLGIIVKDFE 73



 Score = 31.9 bits (69), Expect = 1.3
 Identities = 16/51 (31%), Positives = 25/51 (49%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
            L   V +A +L+  D +  SDP+  I  +  S     T +   TLNP W++
Sbjct: 1141 LRCYVYQARNLLALDKDSFSDPYAHICFLHRSK---TTEIIHSTLNPTWDQ 1188


>AL365364-4|CAI41208.1|  445|Homo sapiens fer-1-like 3, myoferlin
           (C. elegans) protein.
          Length = 445

 Score = 33.1 bits (72), Expect = 0.55
 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 2/77 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           ML V +VE+   +PK   G  DP V++        +  T      LNPVW E     + G
Sbjct: 1   MLRV-IVESASNIPKTKFGKPDPIVSVIF---KDEKKKTKKVDNELNPVWNEILEFDLRG 56

Query: 439 TVNE--DSLCLEVWDFD 483
              +   SL + V DF+
Sbjct: 57  IPLDFSSSLGIIVKDFE 73


>AL360229-4|CAH72373.1|  445|Homo sapiens fer-1-like 3, myoferlin
           (C. elegans) protein.
          Length = 445

 Score = 33.1 bits (72), Expect = 0.55
 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 2/77 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           ML V +VE+   +PK   G  DP V++        +  T      LNPVW E     + G
Sbjct: 1   MLRV-IVESASNIPKTKFGKPDPIVSVIF---KDEKKKTKKVDNELNPVWNEILEFDLRG 56

Query: 439 TVNE--DSLCLEVWDFD 483
              +   SL + V DF+
Sbjct: 57  IPLDFSSSLGIIVKDFE 73


>AL360229-1|CAH72370.1|  160|Homo sapiens fer-1-like 3, myoferlin
           (C. elegans) protein.
          Length = 160

 Score = 33.1 bits (72), Expect = 0.55
 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 2/77 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           ML V +VE+   +PK   G  DP V++        +  T      LNPVW E     + G
Sbjct: 1   MLRV-IVESASNIPKTKFGKPDPIVSVIF---KDEKKKTKKVDNELNPVWNEILEFDLRG 56

Query: 439 TVNE--DSLCLEVWDFD 483
              +   SL + V DF+
Sbjct: 57  IPLDFSSSLGIIVKDFE 73


>Z73900-1|CAI42004.1|  671|Homo sapiens synaptotagmin-like 4
           (granuphilin-a) protein.
          Length = 671

 Score = 32.7 bits (71), Expect = 0.73
 Identities = 18/56 (32%), Positives = 33/56 (58%), Gaps = 4/56 (7%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEE--HFSLPMSGTVNEDSLCLEVW 474
           S+P+V  YL+ + S   +  TS+K  T+NP+++E   + +P S  + + +L   VW
Sbjct: 393 SNPYVKTYLLPDKSRQGKRKTSIKRDTINPLYDETLRYEIPES-LLAQRTLQFSVW 447


>BC139914-1|AAI39915.1|  390|Homo sapiens SYT15 protein protein.
          Length = 390

 Score = 32.7 bits (71), Expect = 0.73
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 1/60 (1%)
 Frame = +1

Query: 307 PNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG-TVNEDSLCLEVWDFD 483
           P+    P V +YL+ +      +  K  T NP ++EHF   +S  T+ +  L   V+  D
Sbjct: 177 PSETCSPLVKLYLLPDERRFLQSKTKRKTSNPQFDEHFIFQVSSKTITQRVLKFSVYHVD 236


>AL391688-1|CAI41007.1|  671|Homo sapiens synaptotagmin-like 4
           (granuphilin-a) protein.
          Length = 671

 Score = 32.7 bits (71), Expect = 0.73
 Identities = 18/56 (32%), Positives = 33/56 (58%), Gaps = 4/56 (7%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEE--HFSLPMSGTVNEDSLCLEVW 474
           S+P+V  YL+ + S   +  TS+K  T+NP+++E   + +P S  + + +L   VW
Sbjct: 393 SNPYVKTYLLPDKSRQGKRKTSIKRDTINPLYDETLRYEIPES-LLAQRTLQFSVW 447


>AL356056-4|CAH73271.1|  474|Homo sapiens synaptotagmin XV protein.
          Length = 474

 Score = 32.7 bits (71), Expect = 0.73
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 1/60 (1%)
 Frame = +1

Query: 307 PNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG-TVNEDSLCLEVWDFD 483
           P+    P V +YL+ +      +  K  T NP ++EHF   +S  T+ +  L   V+  D
Sbjct: 230 PSETCSPLVKLYLLPDERRFLQSKTKRKTSNPQFDEHFIFQVSSKTITQRVLKFSVYHVD 289


>AK131036-1|BAC85479.1|  348|Homo sapiens protein ( Homo sapiens
           cDNA FLJ29001 fis, clone CBL08678. ).
          Length = 348

 Score = 32.7 bits (71), Expect = 0.73
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 1/60 (1%)
 Frame = +1

Query: 307 PNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG-TVNEDSLCLEVWDFD 483
           P+    P V +YL+ +      +  K  T NP ++EHF   +S  T+ +  L   V+  D
Sbjct: 177 PSETCSPLVKLYLLPDERRFLQSKTKRKTSNPQFDEHFIFQVSSKTITQRVLKFSVYHVD 236


>AK127436-1|BAC86979.1|  474|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45528 fis, clone BRTHA2027250, weakly  similar
           to Synaptotagmin B. ).
          Length = 474

 Score = 32.7 bits (71), Expect = 0.73
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 1/60 (1%)
 Frame = +1

Query: 307 PNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG-TVNEDSLCLEVWDFD 483
           P+    P V +YL+ +      +  K  T NP ++EHF   +S  T+ +  L   V+  D
Sbjct: 230 PSETCSPLVKLYLLPDERRFLQSKTKRKTSNPQFDEHFIFQVSSKTITQRVLKFSVYHVD 289


>AF302493-1|AAQ14492.1|  673|Homo sapiens endocrine transmitter
           regulatory protein protein.
          Length = 673

 Score = 32.7 bits (71), Expect = 0.73
 Identities = 18/56 (32%), Positives = 33/56 (58%), Gaps = 4/56 (7%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEE--HFSLPMSGTVNEDSLCLEVW 474
           S+P+V  YL+ + S   +  TS+K  T+NP+++E   + +P S  + + +L   VW
Sbjct: 395 SNPYVKTYLLPDKSRQGKRKTSIKRDTINPLYDETLRYEIPES-LLAQRTLQFSVW 449


>AB109023-1|BAC76818.1|  390|Homo sapiens synaptotagmin XV-b
           protein.
          Length = 390

 Score = 32.7 bits (71), Expect = 0.73
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 1/60 (1%)
 Frame = +1

Query: 307 PNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG-TVNEDSLCLEVWDFD 483
           P+    P V +YL+ +      +  K  T NP ++EHF   +S  T+ +  L   V+  D
Sbjct: 177 PSETCSPLVKLYLLPDERRFLQSKTKRKTSNPQFDEHFIFQVSSKTITQRVLKFSVYHVD 236


>AB109022-1|BAC76817.1|  421|Homo sapiens synaptotagmin XV-a
           protein.
          Length = 421

 Score = 32.7 bits (71), Expect = 0.73
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 1/60 (1%)
 Frame = +1

Query: 307 PNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG-TVNEDSLCLEVWDFD 483
           P+    P V +YL+ +      +  K  T NP ++EHF   +S  T+ +  L   V+  D
Sbjct: 177 PSETCSPLVKLYLLPDERRFLQSKTKRKTSNPQFDEHFIFQVSSKTITQRVLKFSVYHVD 236


>BX537410-1|CAD97652.1|  671|Homo sapiens hypothetical protein
           protein.
          Length = 671

 Score = 32.3 bits (70), Expect = 0.96
 Identities = 18/56 (32%), Positives = 33/56 (58%), Gaps = 4/56 (7%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEE--HFSLPMSGTVNEDSLCLEVW 474
           S+P+V  YL+ + S   +  TS+K  T+NP+++E   + +P S  + + +L   VW
Sbjct: 393 SNPYVKTYLLPDKSRQGKRKTSIKRDTVNPLYDETLRYEIPES-LLAQRTLQFSVW 447


>BC014913-1|AAH14913.1|  671|Homo sapiens synaptotagmin-like 4
           (granuphilin-a) protein.
          Length = 671

 Score = 32.3 bits (70), Expect = 0.96
 Identities = 18/56 (32%), Positives = 33/56 (58%), Gaps = 4/56 (7%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEE--HFSLPMSGTVNEDSLCLEVW 474
           S+P+V  YL+ + S   +  TS+K  T+NP+++E   + +P S  + + +L   VW
Sbjct: 393 SNPYVKTYLLPDKSRQGKRKTSIKRDTVNPLYDETLRYEIPES-LLAQRTLQFSVW 447


>AK094110-1|BAC04287.1|  671|Homo sapiens protein ( Homo sapiens
           cDNA FLJ36791 fis, clone ADRGL2004833, highly similar to
           Mus musculus mRNA for granuphilin-a. ).
          Length = 671

 Score = 32.3 bits (70), Expect = 0.96
 Identities = 18/56 (32%), Positives = 33/56 (58%), Gaps = 4/56 (7%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEE--HFSLPMSGTVNEDSLCLEVW 474
           S+P+V  YL+ + S   +  TS+K  T+NP+++E   + +P S  + + +L   VW
Sbjct: 393 SNPYVKTYLLPDKSRQGKRKTSIKRDTVNPLYDETLRYEIPES-LLAQRTLQFSVW 447


>AY190519-1|AAO38848.1| 1692|Homo sapiens Rab3A-interacting molecule
           protein.
          Length = 1692

 Score = 31.9 bits (69), Expect = 1.3
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 5/80 (6%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHF- 420
           G  L V V++ATDL  +      +P+V +Y +   S+ S R   +VK   L P W + F 
Sbjct: 756 GHQLIVNVLQATDLPARVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKK-ILEPKWNQTFV 814

Query: 421 -SLPMSGTVNEDSLCLEVWD 477
            S        E  L + VWD
Sbjct: 815 YSHVHRRDFRERMLEITVWD 834


>AL590011-1|CAI16961.1| 1039|Homo sapiens regulating synaptic
           membrane exocytosis 1 protein.
          Length = 1039

 Score = 31.9 bits (69), Expect = 1.3
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 5/80 (6%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHF- 420
           G  L V V++ATDL  +      +P+V +Y +   S+ S R   +VK   L P W + F 
Sbjct: 756 GHQLIVNVLQATDLPARVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKK-ILEPKWNQTFV 814

Query: 421 -SLPMSGTVNEDSLCLEVWD 477
            S        E  L + VWD
Sbjct: 815 YSHVHRRDFRERMLEITVWD 834


>AL445256-7|CAI39602.1|  624|Homo sapiens regulating synaptic
           membrane exocytosis 1 protein.
          Length = 624

 Score = 31.9 bits (69), Expect = 1.3
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 5/80 (6%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHF- 420
           G  L V V++ATDL  +      +P+V +Y +   S+ S R   +VK   L P W + F 
Sbjct: 9   GHQLIVNVLQATDLPARVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKK-ILEPKWNQTFV 67

Query: 421 -SLPMSGTVNEDSLCLEVWD 477
            S        E  L + VWD
Sbjct: 68  YSHVHRRDFRERMLEITVWD 87


>AL445256-6|CAI39600.1|  728|Homo sapiens regulating synaptic
           membrane exocytosis 1 protein.
          Length = 728

 Score = 31.9 bits (69), Expect = 1.3
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 5/80 (6%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHF- 420
           G  L V V++ATDL  +      +P+V +Y +   S+ S R   +VK   L P W + F 
Sbjct: 9   GHQLIVNVLQATDLPARVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKK-ILEPKWNQTFV 67

Query: 421 -SLPMSGTVNEDSLCLEVWD 477
            S        E  L + VWD
Sbjct: 68  YSHVHRRDFRERMLEITVWD 87


>AL445256-5|CAI39605.1|  544|Homo sapiens regulating synaptic
           membrane exocytosis 1 protein.
          Length = 544

 Score = 31.9 bits (69), Expect = 1.3
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 5/80 (6%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHF- 420
           G  L V V++ATDL  +      +P+V +Y +   S+ S R   +VK   L P W + F 
Sbjct: 9   GHQLIVNVLQATDLPARVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKK-ILEPKWNQTFV 67

Query: 421 -SLPMSGTVNEDSLCLEVWD 477
            S        E  L + VWD
Sbjct: 68  YSHVHRRDFRERMLEITVWD 87


>AL445256-4|CAI39604.1|  768|Homo sapiens regulating synaptic
           membrane exocytosis 1 protein.
          Length = 768

 Score = 31.9 bits (69), Expect = 1.3
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 5/80 (6%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHF- 420
           G  L V V++ATDL  +      +P+V +Y +   S+ S R   +VK   L P W + F 
Sbjct: 9   GHQLIVNVLQATDLPARVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKK-ILEPKWNQTFV 67

Query: 421 -SLPMSGTVNEDSLCLEVWD 477
            S        E  L + VWD
Sbjct: 68  YSHVHRRDFRERMLEITVWD 87


>AL445256-3|CAI39601.1|  794|Homo sapiens regulating synaptic
           membrane exocytosis 1 protein.
          Length = 794

 Score = 31.9 bits (69), Expect = 1.3
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 5/80 (6%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHF- 420
           G  L V V++ATDL  +      +P+V +Y +   S+ S R   +VK   L P W + F 
Sbjct: 9   GHQLIVNVLQATDLPARVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKK-ILEPKWNQTFV 67

Query: 421 -SLPMSGTVNEDSLCLEVWD 477
            S        E  L + VWD
Sbjct: 68  YSHVHRRDFRERMLEITVWD 87


>AL445256-2|CAI39603.1|  595|Homo sapiens regulating synaptic
           membrane exocytosis 1 protein.
          Length = 595

 Score = 31.9 bits (69), Expect = 1.3
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 5/80 (6%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHF- 420
           G  L V V++ATDL  +      +P+V +Y +   S+ S R   +VK   L P W + F 
Sbjct: 9   GHQLIVNVLQATDLPARVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKK-ILEPKWNQTFV 67

Query: 421 -SLPMSGTVNEDSLCLEVWD 477
            S        E  L + VWD
Sbjct: 68  YSHVHRRDFRERMLEITVWD 87


>AL445256-1|CAI39598.1| 1039|Homo sapiens regulating synaptic
           membrane exocytosis 1 protein.
          Length = 1039

 Score = 31.9 bits (69), Expect = 1.3
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 5/80 (6%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHF- 420
           G  L V V++ATDL  +      +P+V +Y +   S+ S R   +VK   L P W + F 
Sbjct: 756 GHQLIVNVLQATDLPARVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKK-ILEPKWNQTFV 814

Query: 421 -SLPMSGTVNEDSLCLEVWD 477
            S        E  L + VWD
Sbjct: 815 YSHVHRRDFRERMLEITVWD 834


>AL390056-1|CAI21554.1| 1039|Homo sapiens regulating synaptic
           membrane exocytosis 1 protein.
          Length = 1039

 Score = 31.9 bits (69), Expect = 1.3
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 5/80 (6%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHF- 420
           G  L V V++ATDL  +      +P+V +Y +   S+ S R   +VK   L P W + F 
Sbjct: 756 GHQLIVNVLQATDLPARVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKK-ILEPKWNQTFV 814

Query: 421 -SLPMSGTVNEDSLCLEVWD 477
            S        E  L + VWD
Sbjct: 815 YSHVHRRDFRERMLEITVWD 834


>AL035633-7|CAI42137.1|  624|Homo sapiens regulating synaptic
           membrane exocytosis 1 protein.
          Length = 624

 Score = 31.9 bits (69), Expect = 1.3
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 5/80 (6%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHF- 420
           G  L V V++ATDL  +      +P+V +Y +   S+ S R   +VK   L P W + F 
Sbjct: 9   GHQLIVNVLQATDLPARVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKK-ILEPKWNQTFV 67

Query: 421 -SLPMSGTVNEDSLCLEVWD 477
            S        E  L + VWD
Sbjct: 68  YSHVHRRDFRERMLEITVWD 87


>AL035633-6|CAI42135.1|  728|Homo sapiens regulating synaptic
           membrane exocytosis 1 protein.
          Length = 728

 Score = 31.9 bits (69), Expect = 1.3
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 5/80 (6%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHF- 420
           G  L V V++ATDL  +      +P+V +Y +   S+ S R   +VK   L P W + F 
Sbjct: 9   GHQLIVNVLQATDLPARVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKK-ILEPKWNQTFV 67

Query: 421 -SLPMSGTVNEDSLCLEVWD 477
            S        E  L + VWD
Sbjct: 68  YSHVHRRDFRERMLEITVWD 87


>AL035633-5|CAI42140.1|  544|Homo sapiens regulating synaptic
           membrane exocytosis 1 protein.
          Length = 544

 Score = 31.9 bits (69), Expect = 1.3
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 5/80 (6%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHF- 420
           G  L V V++ATDL  +      +P+V +Y +   S+ S R   +VK   L P W + F 
Sbjct: 9   GHQLIVNVLQATDLPARVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKK-ILEPKWNQTFV 67

Query: 421 -SLPMSGTVNEDSLCLEVWD 477
            S        E  L + VWD
Sbjct: 68  YSHVHRRDFRERMLEITVWD 87


>AL035633-4|CAI42139.1|  768|Homo sapiens regulating synaptic
           membrane exocytosis 1 protein.
          Length = 768

 Score = 31.9 bits (69), Expect = 1.3
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 5/80 (6%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHF- 420
           G  L V V++ATDL  +      +P+V +Y +   S+ S R   +VK   L P W + F 
Sbjct: 9   GHQLIVNVLQATDLPARVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKK-ILEPKWNQTFV 67

Query: 421 -SLPMSGTVNEDSLCLEVWD 477
            S        E  L + VWD
Sbjct: 68  YSHVHRRDFRERMLEITVWD 87


>AL035633-3|CAI42136.1|  794|Homo sapiens regulating synaptic
           membrane exocytosis 1 protein.
          Length = 794

 Score = 31.9 bits (69), Expect = 1.3
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 5/80 (6%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHF- 420
           G  L V V++ATDL  +      +P+V +Y +   S+ S R   +VK   L P W + F 
Sbjct: 9   GHQLIVNVLQATDLPARVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKK-ILEPKWNQTFV 67

Query: 421 -SLPMSGTVNEDSLCLEVWD 477
            S        E  L + VWD
Sbjct: 68  YSHVHRRDFRERMLEITVWD 87


>AL035633-2|CAI42138.1|  595|Homo sapiens regulating synaptic
           membrane exocytosis 1 protein.
          Length = 595

 Score = 31.9 bits (69), Expect = 1.3
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 5/80 (6%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHF- 420
           G  L V V++ATDL  +      +P+V +Y +   S+ S R   +VK   L P W + F 
Sbjct: 9   GHQLIVNVLQATDLPARVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKK-ILEPKWNQTFV 67

Query: 421 -SLPMSGTVNEDSLCLEVWD 477
            S        E  L + VWD
Sbjct: 68  YSHVHRRDFRERMLEITVWD 87


>AL034373-1|CAI20558.1| 1039|Homo sapiens regulating synaptic
           membrane exocytosis 1 protein.
          Length = 1039

 Score = 31.9 bits (69), Expect = 1.3
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 5/80 (6%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHF- 420
           G  L V V++ATDL  +      +P+V +Y +   S+ S R   +VK   L P W + F 
Sbjct: 756 GHQLIVNVLQATDLPARVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKK-ILEPKWNQTFV 814

Query: 421 -SLPMSGTVNEDSLCLEVWD 477
            S        E  L + VWD
Sbjct: 815 YSHVHRRDFRERMLEITVWD 834


>AB051866-1|BAB87242.1| 1470|Homo sapiens RIM long form protein.
          Length = 1470

 Score = 31.9 bits (69), Expect = 1.3
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 5/80 (6%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHF- 420
           G  L V V++ATDL  +      +P+V +Y +   S+ S R   +VK   L P W + F 
Sbjct: 745 GHQLIVNVLQATDLPARVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKK-ILEPKWNQTFV 803

Query: 421 -SLPMSGTVNEDSLCLEVWD 477
            S        E  L + VWD
Sbjct: 804 YSHVHRRDFRERMLEITVWD 823


>AB045726-1|BAB87121.1| 1028|Homo sapiens RIM short form protein.
          Length = 1028

 Score = 31.9 bits (69), Expect = 1.3
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 5/80 (6%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVKSGTLNPVWEEHF- 420
           G  L V V++ATDL  +      +P+V +Y +   S+ S R   +VK   L P W + F 
Sbjct: 745 GHQLIVNVLQATDLPARVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKK-ILEPKWNQTFV 803

Query: 421 -SLPMSGTVNEDSLCLEVWD 477
            S        E  L + VWD
Sbjct: 804 YSHVHRRDFRERMLEITVWD 823


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 74,566,383
Number of Sequences: 237096
Number of extensions: 1483141
Number of successful extensions: 3566
Number of sequences better than 10.0: 268
Number of HSP's better than 10.0 without gapping: 3292
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3504
length of database: 76,859,062
effective HSP length: 85
effective length of database: 56,705,902
effective search space used: 4536472160
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).