SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0092
         (720 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X81649-1|CAA57309.1|  850|Homo sapiens gastric mucin protein.          33   1.0  
AJ298317-1|CAC83674.1| 2448|Homo sapiens mucin 5 protein.              33   1.0  
X00734-1|CAA25318.1|  444|Homo sapiens tubulin 5-beta protein.         31   4.1  
BC111374-1|AAI11375.1|  447|Homo sapiens TUBB6 protein protein.        31   5.5  
BC002654-1|AAH02654.1|  446|Homo sapiens tubulin, beta 6 protein.      31   5.5  
AK022340-1|BAB14016.1|  446|Homo sapiens protein ( Homo sapiens ...    31   5.5  
V00599-1|CAA23844.1|  437|Homo sapiens protein ( Human mRNA frag...    30   9.6  
J00314-1|AAB59507.1|  444|Homo sapiens protein ( Human beta-tubu...    30   9.6  
BX248307-8|CAM25935.1|  372|Homo sapiens tubulin beta polypeptid...    30   9.6  
BX248307-7|CAM25934.1|  426|Homo sapiens tubulin beta polypeptid...    30   9.6  
BX248307-6|CAM25933.1|  444|Homo sapiens tubulin beta polypeptid...    30   9.6  
BC103746-1|AAI03747.1|  444|Homo sapiens tubulin, beta protein.        30   9.6  
BC101271-1|AAI01272.1|  441|Homo sapiens TUBB8 protein protein.        30   9.6  
BC101270-1|AAI01271.1|  441|Homo sapiens TUBB8 protein protein.        30   9.6  
BC070326-1|AAH70326.1|  444|Homo sapiens tubulin, beta protein.        30   9.6  
BC062532-1|AAH62532.1|  124|Homo sapiens TUBB protein protein.         30   9.6  
BC021909-1|AAH21909.1|  444|Homo sapiens tubulin, beta protein.        30   9.6  
BC020946-1|AAH20946.1|  444|Homo sapiens tubulin, beta protein.        30   9.6  
BC019924-1|AAH19924.1|  444|Homo sapiens tubulin, beta protein.        30   9.6  
BC015889-1|AAH15889.1|  266|Homo sapiens TUBB protein protein.         30   9.6  
BC013374-1|AAH13374.1|  444|Homo sapiens tubulin, beta protein.        30   9.6  
BC007605-1|AAH07605.1|  444|Homo sapiens tubulin, beta protein.        30   9.6  
BC005838-1|AAH05838.1|  444|Homo sapiens tubulin, beta protein.        30   9.6  
BC002347-1|AAH02347.1|  444|Homo sapiens tubulin, beta protein.        30   9.6  
BC001938-1|AAH01938.1|  444|Homo sapiens tubulin, beta protein.        30   9.6  
BC001896-1|AAH01896.1|  340|Homo sapiens TUBB protein protein.         30   9.6  
BA000025-69|BAB63321.1|  444|Homo sapiens Beta-tubulin protein.        30   9.6  
AL845353-25|CAI41894.1|  372|Homo sapiens tubulin, beta polypept...    30   9.6  
AL845353-24|CAI41893.1|  426|Homo sapiens tubulin, beta polypept...    30   9.6  
AL845353-23|CAI41892.1|  444|Homo sapiens tubulin, beta polypept...    30   9.6  
AL713922-4|CAI16221.1|  435|Homo sapiens novel protein similar t...    30   9.6  
AL713922-3|CAI16220.1|  410|Homo sapiens novel protein similar t...    30   9.6  
AL662848-9|CAI17442.1|  372|Homo sapiens tubulin, beta protein.        30   9.6  
AL662848-8|CAM24851.1|  426|Homo sapiens tubulin, beta protein.        30   9.6  
AL662848-7|CAI17441.1|  444|Homo sapiens tubulin, beta protein.        30   9.6  
AL662797-13|CAI18197.1|  372|Homo sapiens tubulin, beta protein.       30   9.6  
AL662797-12|CAM25516.1|  426|Homo sapiens tubulin, beta protein.       30   9.6  
AL662797-11|CAI18196.1|  444|Homo sapiens tubulin, beta protein.       30   9.6  
AF355127-1|AAL32434.1|  444|Homo sapiens beta-tubulin 4Q protein.      30   9.6  
AF141349-1|AAD33873.1|  444|Homo sapiens beta-tubulin protein.         30   9.6  
AF070600-1|AAC28654.1|  444|Homo sapiens beta-tubulin protein.         30   9.6  
AF070593-1|AAC28650.1|  444|Homo sapiens beta-tubulin protein.         30   9.6  
AF070561-1|AAC28642.1|  444|Homo sapiens beta-tubulin protein.         30   9.6  
AB202098-1|BAE78618.1|  444|Homo sapiens beta 5-tubulin protein.       30   9.6  
AB103606-1|BAF31267.1|  444|Homo sapiens beta-tubulin protein pr...    30   9.6  
AB088100-1|BAC54932.1|  444|Homo sapiens tubulin, beta polypepti...    30   9.6  
AB062393-1|BAB93480.1|  444|Homo sapiens beta 5-tubulin protein.       30   9.6  

>X81649-1|CAA57309.1|  850|Homo sapiens gastric mucin protein.
          Length = 850

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = -1

Query: 582 RSRETISHLCYTSHVSLQCQTRVKLTGSSFPADSPKP 472
           R+RE  S LCY   + +QC T +  + SS PA +  P
Sbjct: 453 RNREQASGLCYNYQIRVQCCTPLACSTSSSPAQTTPP 489


>AJ298317-1|CAC83674.1| 2448|Homo sapiens mucin 5 protein.
          Length = 2448

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = -1

Query: 582  RSRETISHLCYTSHVSLQCQTRVKLTGSSFPADSPKP 472
            R+RE  S LCY   + +QC T +  + SS PA +  P
Sbjct: 1457 RNREQASGLCYNYQIRVQCCTPLPCSTSSSPAQTTPP 1493


>X00734-1|CAA25318.1|  444|Homo sapiens tubulin 5-beta protein.
          Length = 444

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           S+ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 335 SKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>BC111374-1|AAI11375.1|  447|Homo sapiens TUBB6 protein protein.
          Length = 447

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 23/102 (22%), Positives = 42/102 (41%), Gaps = 5/102 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQNWHGQGESDCL 237
           ++ SSY  +WI   V     D+P R +   S    ++       +R ++ +         
Sbjct: 335 NKNSSYFVEWIPNNVKVAVCDIPPRGLKMASTFIGNSTAIQELFKRISEQFSAMFRRKAF 394

Query: 238 IKTKHWMALAGVDAM*FLPSALNVN-----VKKFKQARVNGG 348
           +   HW    G+D M F  +  N+N      ++++ A VN G
Sbjct: 395 L---HWFTGEGMDEMEFTEAESNMNDLVSEYQQYQDATVNDG 433


>BC002654-1|AAH02654.1|  446|Homo sapiens tubulin, beta 6 protein.
          Length = 446

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 22/93 (23%), Positives = 39/93 (41%), Gaps = 2/93 (2%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQNWHGQGESDCL 237
           S+ SSY  +WI   V     D+P R +   S    ++       +R ++ +         
Sbjct: 335 SKNSSYFVEWIPNNVKVAVCDIPPRGLKMASTFIGNSTAIQELFKRISEQFSAMFRRKAF 394

Query: 238 IKTKHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
           +   HW    G+D M F  +  N+N  V +++Q
Sbjct: 395 L---HWFTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>AK022340-1|BAB14016.1|  446|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12278 fis, clone MAMMA1001735, highly similar to
           TUBULIN BETA-5 CHAIN. ).
          Length = 446

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 22/93 (23%), Positives = 39/93 (41%), Gaps = 2/93 (2%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQNWHGQGESDCL 237
           S+ SSY  +WI   V     D+P R +   S    ++       +R ++ +         
Sbjct: 335 SKNSSYFVEWIPNNVKVAVCDIPPRGLKMASTFIGNSTAIQELFKRISEQFSAMFRRKAF 394

Query: 238 IKTKHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
           +   HW    G+D M F  +  N+N  V +++Q
Sbjct: 395 L---HWFTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>V00599-1|CAA23844.1|  437|Homo sapiens protein ( Human mRNA
           fragment encoding beta-tubulin. (from clone D-beta-1).
           ).
          Length = 437

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 328 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 382

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 383 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 417


>J00314-1|AAB59507.1|  444|Homo sapiens protein ( Human beta-tubulin
           gene, clone m40. ).
          Length = 444

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>BX248307-8|CAM25935.1|  372|Homo sapiens tubulin beta polypeptide
           protein.
          Length = 372

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 263 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 317

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 318 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 352


>BX248307-7|CAM25934.1|  426|Homo sapiens tubulin beta polypeptide
           protein.
          Length = 426

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 317 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 371

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 372 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 406


>BX248307-6|CAM25933.1|  444|Homo sapiens tubulin beta polypeptide
           protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>BC103746-1|AAI03747.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>BC101271-1|AAI01272.1|  441|Homo sapiens TUBB8 protein protein.
          Length = 441

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 26/94 (27%), Positives = 43/94 (45%), Gaps = 4/94 (4%)
 Frame = +1

Query: 61  RKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDCL 237
           + SSY +DW+   V     D+P R + +S +F   +     TA+Q   +    Q  +   
Sbjct: 333 KNSSYFADWLPNNVKTAVCDIPPRGLKMSATFIGNN-----TAIQELFKRVSEQFTAMFR 387

Query: 238 IKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
            K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 388 RKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 421


>BC101270-1|AAI01271.1|  441|Homo sapiens TUBB8 protein protein.
          Length = 441

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 26/94 (27%), Positives = 43/94 (45%), Gaps = 4/94 (4%)
 Frame = +1

Query: 61  RKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDCL 237
           + SSY +DW+   V     D+P R + +S +F   +     TA+Q   +    Q  +   
Sbjct: 333 KNSSYFADWLPNNVKTAVCDIPPRGLKMSATFIGNN-----TAIQELFKRVSEQFTAMFR 387

Query: 238 IKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
            K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 388 RKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 421


>BC070326-1|AAH70326.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>BC062532-1|AAH62532.1|  124|Homo sapiens TUBB protein protein.
          Length = 124

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 15  NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 69

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 70  RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 104


>BC021909-1|AAH21909.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>BC020946-1|AAH20946.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>BC019924-1|AAH19924.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>BC015889-1|AAH15889.1|  266|Homo sapiens TUBB protein protein.
          Length = 266

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 157 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 211

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 212 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 246


>BC013374-1|AAH13374.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>BC007605-1|AAH07605.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>BC005838-1|AAH05838.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>BC002347-1|AAH02347.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>BC001938-1|AAH01938.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>BC001896-1|AAH01896.1|  340|Homo sapiens TUBB protein protein.
          Length = 340

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 231 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 285

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 286 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 320


>BA000025-69|BAB63321.1|  444|Homo sapiens Beta-tubulin protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>AL845353-25|CAI41894.1|  372|Homo sapiens tubulin, beta polypeptide
           protein.
          Length = 372

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 263 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 317

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 318 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 352


>AL845353-24|CAI41893.1|  426|Homo sapiens tubulin, beta polypeptide
           protein.
          Length = 426

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 317 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 371

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 372 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 406


>AL845353-23|CAI41892.1|  444|Homo sapiens tubulin, beta polypeptide
           protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>AL713922-4|CAI16221.1|  435|Homo sapiens novel protein similar to
           beta-tubulin 4Q (TUBB4Q)kinase) II gamma protein.
          Length = 435

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 26/94 (27%), Positives = 43/94 (45%), Gaps = 4/94 (4%)
 Frame = +1

Query: 61  RKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDCL 237
           + SSY +DW+   V     D+P R + +S +F   +     TA+Q   +    Q  +   
Sbjct: 336 KNSSYFADWLPNNVKTAVCDIPPRGLKMSATFIGNN-----TAIQELFKRVSEQFTAMFR 390

Query: 238 IKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
            K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 391 RKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>AL713922-3|CAI16220.1|  410|Homo sapiens novel protein similar to
           beta-tubulin 4Q (TUBB4Q)kinase) II gamma protein.
          Length = 410

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 26/94 (27%), Positives = 43/94 (45%), Gaps = 4/94 (4%)
 Frame = +1

Query: 61  RKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDCL 237
           + SSY +DW+   V     D+P R + +S +F   +     TA+Q   +    Q  +   
Sbjct: 302 KNSSYFADWLPNNVKTAVCDIPPRGLKMSATFIGNN-----TAIQELFKRVSEQFTAMFR 356

Query: 238 IKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
            K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 357 RKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 390


>AL662848-9|CAI17442.1|  372|Homo sapiens tubulin, beta protein.
          Length = 372

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 263 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 317

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 318 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 352


>AL662848-8|CAM24851.1|  426|Homo sapiens tubulin, beta protein.
          Length = 426

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 317 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 371

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 372 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 406


>AL662848-7|CAI17441.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>AL662797-13|CAI18197.1|  372|Homo sapiens tubulin, beta protein.
          Length = 372

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 263 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 317

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 318 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 352


>AL662797-12|CAM25516.1|  426|Homo sapiens tubulin, beta protein.
          Length = 426

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 317 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 371

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 372 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 406


>AL662797-11|CAI18196.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>AF355127-1|AAL32434.1|  444|Homo sapiens beta-tubulin 4Q protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 26/94 (27%), Positives = 43/94 (45%), Gaps = 4/94 (4%)
 Frame = +1

Query: 61  RKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDCL 237
           + SSY +DW+   V     D+P R + +S +F   +     TA+Q   +    Q  +   
Sbjct: 336 KNSSYFADWLPNNVKTAVCDIPPRGLKMSATFIGNN-----TAIQELFKRVSEQFTAMFR 390

Query: 238 IKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
            K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 391 RKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>AF141349-1|AAD33873.1|  444|Homo sapiens beta-tubulin protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>AF070600-1|AAC28654.1|  444|Homo sapiens beta-tubulin protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>AF070593-1|AAC28650.1|  444|Homo sapiens beta-tubulin protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>AF070561-1|AAC28642.1|  444|Homo sapiens beta-tubulin protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>AB202098-1|BAE78618.1|  444|Homo sapiens beta 5-tubulin protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>AB103606-1|BAF31267.1|  444|Homo sapiens beta-tubulin protein
           protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>AB088100-1|BAC54932.1|  444|Homo sapiens tubulin, beta polypeptide
           protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>AB062393-1|BAB93480.1|  444|Homo sapiens beta 5-tubulin protein.
          Length = 444

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKV-VSVSFRARSARFCTTAVQRSAQNWHGQGESDC 234
           ++ SSY  +WI   V     D+P R + ++V+F   S     TA+Q   +    Q  +  
Sbjct: 335 NKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNS-----TAIQELFKRISEQFTAMF 389

Query: 235 LIKT-KHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
             K   HW    G+D M F  +  N+N  V +++Q
Sbjct: 390 RRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 108,643,430
Number of Sequences: 237096
Number of extensions: 2330349
Number of successful extensions: 4495
Number of sequences better than 10.0: 47
Number of HSP's better than 10.0 without gapping: 4246
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4411
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8455186714
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).