SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0076
         (634 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X81649-1|CAA57309.1|  850|Homo sapiens gastric mucin protein.          31   3.4  
AJ298317-1|CAC83674.1| 2448|Homo sapiens mucin 5 protein.              31   3.4  
K01500-1|AAA51543.1|  433|Homo sapiens alpha-1-antichymotrypsin ...    30   5.9  

>X81649-1|CAA57309.1|  850|Homo sapiens gastric mucin protein.
          Length = 850

 Score = 31.1 bits (67), Expect = 3.4
 Identities = 14/37 (37%), Positives = 20/37 (54%)
 Frame = -2

Query: 339 RSRETISHLCYTSHVSLQCQTRVKLNRVSFPADSPKP 229
           R+RE  S LCY   + +QC T +  +  S PA +  P
Sbjct: 453 RNREQASGLCYNYQIRVQCCTPLACSTSSSPAQTTPP 489


>AJ298317-1|CAC83674.1| 2448|Homo sapiens mucin 5 protein.
          Length = 2448

 Score = 31.1 bits (67), Expect = 3.4
 Identities = 14/37 (37%), Positives = 20/37 (54%)
 Frame = -2

Query: 339  RSRETISHLCYTSHVSLQCQTRVKLNRVSFPADSPKP 229
            R+RE  S LCY   + +QC T +  +  S PA +  P
Sbjct: 1457 RNREQASGLCYNYQIRVQCCTPLPCSTSSSPAQTTPP 1493


>K01500-1|AAA51543.1|  433|Homo sapiens alpha-1-antichymotrypsin
           protein.
          Length = 433

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 4/59 (6%)
 Frame = -2

Query: 612 FAPREVSV-LAELALGHLRYSLTDVPPQSNSPHGS-VSNRITREF--*TATSVSATSPL 448
           F+P  +S  LA L+LG    +LT++   S+SPHG  +  + T+ F    A S+S++  L
Sbjct: 75  FSPLSISTALAFLSLGAHNTTLTEILKASSSPHGDLLRQKFTQSFQHLRAPSISSSDEL 133


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 93,020,258
Number of Sequences: 237096
Number of extensions: 1913766
Number of successful extensions: 3330
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3233
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3330
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6916500330
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).