SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0100
         (644 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC114377-1|AAI14378.1|   44|Homo sapiens Unknown (protein for MG...    70   8e-12
X04701-1|CAA28407.1|  705|Homo sapiens protein ( Human mRNA for ...    31   3.5  
M14058-1|AAA51851.1|  705|Homo sapiens C1R protein.                    31   3.5  
BC042145-1|AAH42145.1|  837|Homo sapiens zinc fingers and homeob...    31   3.5  
BC035220-1|AAH35220.1|  705|Homo sapiens complement component 1,...    31   3.5  
AB083653-1|BAC76615.1|  837|Homo sapiens transcription factor ZH...    31   3.5  
AB083037-1|BAC19850.2|  705|Homo sapiens r subcomponent of compl...    31   3.5  
AB020661-1|BAA74877.2|  868|Homo sapiens KIAA0854 protein protein.     31   3.5  

>BC114377-1|AAI14378.1|   44|Homo sapiens Unknown (protein for
           MGC:134704) protein.
          Length = 44

 Score = 69.7 bits (163), Expect = 8e-12
 Identities = 31/34 (91%), Positives = 32/34 (94%)
 Frame = -1

Query: 638 MIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTS 537
           MIGRADIEGSKS+VAMNAW PQASYPCGNFS TS
Sbjct: 1   MIGRADIEGSKSDVAMNAWPPQASYPCGNFSDTS 34


>X04701-1|CAA28407.1|  705|Homo sapiens protein ( Human mRNA for
           complement component C1r. ).
          Length = 705

 Score = 31.1 bits (67), Expect = 3.5
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = +2

Query: 2   D*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSS 112
           D +  HCPY    +  A G  +GE  GK+ P +LD+S
Sbjct: 244 DHQQVHCPYD-QLQIYANGKNIGEFCGKQRPPDLDTS 279


>M14058-1|AAA51851.1|  705|Homo sapiens C1R protein.
          Length = 705

 Score = 31.1 bits (67), Expect = 3.5
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = +2

Query: 2   D*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSS 112
           D +  HCPY    +  A G  +GE  GK+ P +LD+S
Sbjct: 244 DHQQVHCPYD-QLQIYANGKNIGEFCGKQRPPDLDTS 279


>BC042145-1|AAH42145.1|  837|Homo sapiens zinc fingers and
           homeoboxes 2 protein.
          Length = 837

 Score = 31.1 bits (67), Expect = 3.5
 Identities = 26/87 (29%), Positives = 41/87 (47%)
 Frame = -2

Query: 406 LGHLRYSLTDVPPQSNSPPGSVLEPDHAGVLNGDERFRHVTTLHAWNETPWPADIIDRAP 227
           LG     LT V   S +   S +    AGV N  ++ R + T  A  E   P   I + P
Sbjct: 371 LGQTSLVLTQVTSGSTTVSCSPITLAVAGVTNHGQK-RPLVTPQAAPEPKRPH--IAQVP 427

Query: 226 LPPNRVSNETMKVVVFQRRSRETISHL 146
            PP +V+N  +     +++++E I+HL
Sbjct: 428 EPPPKVANPPLTPASDRKKTKEQIAHL 454


>BC035220-1|AAH35220.1|  705|Homo sapiens complement component 1, r
           subcomponent protein.
          Length = 705

 Score = 31.1 bits (67), Expect = 3.5
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = +2

Query: 2   D*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSS 112
           D +  HCPY    +  A G  +GE  GK+ P +LD+S
Sbjct: 244 DHQQVHCPYD-QLQIYANGKNIGEFCGKQRPPDLDTS 279


>AB083653-1|BAC76615.1|  837|Homo sapiens transcription factor ZHX2
           protein.
          Length = 837

 Score = 31.1 bits (67), Expect = 3.5
 Identities = 26/87 (29%), Positives = 41/87 (47%)
 Frame = -2

Query: 406 LGHLRYSLTDVPPQSNSPPGSVLEPDHAGVLNGDERFRHVTTLHAWNETPWPADIIDRAP 227
           LG     LT V   S +   S +    AGV N  ++ R + T  A  E   P   I + P
Sbjct: 371 LGQTSLVLTQVTSGSTTVSCSPITLAVAGVTNHGQK-RPLVTPQAAPEPKRPH--IAQVP 427

Query: 226 LPPNRVSNETMKVVVFQRRSRETISHL 146
            PP +V+N  +     +++++E I+HL
Sbjct: 428 EPPPKVANPPLTPASDRKKTKEQIAHL 454


>AB083037-1|BAC19850.2|  705|Homo sapiens r subcomponent of
           complement component 1 protein.
          Length = 705

 Score = 31.1 bits (67), Expect = 3.5
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = +2

Query: 2   D*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSS 112
           D +  HCPY    +  A G  +GE  GK+ P +LD+S
Sbjct: 244 DHQQVHCPYD-QLQIYANGKNIGEFCGKQRPPDLDTS 279


>AB020661-1|BAA74877.2|  868|Homo sapiens KIAA0854 protein protein.
          Length = 868

 Score = 31.1 bits (67), Expect = 3.5
 Identities = 26/87 (29%), Positives = 41/87 (47%)
 Frame = -2

Query: 406 LGHLRYSLTDVPPQSNSPPGSVLEPDHAGVLNGDERFRHVTTLHAWNETPWPADIIDRAP 227
           LG     LT V   S +   S +    AGV N  ++ R + T  A  E   P   I + P
Sbjct: 402 LGQTSLVLTQVTSGSTTVSCSPITLAVAGVTNHGQK-RPLVTPQAAPEPKRPH--IAQVP 458

Query: 226 LPPNRVSNETMKVVVFQRRSRETISHL 146
            PP +V+N  +     +++++E I+HL
Sbjct: 459 EPPPKVANPPLTPASDRKKTKEQIAHL 485


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 99,491,838
Number of Sequences: 237096
Number of extensions: 2317804
Number of successful extensions: 5748
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 5334
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5744
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7141427170
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).