SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0088
         (672 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC114377-1|AAI14378.1|   44|Homo sapiens Unknown (protein for MG...    55   3e-07
AK027290-1|BAB55018.1|  433|Homo sapiens protein ( Homo sapiens ...    31   2.8  
BC105633-1|AAI05634.1|  757|Homo sapiens tumor endothelial marke...    31   5.0  
BC104484-1|AAI04485.1|  757|Homo sapiens tumor endothelial marke...    31   5.0  
BC051340-1|AAH51340.1|  757|Homo sapiens CD248 molecule, endosia...    31   5.0  
AJ295846-1|CAC34381.1|  757|Homo sapiens endosialin protein prot...    31   5.0  
AF279142-1|AAG00867.1|  757|Homo sapiens tumor endothelial marke...    31   5.0  
BC048251-1|AAH48251.1|  322|Homo sapiens ZDHHC12 protein protein.      30   6.6  
AL441992-6|CAI15406.1|  210|Homo sapiens zinc finger, DHHC-type ...    30   6.6  
AB127405-1|BAD03968.1| 1183|Homo sapiens SNAP-25-interacting pro...    30   6.6  

>BC114377-1|AAI14378.1|   44|Homo sapiens Unknown (protein for
           MGC:134704) protein.
          Length = 44

 Score = 54.8 bits (126), Expect = 3e-07
 Identities = 25/30 (83%), Positives = 26/30 (86%)
 Frame = +3

Query: 432 MIGRADIEGSKSNVAMNAWLPQASYPVVTF 521
           MIGRADIEGSKS+VAMNAW PQASYP   F
Sbjct: 1   MIGRADIEGSKSDVAMNAWPPQASYPCGNF 30


>AK027290-1|BAB55018.1|  433|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14384 fis, clone HEMBA1002150. ).
          Length = 433

 Score = 31.5 bits (68), Expect = 2.8
 Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 2/85 (2%)
 Frame = +3

Query: 138 PTLGAPQ*AYPCRIRLGWLRP*RRSGIIPRMVASHHRPLAECMNQM--SETAVPLVLSSI 311
           P L AP+  Y   + L   RP   S   P + ++H  P+    +     +  +P+++++ 
Sbjct: 107 PPLSAPRVPYHSSV-LSVTRPVVVSATHPTLPSAHQPPVIPATHPALSRDHQIPVIVANY 165

Query: 312 TIATTSHQ*GKTNLSHDGLNPAHVP 386
               +++Q G  ++SH    PAH P
Sbjct: 166 PDLPSAYQPGILSVSHSAQPPAHQP 190


>BC105633-1|AAI05634.1|  757|Homo sapiens tumor endothelial marker
           1, precursor protein.
          Length = 757

 Score = 30.7 bits (66), Expect = 5.0
 Identities = 21/85 (24%), Positives = 39/85 (45%), Gaps = 2/85 (2%)
 Frame = +3

Query: 138 PTLGAPQ*AYPCRIRLGWLRP*RRSGIIPRMVASHHRPLAECMNQM--SETAVPLVLSSI 311
           P L AP+  Y   + L   RP   S   P + ++H  P+    +     +  +P++ ++ 
Sbjct: 431 PPLSAPRVPYHSSV-LSVTRPVVVSATRPTLPSAHQPPVIPATHPALSRDHQIPVIAANY 489

Query: 312 TIATTSHQ*GKTNLSHDGLNPAHVP 386
               +++Q G  ++SH    PAH P
Sbjct: 490 PDLPSAYQPGILSVSHSAQPPAHQP 514


>BC104484-1|AAI04485.1|  757|Homo sapiens tumor endothelial marker
           1, precursor protein.
          Length = 757

 Score = 30.7 bits (66), Expect = 5.0
 Identities = 21/85 (24%), Positives = 39/85 (45%), Gaps = 2/85 (2%)
 Frame = +3

Query: 138 PTLGAPQ*AYPCRIRLGWLRP*RRSGIIPRMVASHHRPLAECMNQM--SETAVPLVLSSI 311
           P L AP+  Y   + L   RP   S   P + ++H  P+    +     +  +P++ ++ 
Sbjct: 431 PPLSAPRVPYHSSV-LSVTRPVVVSATRPTLPSAHQPPVIPATHPALSRDHQIPVIAANY 489

Query: 312 TIATTSHQ*GKTNLSHDGLNPAHVP 386
               +++Q G  ++SH    PAH P
Sbjct: 490 PDLPSAYQPGILSVSHSAQPPAHQP 514


>BC051340-1|AAH51340.1|  757|Homo sapiens CD248 molecule, endosialin
           protein.
          Length = 757

 Score = 30.7 bits (66), Expect = 5.0
 Identities = 21/85 (24%), Positives = 39/85 (45%), Gaps = 2/85 (2%)
 Frame = +3

Query: 138 PTLGAPQ*AYPCRIRLGWLRP*RRSGIIPRMVASHHRPLAECMNQM--SETAVPLVLSSI 311
           P L AP+  Y   + L   RP   S   P + ++H  P+    +     +  +P++ ++ 
Sbjct: 431 PPLSAPRVPYHSSV-LSVTRPVVVSATHPTLPSAHQPPVIPATHPALSRDHQIPVIAANY 489

Query: 312 TIATTSHQ*GKTNLSHDGLNPAHVP 386
               +++Q G  ++SH    PAH P
Sbjct: 490 PDLPSAYQPGILSVSHSAQPPAHQP 514


>AJ295846-1|CAC34381.1|  757|Homo sapiens endosialin protein
           protein.
          Length = 757

 Score = 30.7 bits (66), Expect = 5.0
 Identities = 21/85 (24%), Positives = 39/85 (45%), Gaps = 2/85 (2%)
 Frame = +3

Query: 138 PTLGAPQ*AYPCRIRLGWLRP*RRSGIIPRMVASHHRPLAECMNQM--SETAVPLVLSSI 311
           P L AP+  Y   + L   RP   S   P + ++H  P+    +     +  +P++ ++ 
Sbjct: 431 PPLSAPRVPYHSSV-LSVTRPVVVSATHPTLPSAHQPPVIPATHPALSRDHQIPVIAANY 489

Query: 312 TIATTSHQ*GKTNLSHDGLNPAHVP 386
               +++Q G  ++SH    PAH P
Sbjct: 490 PDLPSAYQPGILSVSHSAQPPAHQP 514


>AF279142-1|AAG00867.1|  757|Homo sapiens tumor endothelial marker 1
           precursor protein.
          Length = 757

 Score = 30.7 bits (66), Expect = 5.0
 Identities = 21/85 (24%), Positives = 39/85 (45%), Gaps = 2/85 (2%)
 Frame = +3

Query: 138 PTLGAPQ*AYPCRIRLGWLRP*RRSGIIPRMVASHHRPLAECMNQM--SETAVPLVLSSI 311
           P L AP+  Y   + L   RP   S   P + ++H  P+    +     +  +P++ ++ 
Sbjct: 431 PPLSAPRVPYHSSV-LSVTRPVVVSATHPTLPSAHQPPVIPATHPALSRDHQIPVIAANY 489

Query: 312 TIATTSHQ*GKTNLSHDGLNPAHVP 386
               +++Q G  ++SH    PAH P
Sbjct: 490 PDLPSAYQPGILSVSHSAQPPAHQP 514


>BC048251-1|AAH48251.1|  322|Homo sapiens ZDHHC12 protein protein.
          Length = 322

 Score = 30.3 bits (65), Expect = 6.6
 Identities = 13/25 (52%), Positives = 15/25 (60%)
 Frame = -2

Query: 209 TPLRPKPA*PNPARICSLWSPESRE 135
           TP  P P  P PA +CS  SPE R+
Sbjct: 68  TPTPPTPVLPGPASLCSPASPELRQ 92


>AL441992-6|CAI15406.1|  210|Homo sapiens zinc finger, DHHC-type
           containing 12 protein.
          Length = 210

 Score = 30.3 bits (65), Expect = 6.6
 Identities = 13/25 (52%), Positives = 15/25 (60%)
 Frame = -2

Query: 209 TPLRPKPA*PNPARICSLWSPESRE 135
           TP  P P  P PA +CS  SPE R+
Sbjct: 68  TPTPPTPVLPGPASLCSPASPELRQ 92


>AB127405-1|BAD03968.1| 1183|Homo sapiens SNAP-25-interacting
           protein protein.
          Length = 1183

 Score = 30.3 bits (65), Expect = 6.6
 Identities = 32/109 (29%), Positives = 52/109 (47%), Gaps = 2/109 (1%)
 Frame = -1

Query: 387 RERELGLDRRETG*FYPTDGLSLR**YCSVREEPQFRTFGSCTRRAAGGAKLPSAGLCLN 208
           R+R+  +D  ++   YP   L+LR     +RE+P + +F + + R   GA+    GL   
Sbjct: 78  RKRDAFMDHLKSK--YPQHALALRGQQDRMREQPNYWSFKTRSSRHTQGAQ---PGLADQ 132

Query: 207 ASKAEASLAESGKDMLTVEPRESGGSKQCDFTSR--VSHSKREKRRRSP 67
           A+K   + AES + M   E    G S+   F     +S S  + + RSP
Sbjct: 133 AAKLSYASAESLETMSEAE-LPLGFSRMNRFRQSLPLSRSASQTKPRSP 180


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 100,904,841
Number of Sequences: 237096
Number of extensions: 2171514
Number of successful extensions: 4810
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 4586
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4807
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7647512560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).