SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0032
         (636 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC010708-1|AAH10708.2|  558|Homo sapiens spastic paraplegia 3A (...   145   1e-34
CR457153-1|CAG33434.1|  475|Homo sapiens SPG3A protein.               144   2e-34
AY032844-1|AAK51160.1|  475|Homo sapiens GTPase protein.              144   2e-34
AF444143-1|AAL37898.1|  558|Homo sapiens brain-specific GTP-bind...   144   2e-34
AF131801-1|AAD20047.1|  475|Homo sapiens Unknown protein.             144   2e-34
AK223436-1|BAD97156.1|  558|Homo sapiens atlastin variant protein.    142   7e-34
AK026946-1|BAB15598.1|  579|Homo sapiens protein ( Homo sapiens ...   141   2e-33
AF449187-2|AAM97341.1|  579|Homo sapiens ARL6IP2 protein.             141   2e-33
AF449187-1|AAM97342.1|  583|Homo sapiens ARL6IP2 protein.             141   2e-33
AC016995-1|AAX88950.1|  579|Homo sapiens unknown protein.             141   2e-33
BC077727-1|AAH77727.1|  541|Homo sapiens DKFZP564J0863 protein p...   140   4e-33
AK023383-1|BAB14552.1|  541|Homo sapiens protein ( Homo sapiens ...   140   4e-33
AK097588-1|BAC05111.1|  567|Homo sapiens protein ( Homo sapiens ...   138   2e-32
BC053508-1|AAH53508.1|  412|Homo sapiens ARL6IP2 protein protein.     126   7e-29
BC053989-1|AAH53989.1|  631|Homo sapiens zinc finger protein 179...    55   2e-07
AB026054-1|BAA84698.1|  632|Homo sapiens brain finger protein pr...    55   2e-07
BC070055-1|AAH70055.1|  640|Homo sapiens guanylate binding prote...    42   0.002
BC017889-1|AAH17889.1|  410|Homo sapiens Unknown (protein for IM...    42   0.002
AL832576-1|CAD89936.1|  640|Homo sapiens hypothetical protein pr...    42   0.002
AK131094-1|BAC85144.1|  649|Homo sapiens FLJ00316 protein protein.     42   0.002
AF288814-1|AAL02054.1|  640|Homo sapiens guanylate binding prote...    42   0.002
AK096141-1|BAC04709.1|  638|Homo sapiens protein ( Homo sapiens ...    40   0.006
BX537949-1|CAD97917.1|  633|Homo sapiens hypothetical protein pr...    39   0.013
BC131713-1|AAI31714.1|  633|Homo sapiens guanylate binding prote...    39   0.013
AL691464-1|CAI22141.1|  633|Homo sapiens guanylate binding prote...    39   0.013
AK131356-1|BAD18509.1|  633|Homo sapiens protein ( Homo sapiens ...    39   0.013
M55543-1|AAA67323.1|  591|Homo sapiens guanylate binding protein...    38   0.023
CR457062-1|CAG33343.1|  591|Homo sapiens GBP2 protein.                 38   0.023
BC073163-1|AAH73163.1|  591|Homo sapiens guanylate binding prote...    38   0.023
BC022272-1|AAH22272.1|  481|Homo sapiens GBP2 protein protein.         38   0.023
AL832451-1|CAD89925.1|  591|Homo sapiens hypothetical protein pr...    38   0.023
BC031639-1|AAH31639.1|  586|Homo sapiens guanylate binding prote...    38   0.039
AY358953-1|AAQ89312.1|  586|Homo sapiens ALEI2427 protein.             38   0.039
AK090479-1|BAC03460.1|  504|Homo sapiens FLJ00401 protein protein.     38   0.039
AF430643-1|AAN39036.1|  586|Homo sapiens GBP-5a protein.               38   0.039
AF430642-1|AAN39035.1|  586|Homo sapiens GBP-5b protein.               38   0.039
AF328727-1|AAO40731.1|  489|Homo sapiens CTCL tumor antigen GBP-...    38   0.039
AF288815-1|AAL02055.1|  586|Homo sapiens guanylate binding prote...    38   0.039
M55542-1|AAA35871.1|  592|Homo sapiens guanylate binding protein...    36   0.091
BT006847-1|AAP35493.1|  592|Homo sapiens guanylate binding prote...    36   0.091
BC002666-1|AAH02666.1|  592|Homo sapiens guanylate binding prote...    36   0.091
AY920436-1|AAX13805.1|  592|Homo sapiens guanylate binding prote...    36   0.091
AL160008-5|CAI22972.1|  592|Homo sapiens guanylate binding prote...    36   0.091
BC063819-1|AAH63819.1|  290|Homo sapiens GBP3 protein protein.         35   0.28 
BC017992-1|AAH17992.1|  449|Homo sapiens Unknown (protein for IM...    35   0.28 
AL160008-4|CAI22971.1|  440|Homo sapiens guanylate binding prote...    35   0.28 
AL160008-3|CAI22970.1|  563|Homo sapiens guanylate binding prote...    35   0.28 
AL160008-2|CAM28327.1|  595|Homo sapiens guanylate binding prote...    35   0.28 
AL139416-8|CAI21698.1|  440|Homo sapiens guanylate binding prote...    35   0.28 
AL139416-7|CAI21697.1|  563|Homo sapiens guanylate binding prote...    35   0.28 
AL139416-6|CAM28262.1|  595|Homo sapiens guanylate binding prote...    35   0.28 
AK024010-1|BAB14773.1|  339|Homo sapiens protein ( Homo sapiens ...    32   1.5  
AJ272204-1|CAC01125.1|  999|Homo sapiens hypothetical protein pr...    32   1.5  
AK131080-1|BAC85130.1|  563|Homo sapiens FLJ00279 protein protein.     30   6.0  
AK092192-1|BAC03825.1|  144|Homo sapiens protein ( Homo sapiens ...    30   6.0  
AJ606308-1|CAE54436.1| 4262|Homo sapiens secreted mucin MUC17 pr...    30   7.9  
AJ606307-1|CAE54435.1| 4493|Homo sapiens membrane mucin MUC17 pr...    30   7.9  
AF016693-1|AAB71686.1|  236|Homo sapiens small intestinal mucin ...    30   7.9  

>BC010708-1|AAH10708.2|  558|Homo sapiens spastic paraplegia 3A
           (autosomal dominant) protein.
          Length = 558

 Score =  145 bits (351), Expect = 1e-34
 Identities = 65/90 (72%), Positives = 79/90 (87%), Gaps = 1/90 (1%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL GFSWRGGSER+TTGI +WSEIF     DG+KVA++L+DTQG FDS+ST+RD ATVFA
Sbjct: 106 PLTGFSWRGGSERETTGIQIWSEIFLINKPDGKKVAVLLMDTQGTFDSQSTLRDSATVFA 165

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHLH-CSQ 244
           LSTM+SS+Q+YNLSQN+QEDDLQHL  C++
Sbjct: 166 LSTMISSIQVYNLSQNVQEDDLQHLQLCTE 195



 Score =  127 bits (307), Expect = 3e-29
 Identities = 56/84 (66%), Positives = 67/84 (79%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           L TEYGRLA+E+    PFQ L FLVRDWSFPYE  YGADGG + L +RLKVS  QH ELQ
Sbjct: 192 LCTEYGRLAMEETFLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRLKVSGNQHEELQ 251

Query: 73  SLRKHITACFSELACFLMPHPGLK 2
           ++RKHI +CF+ ++CFL+PHPGLK
Sbjct: 252 NVRKHIHSCFTNISCFLLPHPGLK 275



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 19/23 (82%), Positives = 22/23 (95%)
 Frame = -2

Query: 632 ISVAGAFRKGKSFLLDFFLRYMH 564
           +SVAGAFRKGKSFL+DF LRYM+
Sbjct: 70  VSVAGAFRKGKSFLMDFMLRYMY 92


>CR457153-1|CAG33434.1|  475|Homo sapiens SPG3A protein.
          Length = 475

 Score =  144 bits (350), Expect = 2e-34
 Identities = 64/85 (75%), Positives = 76/85 (89%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL GFSWRGGSER+TTGI +WSEIF     DG+KVA++L+DTQG FDS+ST+RD ATVFA
Sbjct: 23  PLTGFSWRGGSERETTGIQIWSEIFLINKPDGKKVAVLLMDTQGTFDSQSTLRDSATVFA 82

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LSTM+SS+Q+YNLSQN+QEDDLQHL
Sbjct: 83  LSTMISSIQVYNLSQNVQEDDLQHL 107



 Score =  130 bits (315), Expect = 3e-30
 Identities = 57/84 (67%), Positives = 68/84 (80%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLA+E+    PFQ L FLVRDWSFPYE  YGADGG + L +RLKVS  QH ELQ
Sbjct: 109 LFTEYGRLAMEETFLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRLKVSGNQHEELQ 168

Query: 73  SLRKHITACFSELACFLMPHPGLK 2
           ++RKHI +CF+ ++CFL+PHPGLK
Sbjct: 169 NVRKHIHSCFTNISCFLLPHPGLK 192


>AY032844-1|AAK51160.1|  475|Homo sapiens GTPase protein.
          Length = 475

 Score =  144 bits (350), Expect = 2e-34
 Identities = 64/85 (75%), Positives = 76/85 (89%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL GFSWRGGSER+TTGI +WSEIF     DG+KVA++L+DTQG FDS+ST+RD ATVFA
Sbjct: 23  PLTGFSWRGGSERETTGIQIWSEIFLINKPDGKKVAVLLMDTQGTFDSQSTLRDSATVFA 82

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LSTM+SS+Q+YNLSQN+QEDDLQHL
Sbjct: 83  LSTMISSIQVYNLSQNVQEDDLQHL 107



 Score =  130 bits (315), Expect = 3e-30
 Identities = 57/84 (67%), Positives = 68/84 (80%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLA+E+    PFQ L FLVRDWSFPYE  YGADGG + L +RLKVS  QH ELQ
Sbjct: 109 LFTEYGRLAMEETFLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRLKVSGNQHEELQ 168

Query: 73  SLRKHITACFSELACFLMPHPGLK 2
           ++RKHI +CF+ ++CFL+PHPGLK
Sbjct: 169 NVRKHIHSCFTNISCFLLPHPGLK 192


>AF444143-1|AAL37898.1|  558|Homo sapiens brain-specific GTP-binding
           protein protein.
          Length = 558

 Score =  144 bits (350), Expect = 2e-34
 Identities = 64/85 (75%), Positives = 76/85 (89%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL GFSWRGGSER+TTGI +WSEIF     DG+KVA++L+DTQG FDS+ST+RD ATVFA
Sbjct: 106 PLTGFSWRGGSERETTGIQIWSEIFLINKPDGKKVAVLLMDTQGTFDSQSTLRDSATVFA 165

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LSTM+SS+Q+YNLSQN+QEDDLQHL
Sbjct: 166 LSTMISSIQVYNLSQNVQEDDLQHL 190



 Score =  130 bits (315), Expect = 3e-30
 Identities = 57/84 (67%), Positives = 68/84 (80%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLA+E+    PFQ L FLVRDWSFPYE  YGADGG + L +RLKVS  QH ELQ
Sbjct: 192 LFTEYGRLAMEETFLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRLKVSGNQHEELQ 251

Query: 73  SLRKHITACFSELACFLMPHPGLK 2
           ++RKHI +CF+ ++CFL+PHPGLK
Sbjct: 252 NVRKHIHSCFTNISCFLLPHPGLK 275



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 19/23 (82%), Positives = 22/23 (95%)
 Frame = -2

Query: 632 ISVAGAFRKGKSFLLDFFLRYMH 564
           +SVAGAFRKGKSFL+DF LRYM+
Sbjct: 70  VSVAGAFRKGKSFLMDFMLRYMY 92


>AF131801-1|AAD20047.1|  475|Homo sapiens Unknown protein.
          Length = 475

 Score =  144 bits (350), Expect = 2e-34
 Identities = 64/85 (75%), Positives = 76/85 (89%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL GFSWRGGSER+TTGI +WSEIF     DG+KVA++L+DTQG FDS+ST+RD ATVFA
Sbjct: 23  PLTGFSWRGGSERETTGIQIWSEIFLINKPDGKKVAVLLMDTQGTFDSQSTLRDSATVFA 82

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LSTM+SS+Q+YNLSQN+QEDDLQHL
Sbjct: 83  LSTMISSIQVYNLSQNVQEDDLQHL 107



 Score =  130 bits (315), Expect = 3e-30
 Identities = 57/84 (67%), Positives = 68/84 (80%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLA+E+    PFQ L FLVRDWSFPYE  YGADGG + L +RLKVS  QH ELQ
Sbjct: 109 LFTEYGRLAMEETFLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRLKVSGNQHEELQ 168

Query: 73  SLRKHITACFSELACFLMPHPGLK 2
           ++RKHI +CF+ ++CFL+PHPGLK
Sbjct: 169 NVRKHIHSCFTNISCFLLPHPGLK 192


>AK223436-1|BAD97156.1|  558|Homo sapiens atlastin variant protein.
          Length = 558

 Score =  142 bits (345), Expect = 7e-34
 Identities = 63/85 (74%), Positives = 75/85 (88%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL GFSWRGGSER+ TGI +WSEIF     DG+KVA++L+DTQG FDS+ST+RD ATVFA
Sbjct: 106 PLTGFSWRGGSEREATGIQIWSEIFLINKPDGKKVAVLLMDTQGTFDSQSTLRDSATVFA 165

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LSTM+SS+Q+YNLSQN+QEDDLQHL
Sbjct: 166 LSTMISSIQVYNLSQNVQEDDLQHL 190



 Score =  130 bits (315), Expect = 3e-30
 Identities = 57/84 (67%), Positives = 68/84 (80%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLA+E+    PFQ L FLVRDWSFPYE  YGADGG + L +RLKVS  QH ELQ
Sbjct: 192 LFTEYGRLAMEETFLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRLKVSGNQHEELQ 251

Query: 73  SLRKHITACFSELACFLMPHPGLK 2
           ++RKHI +CF+ ++CFL+PHPGLK
Sbjct: 252 NVRKHIHSCFTNISCFLLPHPGLK 275



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 19/23 (82%), Positives = 22/23 (95%)
 Frame = -2

Query: 632 ISVAGAFRKGKSFLLDFFLRYMH 564
           +SVAGAFRKGKSFL+DF LRYM+
Sbjct: 70  VSVAGAFRKGKSFLMDFMLRYMY 92


>AK026946-1|BAB15598.1|  579|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ23293 fis, clone HEP10514. ).
          Length = 579

 Score =  141 bits (342), Expect = 2e-33
 Identities = 62/85 (72%), Positives = 75/85 (88%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL GF+WRGG ER+TTGI +W+E+F     +G KVA++L+DTQGAFDS+ST++DCATVFA
Sbjct: 133 PLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFA 192

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LSTM SSVQ+YNLSQNIQEDDLQHL
Sbjct: 193 LSTMTSSVQVYNLSQNIQEDDLQHL 217



 Score =  126 bits (304), Expect = 7e-29
 Identities = 54/84 (64%), Positives = 65/84 (77%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLA+E+  + PFQ L FL+RDWS+PYE  YG +GG Q L +RL+V   QH ELQ
Sbjct: 219 LFTEYGRLAMEEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQ 278

Query: 73  SLRKHITACFSELACFLMPHPGLK 2
           ++RKHI  CFS L CFL+PHPGLK
Sbjct: 279 NVRKHIHNCFSNLGCFLLPHPGLK 302



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 22/26 (84%), Positives = 24/26 (92%)
 Frame = -2

Query: 635 VISVAGAFRKGKSFLLDFFLRYMHYK 558
           V+SVAGAFRKGKSFLLDF LRYM+ K
Sbjct: 96  VVSVAGAFRKGKSFLLDFMLRYMYNK 121


>AF449187-2|AAM97341.1|  579|Homo sapiens ARL6IP2 protein.
          Length = 579

 Score =  141 bits (342), Expect = 2e-33
 Identities = 62/85 (72%), Positives = 75/85 (88%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL GF+WRGG ER+TTGI +W+E+F     +G KVA++L+DTQGAFDS+ST++DCATVFA
Sbjct: 133 PLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFA 192

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LSTM SSVQ+YNLSQNIQEDDLQHL
Sbjct: 193 LSTMTSSVQVYNLSQNIQEDDLQHL 217



 Score =  126 bits (304), Expect = 7e-29
 Identities = 54/84 (64%), Positives = 65/84 (77%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLA+E+  + PFQ L FL+RDWS+PYE  YG +GG Q L +RL+V   QH ELQ
Sbjct: 219 LFTEYGRLAMEEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQ 278

Query: 73  SLRKHITACFSELACFLMPHPGLK 2
           ++RKHI  CFS L CFL+PHPGLK
Sbjct: 279 NVRKHIHNCFSNLGCFLLPHPGLK 302



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 22/26 (84%), Positives = 24/26 (92%)
 Frame = -2

Query: 635 VISVAGAFRKGKSFLLDFFLRYMHYK 558
           V+SVAGAFRKGKSFLLDF LRYM+ K
Sbjct: 96  VVSVAGAFRKGKSFLLDFMLRYMYNK 121


>AF449187-1|AAM97342.1|  583|Homo sapiens ARL6IP2 protein.
          Length = 583

 Score =  141 bits (342), Expect = 2e-33
 Identities = 62/85 (72%), Positives = 75/85 (88%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL GF+WRGG ER+TTGI +W+E+F     +G KVA++L+DTQGAFDS+ST++DCATVFA
Sbjct: 133 PLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFA 192

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LSTM SSVQ+YNLSQNIQEDDLQHL
Sbjct: 193 LSTMTSSVQVYNLSQNIQEDDLQHL 217



 Score =  126 bits (304), Expect = 7e-29
 Identities = 54/84 (64%), Positives = 65/84 (77%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLA+E+  + PFQ L FL+RDWS+PYE  YG +GG Q L +RL+V   QH ELQ
Sbjct: 219 LFTEYGRLAMEEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQ 278

Query: 73  SLRKHITACFSELACFLMPHPGLK 2
           ++RKHI  CFS L CFL+PHPGLK
Sbjct: 279 NVRKHIHNCFSNLGCFLLPHPGLK 302



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 22/26 (84%), Positives = 24/26 (92%)
 Frame = -2

Query: 635 VISVAGAFRKGKSFLLDFFLRYMHYK 558
           V+SVAGAFRKGKSFLLDF LRYM+ K
Sbjct: 96  VVSVAGAFRKGKSFLLDFMLRYMYNK 121


>AC016995-1|AAX88950.1|  579|Homo sapiens unknown protein.
          Length = 579

 Score =  141 bits (342), Expect = 2e-33
 Identities = 62/85 (72%), Positives = 75/85 (88%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL GF+WRGG ER+TTGI +W+E+F     +G KVA++L+DTQGAFDS+ST++DCATVFA
Sbjct: 133 PLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFA 192

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LSTM SSVQ+YNLSQNIQEDDLQHL
Sbjct: 193 LSTMTSSVQVYNLSQNIQEDDLQHL 217



 Score =  126 bits (304), Expect = 7e-29
 Identities = 54/84 (64%), Positives = 65/84 (77%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLA+E+  + PFQ L FL+RDWS+PYE  YG +GG Q L +RL+V   QH ELQ
Sbjct: 219 LFTEYGRLAMEEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQ 278

Query: 73  SLRKHITACFSELACFLMPHPGLK 2
           ++RKHI  CFS L CFL+PHPGLK
Sbjct: 279 NVRKHIHNCFSNLGCFLLPHPGLK 302



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 22/26 (84%), Positives = 24/26 (92%)
 Frame = -2

Query: 635 VISVAGAFRKGKSFLLDFFLRYMHYK 558
           V+SVAGAFRKGKSFLLDF LRYM+ K
Sbjct: 96  VVSVAGAFRKGKSFLLDFMLRYMYNK 121


>BC077727-1|AAH77727.1|  541|Homo sapiens DKFZP564J0863 protein
           protein.
          Length = 541

 Score =  140 bits (339), Expect = 4e-33
 Identities = 63/85 (74%), Positives = 74/85 (87%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL GFSWRGGS+ +TTGI +WSE+F      G+KVA++L+DTQGAFDS+STV+DCAT+FA
Sbjct: 102 PLTGFSWRGGSDPETTGIQIWSEVFTVEKPGGKKVAVVLMDTQGAFDSQSTVKDCATIFA 161

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LSTM SSVQIYNLSQNIQEDDLQ L
Sbjct: 162 LSTMTSSVQIYNLSQNIQEDDLQQL 186



 Score =  122 bits (295), Expect = 8e-28
 Identities = 51/84 (60%), Positives = 66/84 (78%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLA+++  + PFQ L FLVRDWSFPYE  YG  GGM  L +RL+V + QH E+Q
Sbjct: 188 LFTEYGRLAMDEIFQKPFQTLMFLVRDWSFPYEYSYGLQGGMAFLDKRLQVKEHQHEEIQ 247

Query: 73  SLRKHITACFSELACFLMPHPGLK 2
           ++R HI +CFS++ CFL+PHPGL+
Sbjct: 248 NVRNHIHSCFSDVTCFLLPHPGLQ 271



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 19/24 (79%), Positives = 23/24 (95%)
 Frame = -2

Query: 635 VISVAGAFRKGKSFLLDFFLRYMH 564
           V+SVAGAFRKGKSF+LDF LRY++
Sbjct: 62  VVSVAGAFRKGKSFILDFMLRYLY 85


>AK023383-1|BAB14552.1|  541|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13321 fis, clone OVARC1001703, weakly similar to
           Mus musculus ARL-6 interacting protein-2 (Aip-2) mRNA.
           ).
          Length = 541

 Score =  140 bits (339), Expect = 4e-33
 Identities = 63/85 (74%), Positives = 74/85 (87%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL GFSWRGGS+ +TTGI +WSE+F      G+KVA++L+DTQGAFDS+STV+DCAT+FA
Sbjct: 102 PLTGFSWRGGSDPETTGIQIWSEVFTVEKPGGKKVAVVLMDTQGAFDSQSTVKDCATIFA 161

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LSTM SSVQIYNLSQNIQEDDLQ L
Sbjct: 162 LSTMTSSVQIYNLSQNIQEDDLQQL 186



 Score =  122 bits (295), Expect = 8e-28
 Identities = 51/84 (60%), Positives = 66/84 (78%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLA+++  + PFQ L FLVRDWSFPYE  YG  GGM  L +RL+V + QH E+Q
Sbjct: 188 LFTEYGRLAMDEIFQKPFQTLMFLVRDWSFPYEYSYGLQGGMAFLDKRLQVKEHQHEEIQ 247

Query: 73  SLRKHITACFSELACFLMPHPGLK 2
           ++R HI +CFS++ CFL+PHPGL+
Sbjct: 248 NVRNHIHSCFSDVTCFLLPHPGLQ 271



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 19/24 (79%), Positives = 23/24 (95%)
 Frame = -2

Query: 635 VISVAGAFRKGKSFLLDFFLRYMH 564
           V+SVAGAFRKGKSF+LDF LRY++
Sbjct: 62  VVSVAGAFRKGKSFILDFMLRYLY 85


>AK097588-1|BAC05111.1|  567|Homo sapiens protein ( Homo sapiens
           cDNA FLJ40269 fis, clone TESTI2026597. ).
          Length = 567

 Score =  138 bits (334), Expect = 2e-32
 Identities = 62/85 (72%), Positives = 74/85 (87%)
 Frame = -1

Query: 510 PLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFA 331
           PL GFSWRGGS+ +TTGI +WSE+F      G+KVA++L+DTQGAFDS+STV+DCAT+FA
Sbjct: 128 PLTGFSWRGGSDPETTGIQIWSEVFTVEKPGGKKVAVVLMDTQGAFDSQSTVKDCATIFA 187

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           LSTM SSVQIY+LSQNIQEDDLQ L
Sbjct: 188 LSTMTSSVQIYSLSQNIQEDDLQQL 212



 Score =  122 bits (295), Expect = 8e-28
 Identities = 51/84 (60%), Positives = 66/84 (78%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLA+++  + PFQ L FLVRDWSFPYE  YG  GGM  L +RL+V + QH E+Q
Sbjct: 214 LFTEYGRLAMDEIFQKPFQTLMFLVRDWSFPYEYSYGLQGGMAFLDKRLQVKEHQHEEIQ 273

Query: 73  SLRKHITACFSELACFLMPHPGLK 2
           ++R HI +CFS++ CFL+PHPGL+
Sbjct: 274 NVRNHIHSCFSDVTCFLLPHPGLQ 297



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 19/24 (79%), Positives = 23/24 (95%)
 Frame = -2

Query: 635 VISVAGAFRKGKSFLLDFFLRYMH 564
           V+SVAGAFRKGKSF+LDF LRY++
Sbjct: 88  VVSVAGAFRKGKSFILDFMLRYLY 111


>BC053508-1|AAH53508.1|  412|Homo sapiens ARL6IP2 protein protein.
          Length = 412

 Score =  126 bits (304), Expect = 7e-29
 Identities = 54/84 (64%), Positives = 65/84 (77%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQ 74
           LFTEYGRLA+E+  + PFQ L FL+RDWS+PYE  YG +GG Q L +RL+V   QH ELQ
Sbjct: 48  LFTEYGRLAMEEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQ 107

Query: 73  SLRKHITACFSELACFLMPHPGLK 2
           ++RKHI  CFS L CFL+PHPGLK
Sbjct: 108 NVRKHIHNCFSNLGCFLLPHPGLK 131



 Score = 90.2 bits (214), Expect = 5e-18
 Identities = 40/46 (86%), Positives = 45/46 (97%)
 Frame = -1

Query: 393 LDTQGAFDSESTVRDCATVFALSTMLSSVQIYNLSQNIQEDDLQHL 256
           +DTQGAFDS+ST++DCATVFALSTM SSVQ+YNLSQNIQEDDLQHL
Sbjct: 1   MDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHL 46


>BC053989-1|AAH53989.1|  631|Homo sapiens zinc finger protein 179
           protein.
          Length = 631

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 34/84 (40%), Positives = 47/84 (55%)
 Frame = -1

Query: 507 LQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFAL 328
           LQG  W  G+     GI MWS  F     +G+KVA+ L+DT  A   E +      + AL
Sbjct: 211 LQGCRW--GANGLARGIWMWSHPFLLG-KEGKKVAVFLVDTGDAMSPELSRETRIKLCAL 267

Query: 327 STMLSSVQIYNLSQNIQEDDLQHL 256
           +TMLSS QI + SQ +++ DL +L
Sbjct: 268 TTMLSSYQILSTSQELKDTDLDYL 291


>AB026054-1|BAA84698.1|  632|Homo sapiens brain finger protein
           protein.
          Length = 632

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 34/84 (40%), Positives = 47/84 (55%)
 Frame = -1

Query: 507 LQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFAL 328
           LQG  W  G+     GI MWS  F     +G+KVA+ L+DT  A   E +      + AL
Sbjct: 211 LQGCRW--GANGLARGIWMWSHPFLLG-KEGKKVAVFLVDTGDAMSPELSRETRIKLCAL 267

Query: 327 STMLSSVQIYNLSQNIQEDDLQHL 256
           +TMLSS QI + SQ +++ DL +L
Sbjct: 268 TTMLSSYQILSTSQELKDTDLDYL 291


>BC070055-1|AAH70055.1|  640|Homo sapiens guanylate binding protein
           4 protein.
          Length = 640

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/88 (31%), Positives = 43/88 (48%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSE-STVRDCATV 337
           G   GF      + +T GI MW     +  +      ++LLDT+G  D E S  ++ + +
Sbjct: 75  GKRNGFPLGSTVQSETKGIWMWCVPHLSKPNH----TLVLLDTEGLGDVEKSNPKNDSWI 130

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I    L+ LH
Sbjct: 131 FALAVLLSSSFVYNSVSTINHQALEQLH 158


>BC017889-1|AAH17889.1|  410|Homo sapiens Unknown (protein for
           IMAGE:4698724) protein.
          Length = 410

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/88 (31%), Positives = 43/88 (48%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSE-STVRDCATV 337
           G   GF      + +T GI MW     +  +      ++LLDT+G  D E S  ++ + +
Sbjct: 75  GKRNGFPLGSTVQSETKGIWMWCVPHLSKPNH----TLVLLDTEGLGDVEKSNPKNDSWI 130

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I    L+ LH
Sbjct: 131 FALAVLLSSSFVYNSVSTINHQALEQLH 158


>AL832576-1|CAD89936.1|  640|Homo sapiens hypothetical protein
           protein.
          Length = 640

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/88 (31%), Positives = 43/88 (48%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSE-STVRDCATV 337
           G   GF      + +T GI MW     +  +      ++LLDT+G  D E S  ++ + +
Sbjct: 75  GKRNGFPLGSTVQSETKGIWMWCVPHLSKPNH----TLVLLDTEGLGDVEKSNPKNDSWI 130

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I    L+ LH
Sbjct: 131 FALAVLLSSSFVYNSVSTINHQALEQLH 158


>AK131094-1|BAC85144.1|  649|Homo sapiens FLJ00316 protein protein.
          Length = 649

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/88 (31%), Positives = 43/88 (48%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSE-STVRDCATV 337
           G   GF      + +T GI MW     +  +      ++LLDT+G  D E S  ++ + +
Sbjct: 84  GKRNGFPLGSTVQSETKGIWMWCVPHLSKPNH----TLVLLDTEGLGDVEKSNPKNDSWI 139

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I    L+ LH
Sbjct: 140 FALAVLLSSSFVYNSVSTINHQALEQLH 167


>AF288814-1|AAL02054.1|  640|Homo sapiens guanylate binding protein
           4 protein.
          Length = 640

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/88 (31%), Positives = 43/88 (48%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSE-STVRDCATV 337
           G   GF      + +T GI MW     +  +      ++LLDT+G  D E S  ++ + +
Sbjct: 75  GKRNGFPLGSTVQSETKGIWMWCVPHLSKPNH----TLVLLDTEGLGDVEKSNPKNDSWI 130

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I    L+ LH
Sbjct: 131 FALAVLLSSSFVYNSVSTINHQALEQLH 158


>AK096141-1|BAC04709.1|  638|Homo sapiens protein ( Homo sapiens
           cDNA FLJ38822 fis, clone LIVER2008706, moderately
           similar to Mus musculus purine nucleotide binding
           protein mRNA. ).
          Length = 638

 Score = 40.3 bits (90), Expect = 0.006
 Identities = 29/88 (32%), Positives = 43/88 (48%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSE-STVRDCATV 337
           G  +GF      + +T GI MW     +  +      +ILLDT+G  D E S  +  + +
Sbjct: 60  GKNKGFPLGCTVKSETKGIWMWCVPHPSKPNH----TLILLDTEGLGDMEKSDPKSDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I    L+ LH
Sbjct: 116 FALAVLLSSSFVYNSMGTINHQALEQLH 143


>BX537949-1|CAD97917.1|  633|Homo sapiens hypothetical protein
           protein.
          Length = 633

 Score = 39.1 bits (87), Expect = 0.013
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSES-TVRDCATV 337
           G   GF      + +T GI MW     +  +      ++LLDT+G  D E    ++ + +
Sbjct: 60  GQNHGFPLGSTVQSETKGIWMWCVPHPSKPNH----TLVLLDTEGLGDVEKGDPKNDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +L S  +YN    I    L+ LH
Sbjct: 116 FALAVLLCSTFVYNSMSTINHQALEQLH 143


>BC131713-1|AAI31714.1|  633|Homo sapiens guanylate binding protein
           family, member 6 protein.
          Length = 633

 Score = 39.1 bits (87), Expect = 0.013
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSES-TVRDCATV 337
           G   GF      + +T GI MW     +  +      ++LLDT+G  D E    ++ + +
Sbjct: 60  GQNHGFPLGSTVQSETKGIWMWCVPHPSKPNH----TLVLLDTEGLGDVEKGDPKNDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +L S  +YN    I    L+ LH
Sbjct: 116 FALAVLLCSTFVYNSMSTINHQALEQLH 143


>AL691464-1|CAI22141.1|  633|Homo sapiens guanylate binding protein
           family, member 6 protein.
          Length = 633

 Score = 39.1 bits (87), Expect = 0.013
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSES-TVRDCATV 337
           G   GF      + +T GI MW     +  +      ++LLDT+G  D E    ++ + +
Sbjct: 60  GQNHGFPLGSTVQSETKGIWMWCVPHPSKPNH----TLVLLDTEGLGDVEKGDPKNDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +L S  +YN    I    L+ LH
Sbjct: 116 FALAVLLCSTFVYNSMSTINHQALEQLH 143


>AK131356-1|BAD18509.1|  633|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16386 fis, clone TRACH2000862, moderately
           similar to Mus musculus putative purine nucleotide
           binding protein ).
          Length = 633

 Score = 39.1 bits (87), Expect = 0.013
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSES-TVRDCATV 337
           G   GF      + +T GI MW     +  +      ++LLDT+G  D E    ++ + +
Sbjct: 60  GQNHGFPLGSTVQSETKGIWMWCVPHPSKPNH----TLVLLDTEGLGDVEKGDPKNDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +L S  +YN    I    L+ LH
Sbjct: 116 FALAVLLCSTFVYNSMSTINHQALEQLH 143


>M55543-1|AAA67323.1|  591|Homo sapiens guanylate binding protein
           isoform II protein.
          Length = 591

 Score = 38.3 bits (85), Expect = 0.023
 Identities = 27/88 (30%), Positives = 40/88 (45%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCAT-V 337
           G   GFS     +  T GI MW        +      ++LLDT+G  D E    +  + +
Sbjct: 60  GKKNGFSLGSTVKSHTKGIWMWCVPHPKKPEH----TLVLLDTEGLGDIEKGDNENDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I +  +  LH
Sbjct: 116 FALAILLSSTFVYNSMGTINQQAMDQLH 143


>CR457062-1|CAG33343.1|  591|Homo sapiens GBP2 protein.
          Length = 591

 Score = 38.3 bits (85), Expect = 0.023
 Identities = 27/88 (30%), Positives = 40/88 (45%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCAT-V 337
           G   GFS     +  T GI MW        +      ++LLDT+G  D E    +  + +
Sbjct: 60  GKKNGFSLGSTVKSHTKGIWMWCVPHPKKPEH----TLVLLDTEGLGDIEKGDNENDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I +  +  LH
Sbjct: 116 FALAILLSSTFVYNSMGTINQQAMDQLH 143


>BC073163-1|AAH73163.1|  591|Homo sapiens guanylate binding protein
           2, interferon-inducible protein.
          Length = 591

 Score = 38.3 bits (85), Expect = 0.023
 Identities = 27/88 (30%), Positives = 40/88 (45%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCAT-V 337
           G   GFS     +  T GI MW        +      ++LLDT+G  D E    +  + +
Sbjct: 60  GKKNGFSLGSTVKSHTKGIWMWCVPHPKKPEH----TLVLLDTEGLGDIEKGDNENDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I +  +  LH
Sbjct: 116 FALAILLSSTFVYNSMGTINQQAMDQLH 143


>BC022272-1|AAH22272.1|  481|Homo sapiens GBP2 protein protein.
          Length = 481

 Score = 38.3 bits (85), Expect = 0.023
 Identities = 27/88 (30%), Positives = 40/88 (45%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCAT-V 337
           G   GFS     +  T GI MW        +      ++LLDT+G  D E    +  + +
Sbjct: 60  GKKNGFSLGSTVKSHTKGIWMWCVPHPKKPEH----TLVLLDTEGLGDIEKGDNENDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I +  +  LH
Sbjct: 116 FALAILLSSTFVYNSMGTINQQAMDQLH 143


>AL832451-1|CAD89925.1|  591|Homo sapiens hypothetical protein
           protein.
          Length = 591

 Score = 38.3 bits (85), Expect = 0.023
 Identities = 27/88 (30%), Positives = 40/88 (45%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCAT-V 337
           G   GFS     +  T GI MW        +      ++LLDT+G  D E    +  + +
Sbjct: 60  GKKNGFSLGSTVKSHTKGIWMWCVPHPKKPEH----TLVLLDTEGLGDIEKGDNENDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I +  +  LH
Sbjct: 116 FALAILLSSTFVYNSMGTINQQAMDQLH 143


>BC031639-1|AAH31639.1|  586|Homo sapiens guanylate binding protein
           5 protein.
          Length = 586

 Score = 37.5 bits (83), Expect = 0.039
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTV-RDCATV 337
           G  +GFS     +  T GI +W         +     ++LLDT+G  D E    ++   +
Sbjct: 60  GKNKGFSVASTVQSHTKGIWIWC----VPHPNWPNHTLVLLDTEGLGDVEKADNKNDIQI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I +  +  LH
Sbjct: 116 FALALLLSSTFVYNTVNKIDQGAIDLLH 143


>AY358953-1|AAQ89312.1|  586|Homo sapiens ALEI2427 protein.
          Length = 586

 Score = 37.5 bits (83), Expect = 0.039
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTV-RDCATV 337
           G  +GFS     +  T GI +W         +     ++LLDT+G  D E    ++   +
Sbjct: 60  GKNKGFSVASTVQSHTKGIWIWC----VPHPNWPNHTLVLLDTEGLGDVEKADNKNDIQI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I +  +  LH
Sbjct: 116 FALALLLSSTFVYNTVNKIDQGAIDLLH 143


>AK090479-1|BAC03460.1|  504|Homo sapiens FLJ00401 protein protein.
          Length = 504

 Score = 37.5 bits (83), Expect = 0.039
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTV-RDCATV 337
           G  +GFS     +  T GI +W         +     ++LLDT+G  D E    ++   +
Sbjct: 81  GKNKGFSVASTVQSHTKGIWIWC----VPHPNWPNHTLVLLDTEGLGDVEKADNKNDIQI 136

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I +  +  LH
Sbjct: 137 FALALLLSSTFVYNTVNKIDQGAIDLLH 164


>AF430643-1|AAN39036.1|  586|Homo sapiens GBP-5a protein.
          Length = 586

 Score = 37.5 bits (83), Expect = 0.039
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTV-RDCATV 337
           G  +GFS     +  T GI +W         +     ++LLDT+G  D E    ++   +
Sbjct: 60  GKNKGFSVASTVQSHTKGIWIWC----VPHPNWPNHTLVLLDTEGLGDVEKADNKNDIQI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I +  +  LH
Sbjct: 116 FALALLLSSTFVYNTVNKIDQGAIDLLH 143


>AF430642-1|AAN39035.1|  586|Homo sapiens GBP-5b protein.
          Length = 586

 Score = 37.5 bits (83), Expect = 0.039
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTV-RDCATV 337
           G  +GFS     +  T GI +W         +     ++LLDT+G  D E    ++   +
Sbjct: 60  GKNKGFSVASTVQSHTKGIWIWC----VPHPNWPNHTLVLLDTEGLGDVEKADNKNDIQI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I +  +  LH
Sbjct: 116 FALALLLSSTFVYNTVNKIDQGAIDLLH 143


>AF328727-1|AAO40731.1|  489|Homo sapiens CTCL tumor antigen GBP-5ta
           protein.
          Length = 489

 Score = 37.5 bits (83), Expect = 0.039
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTV-RDCATV 337
           G  +GFS     +  T GI +W         +     ++LLDT+G  D E    ++   +
Sbjct: 60  GKNKGFSVASTVQSHTKGIWIWC----VPHPNWPNHTLVLLDTEGLGDVEKADNKNDIQI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I +  +  LH
Sbjct: 116 FALALLLSSTFVYNTVNKIDQGAIDLLH 143


>AF288815-1|AAL02055.1|  586|Homo sapiens guanylate binding protein
           5 protein.
          Length = 586

 Score = 37.5 bits (83), Expect = 0.039
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTV-RDCATV 337
           G  +GFS     +  T GI +W         +     ++LLDT+G  D E    ++   +
Sbjct: 60  GKNKGFSVASTVQSHTKGIWIWC----VPHPNWPNHTLVLLDTEGLGDVEKADNKNDIQI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I +  +  LH
Sbjct: 116 FALALLLSSTFVYNTVNKIDQGAIDLLH 143


>M55542-1|AAA35871.1|  592|Homo sapiens guanylate binding protein
           isoform I protein.
          Length = 592

 Score = 36.3 bits (80), Expect = 0.091
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSES-TVRDCATV 337
           G  +GFS     +  T GI MW          G    ++LLDT+G  D E    ++ + +
Sbjct: 60  GKKKGFSLGSTVQSHTKGIWMWC--VPHPKKPGH--ILVLLDTEGLGDVEKGDNQNDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I +  +  L+
Sbjct: 116 FALAVLLSSTFVYNSIGTINQQAMDQLY 143


>BT006847-1|AAP35493.1|  592|Homo sapiens guanylate binding protein
           1, interferon-inducible, 67kDa protein.
          Length = 592

 Score = 36.3 bits (80), Expect = 0.091
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSES-TVRDCATV 337
           G  +GFS     +  T GI MW          G    ++LLDT+G  D E    ++ + +
Sbjct: 60  GKKKGFSLGSTVQSHTKGIWMWC--VPHPKKPGH--ILVLLDTEGLGDVEKGDNQNDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I +  +  L+
Sbjct: 116 FALAVLLSSTFVYNSIGTINQQAMDQLY 143


>BC002666-1|AAH02666.1|  592|Homo sapiens guanylate binding protein
           1, interferon-inducible, 67kDa protein.
          Length = 592

 Score = 36.3 bits (80), Expect = 0.091
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSES-TVRDCATV 337
           G  +GFS     +  T GI MW          G    ++LLDT+G  D E    ++ + +
Sbjct: 60  GKKKGFSLGSTVQSHTKGIWMWC--VPHPKKPGH--ILVLLDTEGLGDVEKGDNQNDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I +  +  L+
Sbjct: 116 FALAVLLSSTFVYNSIGTINQQAMDQLY 143


>AY920436-1|AAX13805.1|  592|Homo sapiens guanylate binding protein
           1 protein.
          Length = 592

 Score = 36.3 bits (80), Expect = 0.091
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSES-TVRDCATV 337
           G  +GFS     +  T GI MW          G    ++LLDT+G  D E    ++ + +
Sbjct: 60  GKKKGFSLGSTVQSHTKGIWMWC--VPHPKKPGH--ILVLLDTEGLGDVEKGDNQNDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I +  +  L+
Sbjct: 116 FALAVLLSSTFVYNSIGTINQQAMDQLY 143


>AL160008-5|CAI22972.1|  592|Homo sapiens guanylate binding protein
           1, interferon-inducible, 67kDa protein.
          Length = 592

 Score = 36.3 bits (80), Expect = 0.091
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSES-TVRDCATV 337
           G  +GFS     +  T GI MW          G    ++LLDT+G  D E    ++ + +
Sbjct: 60  GKKKGFSLGSTVQSHTKGIWMWC--VPHPKKPGH--ILVLLDTEGLGDVEKGDNQNDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           FAL+ +LSS  +YN    I +  +  L+
Sbjct: 116 FALAVLLSSTFVYNSIGTINQQAMDQLY 143


>BC063819-1|AAH63819.1|  290|Homo sapiens GBP3 protein protein.
          Length = 290

 Score = 34.7 bits (76), Expect = 0.28
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFD-SESTVRDCATV 337
           G  +GFS     +  T GI MW        +      ++LLDT+G  D  +   ++ + +
Sbjct: 60  GKNKGFSLGSTVKSHTKGIWMWCVPHPKKPEH----TLVLLDTEGLGDVKKGDNQNDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           F L+ +LSS  +YN    I +  +  L+
Sbjct: 116 FTLAVLLSSTLVYNSMGTINQQAMDQLY 143


>BC017992-1|AAH17992.1|  449|Homo sapiens Unknown (protein for
           IMAGE:4249097) protein.
          Length = 449

 Score = 34.7 bits (76), Expect = 0.28
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFD-SESTVRDCATV 337
           G  +GFS     +  T GI MW        +      ++LLDT+G  D  +   ++ + +
Sbjct: 60  GKNKGFSLGSTVKSHTKGIWMWCVPHPKKPEH----TLVLLDTEGLGDVKKGDNQNDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           F L+ +LSS  +YN    I +  +  L+
Sbjct: 116 FTLAVLLSSTLVYNSMGTINQQAMDQLY 143


>AL160008-4|CAI22971.1|  440|Homo sapiens guanylate binding protein
           3 protein.
          Length = 440

 Score = 34.7 bits (76), Expect = 0.28
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFD-SESTVRDCATV 337
           G  +GFS     +  T GI MW        +      ++LLDT+G  D  +   ++ + +
Sbjct: 60  GKNKGFSLGSTVKSHTKGIWMWCVPHPKKPEH----TLVLLDTEGLGDVKKGDNQNDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           F L+ +LSS  +YN    I +  +  L+
Sbjct: 116 FTLAVLLSSTLVYNSMGTINQQAMDQLY 143


>AL160008-3|CAI22970.1|  563|Homo sapiens guanylate binding protein
           3 protein.
          Length = 563

 Score = 34.7 bits (76), Expect = 0.28
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFD-SESTVRDCATV 337
           G  +GFS     +  T GI MW        +      ++LLDT+G  D  +   ++ + +
Sbjct: 60  GKNKGFSLGSTVKSHTKGIWMWCVPHPKKPEH----TLVLLDTEGLGDVKKGDNQNDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           F L+ +LSS  +YN    I +  +  L+
Sbjct: 116 FTLAVLLSSTLVYNSMGTINQQAMDQLY 143


>AL160008-2|CAM28327.1|  595|Homo sapiens guanylate binding protein
           3 protein.
          Length = 595

 Score = 34.7 bits (76), Expect = 0.28
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFD-SESTVRDCATV 337
           G  +GFS     +  T GI MW        +      ++LLDT+G  D  +   ++ + +
Sbjct: 60  GKNKGFSLGSTVKSHTKGIWMWCVPHPKKPEH----TLVLLDTEGLGDVKKGDNQNDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           F L+ +LSS  +YN    I +  +  L+
Sbjct: 116 FTLAVLLSSTLVYNSMGTINQQAMDQLY 143


>AL139416-8|CAI21698.1|  440|Homo sapiens guanylate binding protein
           3 protein.
          Length = 440

 Score = 34.7 bits (76), Expect = 0.28
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFD-SESTVRDCATV 337
           G  +GFS     +  T GI MW        +      ++LLDT+G  D  +   ++ + +
Sbjct: 60  GKNKGFSLGSTVKSHTKGIWMWCVPHPKKPEH----TLVLLDTEGLGDVKKGDNQNDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           F L+ +LSS  +YN    I +  +  L+
Sbjct: 116 FTLAVLLSSTLVYNSMGTINQQAMDQLY 143


>AL139416-7|CAI21697.1|  563|Homo sapiens guanylate binding protein
           3 protein.
          Length = 563

 Score = 34.7 bits (76), Expect = 0.28
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFD-SESTVRDCATV 337
           G  +GFS     +  T GI MW        +      ++LLDT+G  D  +   ++ + +
Sbjct: 60  GKNKGFSLGSTVKSHTKGIWMWCVPHPKKPEH----TLVLLDTEGLGDVKKGDNQNDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           F L+ +LSS  +YN    I +  +  L+
Sbjct: 116 FTLAVLLSSTLVYNSMGTINQQAMDQLY 143


>AL139416-6|CAM28262.1|  595|Homo sapiens guanylate binding protein
           3 protein.
          Length = 595

 Score = 34.7 bits (76), Expect = 0.28
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
 Frame = -1

Query: 513 GPLQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFD-SESTVRDCATV 337
           G  +GFS     +  T GI MW        +      ++LLDT+G  D  +   ++ + +
Sbjct: 60  GKNKGFSLGSTVKSHTKGIWMWCVPHPKKPEH----TLVLLDTEGLGDVKKGDNQNDSWI 115

Query: 336 FALSTMLSSVQIYNLSQNIQEDDLQHLH 253
           F L+ +LSS  +YN    I +  +  L+
Sbjct: 116 FTLAVLLSSTLVYNSMGTINQQAMDQLY 143


>AK024010-1|BAB14773.1|  339|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13948 fis, clone Y79AA1001023. ).
          Length = 339

 Score = 32.3 bits (70), Expect = 1.5
 Identities = 17/52 (32%), Positives = 23/52 (44%)
 Frame = -2

Query: 626 VAGAFRKGKSFLLDFFLRYMHYKYXXXXXXXXXXXXXEDPSRASAGEGAPRG 471
           ++   +K KS L+DFFL+  H K               D SR+ A   AP G
Sbjct: 271 ISDQIKKEKSLLVDFFLKEEHEKLKLMDEPALRSPGGGDRSRSRAASSAPSG 322


>AJ272204-1|CAC01125.1|  999|Homo sapiens hypothetical protein
            protein.
          Length = 999

 Score = 32.3 bits (70), Expect = 1.5
 Identities = 17/52 (32%), Positives = 23/52 (44%)
 Frame = -2

Query: 626  VAGAFRKGKSFLLDFFLRYMHYKYXXXXXXXXXXXXXEDPSRASAGEGAPRG 471
            ++   +K KS L+DFFL+  H K               D SR+ A   AP G
Sbjct: 931  ISDQIKKEKSLLVDFFLKEEHEKLKLMDEPALRSPGGGDRSRSRAASSAPSG 982


>AK131080-1|BAC85130.1|  563|Homo sapiens FLJ00279 protein protein.
          Length = 563

 Score = 30.3 bits (65), Expect = 6.0
 Identities = 14/31 (45%), Positives = 16/31 (51%)
 Frame = +3

Query: 291 RGCISERTTASWTERTRSRSLAPWIHCRRRL 383
           RGC    TT  WT  T +R+ A W   RR L
Sbjct: 19  RGCSRSWTTCWWTWTTSARARATWRRSRRSL 49


>AK092192-1|BAC03825.1|  144|Homo sapiens protein ( Homo sapiens
           cDNA FLJ34873 fis, clone NT2NE2014950. ).
          Length = 144

 Score = 30.3 bits (65), Expect = 6.0
 Identities = 16/45 (35%), Positives = 21/45 (46%)
 Frame = -2

Query: 239 RSAGARGRGPDSLPAAAVPRARLELPLRSALRSGRRHADTVKKIK 105
           R+ G RG GP   P+    RA    P + A  SG+R     +K K
Sbjct: 53  RAGGRRGAGPPQSPSGGDSRASRSAPDKQARSSGKRGLQPQRKGK 97


>AJ606308-1|CAE54436.1| 4262|Homo sapiens secreted mucin MUC17
            protein.
          Length = 4262

 Score = 29.9 bits (64), Expect = 7.9
 Identities = 21/55 (38%), Positives = 30/55 (54%)
 Frame = +2

Query: 317  SIVDRANTVAQSRTVDSLSKAPCVSSNIIATFSPSSSVALNISDHMSMPVVSLSE 481
            SI     TVA S  ++SLS  P V+S  + T+S +SS +   +D  SM   + SE
Sbjct: 1518 SIPVSTTTVASSE-INSLSTTPAVTSTPVTTYSQASS-SPTTADGTSMQTSTYSE 1570


>AJ606307-1|CAE54435.1| 4493|Homo sapiens membrane mucin MUC17
            protein.
          Length = 4493

 Score = 29.9 bits (64), Expect = 7.9
 Identities = 21/55 (38%), Positives = 30/55 (54%)
 Frame = +2

Query: 317  SIVDRANTVAQSRTVDSLSKAPCVSSNIIATFSPSSSVALNISDHMSMPVVSLSE 481
            SI     TVA S  ++SLS  P V+S  + T+S +SS +   +D  SM   + SE
Sbjct: 1518 SIPVSTTTVASSE-INSLSTTPAVTSTPVTTYSQASS-SPTTADGTSMQTSTYSE 1570


>AF016693-1|AAB71686.1|  236|Homo sapiens small intestinal mucin
           MUC3 protein.
          Length = 236

 Score = 29.9 bits (64), Expect = 7.9
 Identities = 21/55 (38%), Positives = 30/55 (54%)
 Frame = +2

Query: 317 SIVDRANTVAQSRTVDSLSKAPCVSSNIIATFSPSSSVALNISDHMSMPVVSLSE 481
           SI     TVA S  ++SLS  P V+S  + T+S +SS +   +D  SM   + SE
Sbjct: 172 SIPVSTTTVASSE-INSLSTTPAVTSTPVTTYSQASS-SPTTADGTSMQTSTYSE 224


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 90,084,875
Number of Sequences: 237096
Number of extensions: 1860879
Number of successful extensions: 6188
Number of sequences better than 10.0: 58
Number of HSP's better than 10.0 without gapping: 5828
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6188
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6972732040
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).