SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0040
         (740 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC063867-1|AAH63867.1| 1115|Homo sapiens HEATR5A protein protein.      30   7.6  
BC045764-1|AAH45764.1| 1778|Homo sapiens HEATR5A protein protein.      30   7.6  
AK000343-1|BAA91098.1|  854|Homo sapiens protein ( Homo sapiens ...    30   7.6  
AB037737-1|BAA92554.1| 1590|Homo sapiens KIAA1316 protein protein.     30   7.6  

>BC063867-1|AAH63867.1| 1115|Homo sapiens HEATR5A protein protein.
          Length = 1115

 Score = 30.3 bits (65), Expect = 7.6
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 3/85 (3%)
 Frame = -1

Query: 491  VSVTNMHLLIKIEVSKETFQLTYLNSLNYFVANKIRTTKGVVAAP*TRPQKRRQTEFNRN 312
            +S+    L + I V +ET        L+  VA  ++  KG++++P  R +K R    +  
Sbjct: 818  ISILPTILYLTIGVLRETAVKLPGGQLSSTVAASLQALKGILSSPMARAEKSRTAWTDLL 877

Query: 311  KKRL-NLLSHWD--IETKEELGDFS 246
            +  L  +L  WD   ET +EL + S
Sbjct: 878  RSALTTILDCWDPVDETHQELDEVS 902


>BC045764-1|AAH45764.1| 1778|Homo sapiens HEATR5A protein protein.
          Length = 1778

 Score = 30.3 bits (65), Expect = 7.6
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 3/85 (3%)
 Frame = -1

Query: 491  VSVTNMHLLIKIEVSKETFQLTYLNSLNYFVANKIRTTKGVVAAP*TRPQKRRQTEFNRN 312
            +S+    L + I V +ET        L+  VA  ++  KG++++P  R +K R    +  
Sbjct: 1481 ISILPTILYLTIGVLRETAVKLPGGQLSSTVAASLQALKGILSSPMARAEKSRTAWTDLL 1540

Query: 311  KKRL-NLLSHWD--IETKEELGDFS 246
            +  L  +L  WD   ET +EL + S
Sbjct: 1541 RSALTTILDCWDPVDETHQELDEVS 1565


>AK000343-1|BAA91098.1|  854|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20336 fis, clone HEP11722. ).
          Length = 854

 Score = 30.3 bits (65), Expect = 7.6
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 3/85 (3%)
 Frame = -1

Query: 491 VSVTNMHLLIKIEVSKETFQLTYLNSLNYFVANKIRTTKGVVAAP*TRPQKRRQTEFNRN 312
           +S+    L + I V +ET        L+  VA  ++  KG++++P  R +K R    +  
Sbjct: 557 ISILPTILYLTIGVLRETAVKLPGGQLSSTVAASLQALKGILSSPMARAEKSRTAWTDLL 616

Query: 311 KKRL-NLLSHWD--IETKEELGDFS 246
           +  L  +L  WD   ET +EL + S
Sbjct: 617 RSALTTILDCWDPVDETHQELDEVS 641


>AB037737-1|BAA92554.1| 1590|Homo sapiens KIAA1316 protein protein.
          Length = 1590

 Score = 30.3 bits (65), Expect = 7.6
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 3/85 (3%)
 Frame = -1

Query: 491  VSVTNMHLLIKIEVSKETFQLTYLNSLNYFVANKIRTTKGVVAAP*TRPQKRRQTEFNRN 312
            +S+    L + I V +ET        L+  VA  ++  KG++++P  R +K R    +  
Sbjct: 1293 ISILPTILYLTIGVLRETAVKLPGGQLSSTVAASLQALKGILSSPMARAEKSRTAWTDLL 1352

Query: 311  KKRL-NLLSHWD--IETKEELGDFS 246
            +  L  +L  WD   ET +EL + S
Sbjct: 1353 RSALTTILDCWDPVDETHQELDEVS 1377


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 89,875,286
Number of Sequences: 237096
Number of extensions: 1650618
Number of successful extensions: 2204
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 2197
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2204
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8847149012
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).