SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0071
         (637 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ276485-1|CAB81951.1|  283|Homo sapiens integral membrane trans...    59   1e-08
DQ427109-1|ABD72605.1| 1048|Homo sapiens OTUD4: OTU domain conta...    30   6.0  
BC118653-1|AAI18654.1| 1049|Homo sapiens OTU domain containing 4...    30   6.0  
BC118572-1|AAI18573.1| 1049|Homo sapiens OTU domain containing 4...    30   6.0  

>AJ276485-1|CAB81951.1|  283|Homo sapiens integral membrane
           transporter protein protein.
          Length = 283

 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 25/34 (73%), Positives = 29/34 (85%)
 Frame = -2

Query: 417 MVNYAWSGRSQGKP*WRTVAILTCKSIVGTGYRG 316
           MVNYAW+GRSQ K  WR+VA+LTCKS+V  GYRG
Sbjct: 1   MVNYAWAGRSQRKLWWRSVAVLTCKSVVRPGYRG 34


>DQ427109-1|ABD72605.1| 1048|Homo sapiens OTUD4: OTU domain
           containing 4 protein.
          Length = 1048

 Score = 30.3 bits (65), Expect = 6.0
 Identities = 13/32 (40%), Positives = 20/32 (62%)
 Frame = -1

Query: 103 SGPILVSRTGAVG*TKRSVKAPKKRSWDTMKG 8
           +GP+LV   G    T +++KAP   SW+T+ G
Sbjct: 246 NGPVLVEELGKKH-TSKNLKAPPPESWNTVSG 276


>BC118653-1|AAI18654.1| 1049|Homo sapiens OTU domain containing 4
           protein.
          Length = 1049

 Score = 30.3 bits (65), Expect = 6.0
 Identities = 13/32 (40%), Positives = 20/32 (62%)
 Frame = -1

Query: 103 SGPILVSRTGAVG*TKRSVKAPKKRSWDTMKG 8
           +GP+LV   G    T +++KAP   SW+T+ G
Sbjct: 247 NGPVLVEELGKKH-TSKNLKAPPPESWNTVSG 277


>BC118572-1|AAI18573.1| 1049|Homo sapiens OTU domain containing 4
           protein.
          Length = 1049

 Score = 30.3 bits (65), Expect = 6.0
 Identities = 13/32 (40%), Positives = 20/32 (62%)
 Frame = -1

Query: 103 SGPILVSRTGAVG*TKRSVKAPKKRSWDTMKG 8
           +GP+LV   G    T +++KAP   SW+T+ G
Sbjct: 247 NGPVLVEELGKKH-TSKNLKAPPPESWNTVSG 277


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 93,701,818
Number of Sequences: 237096
Number of extensions: 2022920
Number of successful extensions: 6985
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 6909
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6985
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6972732040
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).