SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0090
         (604 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC114377-1|AAI14378.1|   44|Homo sapiens Unknown (protein for MG...    52   2e-06
BC048251-1|AAH48251.1|  322|Homo sapiens ZDHHC12 protein protein.      31   2.4  
AL441992-6|CAI15406.1|  210|Homo sapiens zinc finger, DHHC-type ...    31   2.4  
EF623992-1|ABR25252.1|  354|Homo sapiens Uba6-specific E2 conjug...    31   4.1  
X76930-1|CAA54248.1|  465|Homo sapiens hepatocyte nuclear factor...    30   7.2  

>BC114377-1|AAI14378.1|   44|Homo sapiens Unknown (protein for
           MGC:134704) protein.
          Length = 44

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 22/27 (81%), Positives = 22/27 (81%)
 Frame = +2

Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*K 580
           K  VAMNAW PQASYPCGNFS TSC K
Sbjct: 11  KSDVAMNAWPPQASYPCGNFSDTSCLK 37


>BC048251-1|AAH48251.1|  322|Homo sapiens ZDHHC12 protein protein.
          Length = 322

 Score = 31.5 bits (68), Expect = 2.4
 Identities = 17/44 (38%), Positives = 21/44 (47%)
 Frame = -3

Query: 305 HALGRAAGGAKLPSAGLA*TPLRPKPA*PNPARICSLWSPESRE 174
           H    A  G   P++    TP  P P  P PA +CS  SPE R+
Sbjct: 51  HLQAFAQPGTHFPTSNC--TPTPPTPVLPGPASLCSPASPELRQ 92


>AL441992-6|CAI15406.1|  210|Homo sapiens zinc finger, DHHC-type
           containing 12 protein.
          Length = 210

 Score = 31.5 bits (68), Expect = 2.4
 Identities = 17/44 (38%), Positives = 21/44 (47%)
 Frame = -3

Query: 305 HALGRAAGGAKLPSAGLA*TPLRPKPA*PNPARICSLWSPESRE 174
           H    A  G   P++    TP  P P  P PA +CS  SPE R+
Sbjct: 51  HLQAFAQPGTHFPTSNC--TPTPPTPVLPGPASLCSPASPELRQ 92


>EF623992-1|ABR25252.1|  354|Homo sapiens Uba6-specific E2
           conjugating enzyme 1 protein.
          Length = 354

 Score = 30.7 bits (66), Expect = 4.1
 Identities = 18/41 (43%), Positives = 21/41 (51%)
 Frame = -3

Query: 308 VHALGRAAGGAKLPSAGLA*TPLRPKPA*PNPARICSLWSP 186
           V A   AAGGA  P +GLA  P  P  A  + A + S W P
Sbjct: 45  VWAAAAAAGGAGGPGSGLAPLPGLPPSAAAHGAALLSHWDP 85


>X76930-1|CAA54248.1|  465|Homo sapiens hepatocyte nuclear factor 4
           protein.
          Length = 465

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 1/59 (1%)
 Frame = +2

Query: 143 TRLVKSHCLEPPDSRGSTVSISLPD-SARLASALEAFRLIPRMVASHHRPLGRVHEPNV 316
           T L      E P  RG   +   P  S   AS  E ++L+P  VA+  +PL  + +P +
Sbjct: 401 THLSNGQMCEWPRPRGQAATPETPQPSPPGASGSEPYKLLPGAVATIVKPLSAIPQPTI 459


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 86,942,485
Number of Sequences: 237096
Number of extensions: 1846517
Number of successful extensions: 4166
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 4004
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4166
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6354183230
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).