SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0014
         (389 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U70136-1|AAB09089.1| 1404|Homo sapiens megakaryocyte stimulating...    33   0.43 
BC067771-1|AAH67771.1|  314|Homo sapiens CCDC74B protein protein.      31   1.8  
BC063387-1|AAH63387.1|  312|Homo sapiens CCDC74A protein protein.      31   1.8  
BC016861-1|AAH16861.1|  378|Homo sapiens coiled-coil domain cont...    31   1.8  
BC012351-1|AAH12351.1|  221|Homo sapiens hairy and enhancer of s...    31   1.8  
AL645608-10|CAI15572.1|  221|Homo sapiens hairy and enhancer of ...    31   1.8  
AK057609-1|BAB71533.1|  380|Homo sapiens protein ( Homo sapiens ...    31   1.8  
AC093838-1|AAY14809.1|  378|Homo sapiens unknown protein.              31   1.8  
AB048791-1|BAB13510.1|  221|Homo sapiens bHLH factor Hes4 protein.     31   1.8  
BC027994-1|AAH27994.1|  605|Homo sapiens beta-transducin repeat ...    30   3.1  
AL627424-17|CAI41042.1|  605|Homo sapiens beta-transducin repeat...    30   3.1  
AL445463-2|CAI12963.1|  605|Homo sapiens beta-transducin repeat ...    30   3.1  
AL445463-1|CAI12962.1|  191|Homo sapiens beta-transducin repeat ...    30   3.1  
AL133387-1|CAH70020.1|  605|Homo sapiens beta-transducin repeat ...    30   3.1  
AF101784-1|AAD08702.1|  605|Homo sapiens b-TRCP variant E3RS-Ika...    30   3.1  
BC016305-1|AAH16305.1|  546|Homo sapiens Unknown (protein for IM...    28   9.3  
AY596971-1|AAT49272.1| 2083|Homo sapiens tuberin-like protein 1 ...    28   9.3  
AY596970-1|AAT49271.1| 2036|Homo sapiens tuberin-like protein 1 ...    28   9.3  
AK022988-1|BAB14349.1|  452|Homo sapiens protein ( Homo sapiens ...    28   9.3  
AB020691-1|BAA74907.1|  943|Homo sapiens KIAA0884 protein protein.     28   9.3  

>U70136-1|AAB09089.1| 1404|Homo sapiens megakaryocyte stimulating
           factor protein.
          Length = 1404

 Score = 32.7 bits (71), Expect = 0.43
 Identities = 21/43 (48%), Positives = 27/43 (62%), Gaps = 1/43 (2%)
 Frame = +1

Query: 175 SASENQVSLGSKSARSSS-VIWEIS*RTKTAPKSAAEREIGKR 300
           S SENQ S  S S+ SSS  IW+I    K++  SAA RE+ K+
Sbjct: 159 SVSENQESSSSSSSSSSSSTIWKI----KSSKNSAANRELQKK 197


>BC067771-1|AAH67771.1|  314|Homo sapiens CCDC74B protein protein.
          Length = 314

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 16/54 (29%), Positives = 27/54 (50%)
 Frame = +2

Query: 104 TTDGKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRH 265
           TT  +  VL+ +   + + Q  ELQHLK+    +Q+ Q  P+ +    D+   H
Sbjct: 204 TTLRQCEVLIRELWNTNLLQTQELQHLKSLLEGSQRPQAVPEEASFPRDQEATH 257


>BC063387-1|AAH63387.1|  312|Homo sapiens CCDC74A protein protein.
          Length = 312

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 16/54 (29%), Positives = 28/54 (51%)
 Frame = +2

Query: 104 TTDGKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRH 265
           TT  +  VL+ +   + + Q  EL+HLK+    +Q+ Q AP+ +    D+   H
Sbjct: 204 TTLRQCEVLIRELWNTNLLQTQELRHLKSLLEGSQRPQAAPEEASFPRDQEATH 257


>BC016861-1|AAH16861.1|  378|Homo sapiens coiled-coil domain
           containing 74A protein.
          Length = 378

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 16/54 (29%), Positives = 28/54 (51%)
 Frame = +2

Query: 104 TTDGKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRH 265
           TT  +  VL+ +   + + Q  EL+HLK+    +Q+ Q AP+ +    D+   H
Sbjct: 270 TTLRQCEVLIRELWNTNLLQTQELRHLKSLLEGSQRPQAAPEEASFPRDQEATH 323


>BC012351-1|AAH12351.1|  221|Homo sapiens hairy and enhancer of
           split 4 (Drosophila) protein.
          Length = 221

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 5/45 (11%)
 Frame = +2

Query: 197 PSAQKAQGAPQSSGKSHDEPRRHQNQRQS-----EKSARGRLVES 316
           PSA    GAP S+ ++ D+PR     R+S     EK  R R+ ES
Sbjct: 9   PSASPMAGAPASASRTPDKPRSAAEHRKSSKPVMEKRRRARINES 53


>AL645608-10|CAI15572.1|  221|Homo sapiens hairy and enhancer of
           split 4 (Drosophila) protein.
          Length = 221

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 5/45 (11%)
 Frame = +2

Query: 197 PSAQKAQGAPQSSGKSHDEPRRHQNQRQS-----EKSARGRLVES 316
           PSA    GAP S+ ++ D+PR     R+S     EK  R R+ ES
Sbjct: 9   PSASPMAGAPASASRTPDKPRSAAEHRKSSKPVMEKRRRARINES 53


>AK057609-1|BAB71533.1|  380|Homo sapiens protein ( Homo sapiens
           cDNA FLJ33047 fis, clone TRACH1000018. ).
          Length = 380

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 16/54 (29%), Positives = 27/54 (50%)
 Frame = +2

Query: 104 TTDGKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRH 265
           TT  +  VL+ +   + + Q  ELQHLK+    +Q+ Q  P+ +    D+   H
Sbjct: 270 TTLRQCEVLIRELWNTNLLQTQELQHLKSLLEGSQRPQAVPEEASFPRDQEATH 323


>AC093838-1|AAY14809.1|  378|Homo sapiens unknown protein.
          Length = 378

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 16/54 (29%), Positives = 28/54 (51%)
 Frame = +2

Query: 104 TTDGKIIVLLPDNKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRH 265
           TT  +  VL+ +   + + Q  EL+HLK+    +Q+ Q AP+ +    D+   H
Sbjct: 270 TTLRQCEVLIRELWNTNLLQTQELRHLKSLLEGSQRPQAAPEEASFPRDQEATH 323


>AB048791-1|BAB13510.1|  221|Homo sapiens bHLH factor Hes4 protein.
          Length = 221

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 5/45 (11%)
 Frame = +2

Query: 197 PSAQKAQGAPQSSGKSHDEPRRHQNQRQS-----EKSARGRLVES 316
           PSA    GAP S+ ++ D+PR     R+S     EK  R R+ ES
Sbjct: 9   PSASPMAGAPASASRTPDKPRSAAEHRKSSKPVMEKRRRARINES 53


>BC027994-1|AAH27994.1|  605|Homo sapiens beta-transducin repeat
           containing protein.
          Length = 605

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%)
 Frame = -1

Query: 203 PRETWFSDAEVQTSVQSY-CVYYPGEGRLFSHLLSSSA*RRNESGPPKR 60
           PR  W   + +  S+ S  C+Y PG G L +   SS     N   PP++
Sbjct: 20  PRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRK 68


>AL627424-17|CAI41042.1|  605|Homo sapiens beta-transducin repeat
           containing protein.
          Length = 605

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%)
 Frame = -1

Query: 203 PRETWFSDAEVQTSVQSY-CVYYPGEGRLFSHLLSSSA*RRNESGPPKR 60
           PR  W   + +  S+ S  C+Y PG G L +   SS     N   PP++
Sbjct: 20  PRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRK 68


>AL445463-2|CAI12963.1|  605|Homo sapiens beta-transducin repeat
           containing protein.
          Length = 605

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%)
 Frame = -1

Query: 203 PRETWFSDAEVQTSVQSY-CVYYPGEGRLFSHLLSSSA*RRNESGPPKR 60
           PR  W   + +  S+ S  C+Y PG G L +   SS     N   PP++
Sbjct: 20  PRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRK 68


>AL445463-1|CAI12962.1|  191|Homo sapiens beta-transducin repeat
           containing protein.
          Length = 191

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%)
 Frame = -1

Query: 203 PRETWFSDAEVQTSVQSY-CVYYPGEGRLFSHLLSSSA*RRNESGPPKR 60
           PR  W   + +  S+ S  C+Y PG G L +   SS     N   PP++
Sbjct: 2   PRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRK 50


>AL133387-1|CAH70020.1|  605|Homo sapiens beta-transducin repeat
           containing protein.
          Length = 605

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%)
 Frame = -1

Query: 203 PRETWFSDAEVQTSVQSY-CVYYPGEGRLFSHLLSSSA*RRNESGPPKR 60
           PR  W   + +  S+ S  C+Y PG G L +   SS     N   PP++
Sbjct: 20  PRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRK 68


>AF101784-1|AAD08702.1|  605|Homo sapiens b-TRCP variant
           E3RS-IkappaB protein.
          Length = 605

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%)
 Frame = -1

Query: 203 PRETWFSDAEVQTSVQSY-CVYYPGEGRLFSHLLSSSA*RRNESGPPKR 60
           PR  W   + +  S+ S  C+Y PG G L +   SS     N   PP++
Sbjct: 20  PRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRK 68


>BC016305-1|AAH16305.1|  546|Homo sapiens Unknown (protein for
           IMAGE:4076117) protein.
          Length = 546

 Score = 28.3 bits (60), Expect = 9.3
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = -1

Query: 314 FRRVVLLPISRSAADFGAVLVRHEISQMTEELLALFEPRETWFSDAEV 171
           FR+  LLPI  +AA    V V  E  Q  E+ L + EP E   + +++
Sbjct: 260 FRQAFLLPICEAAAMRKVVKVYQEWIQQEEKPLFMQEPEEIVITSSDL 307


>AY596971-1|AAT49272.1| 2083|Homo sapiens tuberin-like protein 1
           isoform 2 protein.
          Length = 2083

 Score = 28.3 bits (60), Expect = 9.3
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = -1

Query: 314 FRRVVLLPISRSAADFGAVLVRHEISQMTEELLALFEPRETWFSDAEV 171
           FR+  LLPI  +AA    V V  E  Q  E+ L + EP E   + +++
Sbjct: 415 FRQAFLLPICEAAAMRKVVKVYQEWIQQEEKPLFMQEPEEIVITSSDL 462


>AY596970-1|AAT49271.1| 2036|Homo sapiens tuberin-like protein 1
           isoform 1 protein.
          Length = 2036

 Score = 28.3 bits (60), Expect = 9.3
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = -1

Query: 314 FRRVVLLPISRSAADFGAVLVRHEISQMTEELLALFEPRETWFSDAEV 171
           FR+  LLPI  +AA    V V  E  Q  E+ L + EP E   + +++
Sbjct: 415 FRQAFLLPICEAAAMRKVVKVYQEWIQQEEKPLFMQEPEEIVITSSDL 462


>AK022988-1|BAB14349.1|  452|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12926 fis, clone NT2RP2004732, weakly similar to
           NEUROFILAMENT TRIPLET M PROTEIN. ).
          Length = 452

 Score = 28.3 bits (60), Expect = 9.3
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = -1

Query: 314 FRRVVLLPISRSAADFGAVLVRHEISQMTEELLALFEPRETWFSDAEV 171
           FR+  LLPI  +AA    V V  E  Q  E+ L + EP E   + +++
Sbjct: 144 FRQAFLLPICEAAAMRKVVKVYQEWIQQEEKPLFMQEPEEIVITSSDL 191


>AB020691-1|BAA74907.1|  943|Homo sapiens KIAA0884 protein protein.
          Length = 943

 Score = 28.3 bits (60), Expect = 9.3
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = -1

Query: 314 FRRVVLLPISRSAADFGAVLVRHEISQMTEELLALFEPRETWFSDAEV 171
           FR+  LLPI  +AA    V V  E  Q  E+ L + EP E   + +++
Sbjct: 254 FRQAFLLPICEAAAMRKVVKVYQEWIQQEEKPLFMQEPEEIVITSSDL 301


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 52,759,543
Number of Sequences: 237096
Number of extensions: 1018482
Number of successful extensions: 2573
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 2482
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2565
length of database: 76,859,062
effective HSP length: 82
effective length of database: 57,417,190
effective search space used: 2698607930
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).