SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0099
         (684 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC114377-1|AAI14378.1|   44|Homo sapiens Unknown (protein for MG...    41   0.005
BC126910-1|AAI26911.2| 1768|Homo sapiens TNS1 protein protein.         38   0.033
BC116188-1|AAI16189.1| 1713|Homo sapiens TNS1 protein protein.         38   0.033
AB209238-1|BAD92475.1|  873|Homo sapiens tensin variant protein.       38   0.033
BC011765-1|AAH11765.1|  449|Homo sapiens chromosome 11 open read...    36   0.10 
AY358754-1|AAQ89114.1|  449|Homo sapiens C11orf24 protein.             36   0.10 
AF264781-1|AAG36936.1|  449|Homo sapiens DM4E3 protein.                36   0.10 
BC084581-1|AAH84581.1|  163|Homo sapiens ZNF703 protein protein.       32   2.2  
X04701-1|CAA28407.1|  705|Homo sapiens protein ( Human mRNA for ...    31   3.8  
M14058-1|AAA51851.1|  705|Homo sapiens C1R protein.                    31   3.8  
BC035220-1|AAH35220.1|  705|Homo sapiens complement component 1,...    31   3.8  
AB083037-1|BAC19850.2|  705|Homo sapiens r subcomponent of compl...    31   3.8  
BC116187-1|AAI16188.1| 1721|Homo sapiens TNS1 protein protein.         30   6.7  
BC040516-1|AAH40516.1|  859|Homo sapiens SGIP1 protein protein.        30   8.8  
AL356913-2|CAI22674.1|  828|Homo sapiens SH3-domain GRB2-like (e...    30   8.8  
AL356913-1|CAI22672.1|  859|Homo sapiens SH3-domain GRB2-like (e...    30   8.8  
AL354978-6|CAH71846.1|  828|Homo sapiens SH3-domain GRB2-like (e...    30   8.8  
AL354978-5|CAH71845.1|  859|Homo sapiens SH3-domain GRB2-like (e...    30   8.8  
AL139147-3|CAI21943.1|  828|Homo sapiens SH3-domain GRB2-like (e...    30   8.8  
AL139147-2|CAI21942.1|  859|Homo sapiens SH3-domain GRB2-like (e...    30   8.8  
AB210039-1|BAE06121.1|  856|Homo sapiens DKFZp761D221 variant pr...    30   8.8  

>BC114377-1|AAI14378.1|   44|Homo sapiens Unknown (protein for
           MGC:134704) protein.
          Length = 44

 Score = 40.7 bits (91), Expect = 0.005
 Identities = 16/19 (84%), Positives = 16/19 (84%)
 Frame = -2

Query: 683 WLPQASYPCGNFSGTSC*K 627
           W PQASYPCGNFS TSC K
Sbjct: 19  WPPQASYPCGNFSDTSCLK 37


>BC126910-1|AAI26911.2| 1768|Homo sapiens TNS1 protein protein.
          Length = 1768

 Score = 37.9 bits (84), Expect = 0.033
 Identities = 25/91 (27%), Positives = 40/91 (43%), Gaps = 3/91 (3%)
 Frame = -1

Query: 393  ATSPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETTP-TYATPLMSPYN 217
            A +PL  LG K   PADI+      P        +  V   R++++ P +++ P    Y 
Sbjct: 1030 AKTPLSALGLKPHNPADILLHPTGEPRSYVESVARTAVAGPRAQDSEPKSFSAPATQAYG 1089

Query: 216  AR--LESSSTGSSFPADSPKPVPLAVVSLDS 130
                L + + G SF + SP      ++S DS
Sbjct: 1090 HEIPLRNGTLGGSFVSPSPLSTSSPILSADS 1120


>BC116188-1|AAI16189.1| 1713|Homo sapiens TNS1 protein protein.
          Length = 1713

 Score = 37.9 bits (84), Expect = 0.033
 Identities = 25/91 (27%), Positives = 40/91 (43%), Gaps = 3/91 (3%)
 Frame = -1

Query: 393  ATSPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETTP-TYATPLMSPYN 217
            A +PL  LG K   PADI+      P        +  V   R++++ P +++ P    Y 
Sbjct: 975  AKTPLSALGLKPHNPADILLHPTGEPRSYVESVARTAVAGPRAQDSEPKSFSAPATQAYG 1034

Query: 216  AR--LESSSTGSSFPADSPKPVPLAVVSLDS 130
                L + + G SF + SP      ++S DS
Sbjct: 1035 HEIPLRNGTLGGSFVSPSPLSTSSPILSADS 1065


>AB209238-1|BAD92475.1|  873|Homo sapiens tensin variant protein.
          Length = 873

 Score = 37.9 bits (84), Expect = 0.033
 Identities = 25/91 (27%), Positives = 40/91 (43%), Gaps = 3/91 (3%)
 Frame = -1

Query: 393 ATSPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETTP-TYATPLMSPYN 217
           A +PL  LG K   PADI+      P        +  V   R++++ P +++ P    Y 
Sbjct: 135 AKTPLSALGLKPHNPADILLHPTGEPRSYVESVARTAVAGPRAQDSEPKSFSAPATQAYG 194

Query: 216 AR--LESSSTGSSFPADSPKPVPLAVVSLDS 130
               L + + G SF + SP      ++S DS
Sbjct: 195 HEIPLRNGTLGGSFVSPSPLSTSSPILSADS 225


>BC011765-1|AAH11765.1|  449|Homo sapiens chromosome 11 open reading
           frame 24 protein.
          Length = 449

 Score = 36.3 bits (80), Expect = 0.10
 Identities = 29/116 (25%), Positives = 51/116 (43%), Gaps = 7/116 (6%)
 Frame = -1

Query: 480 QMYRPSQTPRLAVSSNRITREF*TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNR--- 310
           Q+ + S  PR A  +   TR    AT+ + +SP+ T  +  +        +P+PP R   
Sbjct: 194 QVPKSSALPRTATLATLATRAQTVATTANTSSPMSTRPSPSKHMPSDTAASPVPPMRPQA 253

Query: 309 ---VSNETMKVVVFQRRSRET-TPTYATPLMSPYNARLESSSTGSSFPADSPKPVP 154
              +S  ++   V    ++ T  P+  TP  +P    + ++   +  P  SP PVP
Sbjct: 254 QGPISQVSVDQPVVNTTNKSTPMPSNTTPEPAPTPTVVTTTKAQAREPTASPVPVP 309


>AY358754-1|AAQ89114.1|  449|Homo sapiens C11orf24 protein.
          Length = 449

 Score = 36.3 bits (80), Expect = 0.10
 Identities = 29/116 (25%), Positives = 51/116 (43%), Gaps = 7/116 (6%)
 Frame = -1

Query: 480 QMYRPSQTPRLAVSSNRITREF*TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNR--- 310
           Q+ + S  PR A  +   TR    AT+ + +SP+ T  +  +        +P+PP R   
Sbjct: 194 QVPKSSALPRTATLATLATRAQTVATTANTSSPMSTRPSPSKHMPSDTAASPVPPMRPQA 253

Query: 309 ---VSNETMKVVVFQRRSRET-TPTYATPLMSPYNARLESSSTGSSFPADSPKPVP 154
              +S  ++   V    ++ T  P+  TP  +P    + ++   +  P  SP PVP
Sbjct: 254 QGPISQVSVDQPVVNTTNKSTPMPSNTTPEPAPTPTVVTTTKAQAREPTASPVPVP 309


>AF264781-1|AAG36936.1|  449|Homo sapiens DM4E3 protein.
          Length = 449

 Score = 36.3 bits (80), Expect = 0.10
 Identities = 29/116 (25%), Positives = 51/116 (43%), Gaps = 7/116 (6%)
 Frame = -1

Query: 480 QMYRPSQTPRLAVSSNRITREF*TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNR--- 310
           Q+ + S  PR A  +   TR    AT+ + +SP+ T  +  +        +P+PP R   
Sbjct: 194 QVPKSSALPRTATLATLATRAQTVATTANTSSPMSTRPSPSKHMPSDTAASPVPPMRPQA 253

Query: 309 ---VSNETMKVVVFQRRSRET-TPTYATPLMSPYNARLESSSTGSSFPADSPKPVP 154
              +S  ++   V    ++ T  P+  TP  +P    + ++   +  P  SP PVP
Sbjct: 254 QGPISQVSVDQPVVNTTNKSTPMPSNTTPEPAPTPTVVTTTKAQAREPTASPVPVP 309


>BC084581-1|AAH84581.1|  163|Homo sapiens ZNF703 protein protein.
          Length = 163

 Score = 31.9 bits (69), Expect = 2.2
 Identities = 17/46 (36%), Positives = 23/46 (50%)
 Frame = -2

Query: 542 LLHARFLSSLSCLRTPALFVDRCTAPVKLPAWQCPRTGSRGSFKRR 405
           LLH  +L  LS      + +D   +P+ L A  C +TGS GS   R
Sbjct: 63  LLHPEYLQPLSSTPVSPIELDAKKSPLALLAQTCSQTGSPGSLSLR 108


>X04701-1|CAA28407.1|  705|Homo sapiens protein ( Human mRNA for
           complement component C1r. ).
          Length = 705

 Score = 31.1 bits (67), Expect = 3.8
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = +2

Query: 101 D*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSS 211
           D +  HCPY    +  A G  +GE  GK+ P +LD+S
Sbjct: 244 DHQQVHCPYD-QLQIYANGKNIGEFCGKQRPPDLDTS 279


>M14058-1|AAA51851.1|  705|Homo sapiens C1R protein.
          Length = 705

 Score = 31.1 bits (67), Expect = 3.8
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = +2

Query: 101 D*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSS 211
           D +  HCPY    +  A G  +GE  GK+ P +LD+S
Sbjct: 244 DHQQVHCPYD-QLQIYANGKNIGEFCGKQRPPDLDTS 279


>BC035220-1|AAH35220.1|  705|Homo sapiens complement component 1, r
           subcomponent protein.
          Length = 705

 Score = 31.1 bits (67), Expect = 3.8
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = +2

Query: 101 D*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSS 211
           D +  HCPY    +  A G  +GE  GK+ P +LD+S
Sbjct: 244 DHQQVHCPYD-QLQIYANGKNIGEFCGKQRPPDLDTS 279


>AB083037-1|BAC19850.2|  705|Homo sapiens r subcomponent of
           complement component 1 protein.
          Length = 705

 Score = 31.1 bits (67), Expect = 3.8
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = +2

Query: 101 D*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSS 211
           D +  HCPY    +  A G  +GE  GK+ P +LD+S
Sbjct: 244 DHQQVHCPYD-QLQIYANGKNIGEFCGKQRPPDLDTS 279


>BC116187-1|AAI16188.1| 1721|Homo sapiens TNS1 protein protein.
          Length = 1721

 Score = 30.3 bits (65), Expect = 6.7
 Identities = 27/99 (27%), Positives = 43/99 (43%), Gaps = 11/99 (11%)
 Frame = -1

Query: 393  ATSPLCTLGTKHRAPADI------IDRAPLPPNRVS--NETMKVVVFQRRSRETTP-TYA 241
            A +PL  LG K   PADI      + R  + P   S      +  V   R++++ P +++
Sbjct: 976  AKTPLSALGLKPHNPADILLHPTGVTRRWIQPEPRSYVESVARTAVAGPRAQDSEPKSFS 1035

Query: 240  TPLMSPYNAR--LESSSTGSSFPADSPKPVPLAVVSLDS 130
             P    Y     L + + G SF + SP      ++S DS
Sbjct: 1036 APATQAYGHEIPLRNGTLGGSFVSPSPLSTSSPILSADS 1074


>BC040516-1|AAH40516.1|  859|Homo sapiens SGIP1 protein protein.
          Length = 859

 Score = 29.9 bits (64), Expect = 8.8
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = -1

Query: 261 ETTPTYATPLMSPYNARLESSSTGSSFPADSPKPVPL 151
           +T+P + TP ++P    +   +T  + PADSP P PL
Sbjct: 321 DTSPEHVTPELTPREKVVSPPATPDN-PADSPAPGPL 356


>AL356913-2|CAI22674.1|  828|Homo sapiens SH3-domain GRB2-like
           (endophilin) interacting protein 1 protein.
          Length = 828

 Score = 29.9 bits (64), Expect = 8.8
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = -1

Query: 261 ETTPTYATPLMSPYNARLESSSTGSSFPADSPKPVPL 151
           +T+P + TP ++P    +   +T  + PADSP P PL
Sbjct: 317 DTSPEHVTPELTPREKVVSPPATPDN-PADSPAPGPL 352


>AL356913-1|CAI22672.1|  859|Homo sapiens SH3-domain GRB2-like
           (endophilin) interacting protein 1 protein.
          Length = 859

 Score = 29.9 bits (64), Expect = 8.8
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = -1

Query: 261 ETTPTYATPLMSPYNARLESSSTGSSFPADSPKPVPL 151
           +T+P + TP ++P    +   +T  + PADSP P PL
Sbjct: 321 DTSPEHVTPELTPREKVVSPPATPDN-PADSPAPGPL 356


>AL354978-6|CAH71846.1|  828|Homo sapiens SH3-domain GRB2-like
           (endophilin) interacting protein 1 protein.
          Length = 828

 Score = 29.9 bits (64), Expect = 8.8
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = -1

Query: 261 ETTPTYATPLMSPYNARLESSSTGSSFPADSPKPVPL 151
           +T+P + TP ++P    +   +T  + PADSP P PL
Sbjct: 317 DTSPEHVTPELTPREKVVSPPATPDN-PADSPAPGPL 352


>AL354978-5|CAH71845.1|  859|Homo sapiens SH3-domain GRB2-like
           (endophilin) interacting protein 1 protein.
          Length = 859

 Score = 29.9 bits (64), Expect = 8.8
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = -1

Query: 261 ETTPTYATPLMSPYNARLESSSTGSSFPADSPKPVPL 151
           +T+P + TP ++P    +   +T  + PADSP P PL
Sbjct: 321 DTSPEHVTPELTPREKVVSPPATPDN-PADSPAPGPL 356


>AL139147-3|CAI21943.1|  828|Homo sapiens SH3-domain GRB2-like
           (endophilin) interacting protein 1 protein.
          Length = 828

 Score = 29.9 bits (64), Expect = 8.8
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = -1

Query: 261 ETTPTYATPLMSPYNARLESSSTGSSFPADSPKPVPL 151
           +T+P + TP ++P    +   +T  + PADSP P PL
Sbjct: 317 DTSPEHVTPELTPREKVVSPPATPDN-PADSPAPGPL 352


>AL139147-2|CAI21942.1|  859|Homo sapiens SH3-domain GRB2-like
           (endophilin) interacting protein 1 protein.
          Length = 859

 Score = 29.9 bits (64), Expect = 8.8
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = -1

Query: 261 ETTPTYATPLMSPYNARLESSSTGSSFPADSPKPVPL 151
           +T+P + TP ++P    +   +T  + PADSP P PL
Sbjct: 321 DTSPEHVTPELTPREKVVSPPATPDN-PADSPAPGPL 356


>AB210039-1|BAE06121.1|  856|Homo sapiens DKFZp761D221 variant
           protein protein.
          Length = 856

 Score = 29.9 bits (64), Expect = 8.8
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = -1

Query: 261 ETTPTYATPLMSPYNARLESSSTGSSFPADSPKPVPL 151
           +T+P + TP ++P    +   +T  + PADSP P PL
Sbjct: 345 DTSPEHVTPELTPREKVVSPPATPDN-PADSPAPGPL 380


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 104,629,068
Number of Sequences: 237096
Number of extensions: 2390322
Number of successful extensions: 5838
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 5300
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5834
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 7783251346
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).