SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0038
         (703 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL445068-2|CAI22520.1|  366|Homo sapiens protein ( Human DNA seq...    33   1.3  
AL050350-5|CAI42513.1|  366|Homo sapiens protein ( Human DNA seq...    33   1.3  
AF282168-1|AAG03039.1|  437|Homo sapiens DRC3 protein.                 31   4.0  
AF282167-1|AAG03038.1|  437|Homo sapiens DRC3 protein.                 31   4.0  
DQ427109-1|ABD72605.1| 1048|Homo sapiens OTUD4: OTU domain conta...    30   7.0  
BC118653-1|AAI18654.1| 1049|Homo sapiens OTU domain containing 4...    30   7.0  
BC118572-1|AAI18573.1| 1049|Homo sapiens OTU domain containing 4...    30   7.0  
AL117481-1|CAB55954.1|  319|Homo sapiens hypothetical protein pr...    30   7.0  
U77735-1|AAC78506.1|  334|Homo sapiens pim-2 protooncogene homol...    30   9.2  
BC112034-1|AAI12035.1|  157|Homo sapiens hypothetical protein LO...    30   9.2  
BC093711-1|AAH93711.1|  157|Homo sapiens hypothetical protein LO...    30   9.2  
AL133561-1|CAB63715.1|  580|Homo sapiens hypothetical protein pr...    30   9.2  

>AL445068-2|CAI22520.1|  366|Homo sapiens protein ( Human DNA
           sequence from clone RP1-71D21 on chromosome 6. ).
          Length = 366

 Score = 32.7 bits (71), Expect = 1.3
 Identities = 18/44 (40%), Positives = 22/44 (50%)
 Frame = +1

Query: 43  PRQSSRASLEYLLLPPRSAPTEAPSGLTPRPFCALRRARPTRYG 174
           PR +SR  + Y+    R+ P    SG TP P C   R RP R G
Sbjct: 65  PRGASRRQVTYVRSGRRAPPGGGGSG-TPEPGCCAPRGRPRRKG 107


>AL050350-5|CAI42513.1|  366|Homo sapiens protein ( Human DNA
           sequence from clone RP1-261K5 on chromosome 6q21-22.1
           Contains the 3' end of the SLC22A16 gene for solute
           carrier family  ).
          Length = 366

 Score = 32.7 bits (71), Expect = 1.3
 Identities = 18/44 (40%), Positives = 22/44 (50%)
 Frame = +1

Query: 43  PRQSSRASLEYLLLPPRSAPTEAPSGLTPRPFCALRRARPTRYG 174
           PR +SR  + Y+    R+ P    SG TP P C   R RP R G
Sbjct: 65  PRGASRRQVTYVRSGRRAPPGGGGSG-TPEPGCCAPRGRPRRKG 107


>AF282168-1|AAG03039.1|  437|Homo sapiens DRC3 protein.
          Length = 437

 Score = 31.1 bits (67), Expect = 4.0
 Identities = 17/46 (36%), Positives = 23/46 (50%)
 Frame = +1

Query: 1   RLTREQLLFTRNPSPRQSSRASLEYLLLPPRSAPTEAPSGLTPRPF 138
           R  R++   ++ P+PR  S A       PPRSAP   P  L P P+
Sbjct: 390 RAARDRAAQSQGPAPRNRSSARAR---TPPRSAPGCRPRALAPGPW 432


>AF282167-1|AAG03038.1|  437|Homo sapiens DRC3 protein.
          Length = 437

 Score = 31.1 bits (67), Expect = 4.0
 Identities = 17/46 (36%), Positives = 23/46 (50%)
 Frame = +1

Query: 1   RLTREQLLFTRNPSPRQSSRASLEYLLLPPRSAPTEAPSGLTPRPF 138
           R  R++   ++ P+PR  S A       PPRSAP   P  L P P+
Sbjct: 390 RAARDRAAQSQGPAPRNRSSARAR---TPPRSAPGCRPRALAPGPW 432


>DQ427109-1|ABD72605.1| 1048|Homo sapiens OTUD4: OTU domain
           containing 4 protein.
          Length = 1048

 Score = 30.3 bits (65), Expect = 7.0
 Identities = 13/32 (40%), Positives = 20/32 (62%)
 Frame = -1

Query: 445 SGPILVSRTGAVG*TKRSVKAPKKRSWDTMKG 350
           +GP+LV   G    T +++KAP   SW+T+ G
Sbjct: 246 NGPVLVEELGKKH-TSKNLKAPPPESWNTVSG 276


>BC118653-1|AAI18654.1| 1049|Homo sapiens OTU domain containing 4
           protein.
          Length = 1049

 Score = 30.3 bits (65), Expect = 7.0
 Identities = 13/32 (40%), Positives = 20/32 (62%)
 Frame = -1

Query: 445 SGPILVSRTGAVG*TKRSVKAPKKRSWDTMKG 350
           +GP+LV   G    T +++KAP   SW+T+ G
Sbjct: 247 NGPVLVEELGKKH-TSKNLKAPPPESWNTVSG 277


>BC118572-1|AAI18573.1| 1049|Homo sapiens OTU domain containing 4
           protein.
          Length = 1049

 Score = 30.3 bits (65), Expect = 7.0
 Identities = 13/32 (40%), Positives = 20/32 (62%)
 Frame = -1

Query: 445 SGPILVSRTGAVG*TKRSVKAPKKRSWDTMKG 350
           +GP+LV   G    T +++KAP   SW+T+ G
Sbjct: 247 NGPVLVEELGKKH-TSKNLKAPPPESWNTVSG 277


>AL117481-1|CAB55954.1|  319|Homo sapiens hypothetical protein
           protein.
          Length = 319

 Score = 30.3 bits (65), Expect = 7.0
 Identities = 24/59 (40%), Positives = 27/59 (45%), Gaps = 2/59 (3%)
 Frame = +1

Query: 40  SPRQSSRASLEYLLLPPRSAPTEAPS--GLTPRPFCALRRARPTRYGLMIPN*KFSITR 210
           SP    RAS      PPR++PT  PS   LT  P  A     P+R  LM      SITR
Sbjct: 11  SPMTPPRASPR---TPPRASPTTTPSRASLTRTPSWASPTTTPSRASLMKMESTVSITR 66


>U77735-1|AAC78506.1|  334|Homo sapiens pim-2 protooncogene homolog
           pim-2h protein.
          Length = 334

 Score = 29.9 bits (64), Expect = 9.2
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 1/55 (1%)
 Frame = +1

Query: 22  LFTRNPSPRQSSRASLEYLLLPP-RSAPTEAPSGLTPRPFCALRRARPTRYGLMI 183
           L  R  +P+ SSR SLE +LL P    P E    +TP+P   L+R RP  +GL++
Sbjct: 262 LIRRCLAPKPSSRPSLEEILLDPWMQTPAE---DVTPQP---LQR-RPCPFGLVL 309


>BC112034-1|AAI12035.1|  157|Homo sapiens hypothetical protein
           LOC284009 protein.
          Length = 157

 Score = 29.9 bits (64), Expect = 9.2
 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 1/39 (2%)
 Frame = +2

Query: 23  CSRETLLHVSPPGPRWSICYYHQDLHR-RRLQAGSRPDP 136
           C R  ++H+   G RW      +  HR RR   GSRP P
Sbjct: 40  CGRPAVVHIGGEGARWEKGARGRKEHRLRRSDLGSRPVP 78


>BC093711-1|AAH93711.1|  157|Homo sapiens hypothetical protein
           LOC284009 protein.
          Length = 157

 Score = 29.9 bits (64), Expect = 9.2
 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 1/39 (2%)
 Frame = +2

Query: 23  CSRETLLHVSPPGPRWSICYYHQDLHR-RRLQAGSRPDP 136
           C R  ++H+   G RW      +  HR RR   GSRP P
Sbjct: 40  CGRPAVVHIGGEGARWEKGARGRKEHRLRRSDLGSRPVP 78


>AL133561-1|CAB63715.1|  580|Homo sapiens hypothetical protein
           protein.
          Length = 580

 Score = 29.9 bits (64), Expect = 9.2
 Identities = 23/51 (45%), Positives = 27/51 (52%), Gaps = 4/51 (7%)
 Frame = +1

Query: 28  TRNPSP----RQSSRASLEYLLLPPRSAPTEAPSGLTPRPFCALRRARPTR 168
           TR+PS     R  SRASL     PPR++PT  P   +PR      RA PTR
Sbjct: 168 TRSPSTASLTRTPSRASLTRW--PPRASPTRTPPRESPR---MSHRASPTR 213


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 111,126,635
Number of Sequences: 237096
Number of extensions: 2603931
Number of successful extensions: 9669
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 9320
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9651
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8119219030
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).