SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0039
         (826 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB040899-1|BAA95990.1|  505|Homo sapiens KIAA1466 protein protein.     64   4e-10
AK000132-1|BAA90963.1|  392|Homo sapiens protein ( Homo sapiens ...    63   1e-09
AK131226-1|BAD18411.1|  194|Homo sapiens protein ( Homo sapiens ...    54   6e-07
BC033390-1|AAH33390.1|  439|Homo sapiens KRBA2 protein protein.        52   3e-06
AK131219-1|BAD18406.1|  492|Homo sapiens protein ( Homo sapiens ...    52   3e-06
AF499232-2|AAP29639.1| 1183|Homo sapiens pol protein protein.          42   0.002
AF333072-2|AAL60056.1|  702|Homo sapiens pol protein protein.          39   0.025
AK131330-1|BAD18490.1|  153|Homo sapiens protein ( Homo sapiens ...    38   0.033
AK131478-1|BAD18623.1|  266|Homo sapiens protein ( Homo sapiens ...    38   0.044
M14123-4|AAA88033.1| 1361|Homo sapiens protein ( Human endogenou...    37   0.077
BC111741-1|AAI11742.1| 1325|Homo sapiens zinc finger protein 452...    37   0.077
BC110834-1|AAI10835.1| 1325|Homo sapiens zinc finger protein 452...    37   0.077
AY517631-1|AAS01734.1| 1325|Homo sapiens zinc finger protein 452...    37   0.077
AY186778-1|AAO27434.1|  727|Homo sapiens polymerase protein.           37   0.077
AL671879-1|CAI17641.2|  794|Homo sapiens zinc finger protein 452...    37   0.077
AK056369-1|BAB71166.1|  782|Homo sapiens protein ( Homo sapiens ...    37   0.077
AF298588-1|AAK11554.1|  956|Homo sapiens polymerase protein.           37   0.077
AF298587-1|AAK11553.1|  956|Homo sapiens polymerase protein.           37   0.077
AF164614-1|AAD51797.1| 1879|Homo sapiens Gag-Pro-Pol protein pro...    37   0.077
AF164613-1|AAD51796.1| 1755|Homo sapiens Gag-Pro-Pol protein pro...    37   0.077
AF164611-1|AAD51793.1| 2294|Homo sapiens Gag-Pro-Pol-Env protein...    37   0.077
AF074086-7|AAD21097.1|  956|Homo sapiens polymerase protein.           37   0.077
AF074086-3|AAF88167.1|  956|Homo sapiens polymerase protein.           37   0.077
AB067512-1|BAB67818.1| 1147|Homo sapiens KIAA1925 protein protein.     37   0.077
BC111742-1|AAI11743.1| 1325|Homo sapiens zinc finger protein 452...    37   0.10 
AK057704-1|BAB71549.1|  120|Homo sapiens protein ( Homo sapiens ...    36   0.24 
AF480924-3|AAM81188.1|  863|Homo sapiens pol protein protein.          34   0.72 
BC078154-1|AAH78154.1|  595|Homo sapiens zinc finger protein 317...    33   0.95 
AF307097-1|AAL29191.1|  510|Homo sapiens ZNF317-4 protein protein.     33   0.95 
AF307096-1|AAL29190.1|  478|Homo sapiens ZNF317-3 protein protein.     33   0.95 
AF275255-1|AAL29188.1|  595|Homo sapiens ZNF317-2 protein protein.     33   0.95 
AF148135-1|AAL29182.1|  563|Homo sapiens ZNF317-1 protein protein.     33   0.95 
AB046808-1|BAB13414.1|  613|Homo sapiens KIAA1588 protein protein.     33   0.95 
BC093825-1|AAH93825.1| 1037|Homo sapiens caspase recruitment dom...    30   8.8  
AF356193-1|AAK32718.1| 1037|Homo sapiens caspase recruitment dom...    30   8.8  
AB209844-1|BAD93081.1|  872|Homo sapiens caspase recruitment dom...    30   8.8  

>AB040899-1|BAA95990.1|  505|Homo sapiens KIAA1466 protein protein.
          Length = 505

 Score = 64.5 bits (150), Expect = 4e-10
 Identities = 36/100 (36%), Positives = 52/100 (52%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P  + +D G  F +EV++QL +L  IK      YHPQ+ G ++  + TLK  L+ +  
Sbjct: 333 GLPLTLGSDNGPAFMAEVVQQLSQLLKIKWKLHIVYHPQSSGKVQWMNQTLKHLLK-FCQ 391

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYI 524
           E    WD  L  A L     +   TG SP E++FG  P I
Sbjct: 392 EPHLRWDQVLPMAFLQVRCTLTKLTGLSPCEIVFGRPPPI 431


>AK000132-1|BAA90963.1|  392|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20125 fis, clone COL06152. ).
          Length = 392

 Score = 62.9 bits (146), Expect = 1e-09
 Identities = 35/107 (32%), Positives = 56/107 (52%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P+ II DQ   F  ++  +L RLFGIK I  S +   T   +E + +T+K +L  +  
Sbjct: 197 GPPQKIIMDQRDEFIQQINIELYRLFGIKQIVIS-HTSGTVNPMESTPNTIKAFLSKHCA 255

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSL 503
           ++ + WD +L     A+N      T  +P   +F   PY+P++ DSL
Sbjct: 256 DHPNNWDDHLSAVSFAFNVTHLEPTKNTPYFQMFSRNPYMPETSDSL 302


>AK131226-1|BAD18411.1|  194|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16127 fis, clone BRACE2037299. ).
          Length = 194

 Score = 54.0 bits (124), Expect = 6e-07
 Identities = 31/95 (32%), Positives = 47/95 (49%)
 Frame = -1

Query: 766 KQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNS 587
           KQ  RL      F  PYHP + G +ER++  LK +L    ++ +  W   L  A+L   +
Sbjct: 11  KQSPRLSASSGNFIPPYHPSSLGKVERTNGLLKTHLTKLSLQLKKDWTALLPFALLRIRA 70

Query: 586 NIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSD 482
                TG+SP EL +G    +  ++  L  NTY+D
Sbjct: 71  YPQEATGYSPFELSYGCTFLLGPNL--LTDNTYAD 103


>BC033390-1|AAH33390.1|  439|Homo sapiens KRBA2 protein protein.
          Length = 439

 Score = 52.0 bits (119), Expect = 3e-06
 Identities = 28/100 (28%), Positives = 51/100 (51%), Gaps = 2/100 (2%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHP-QTCGALERSHSTLKEYLRSY 650
           +G P ++ +D G  F+++V+ +L  L+    I +  YHP Q+ G+LE +   +K  + ++
Sbjct: 263 LGTPSVLDSDSGVEFTNQVVHELNELWPDLKIVSGKYHPGQSQGSLEGASRDVKNMISTW 322

Query: 649 IVENQHT-WDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
           +  N    W   LR   +  N     +   SP E +FG+K
Sbjct: 323 MQSNHSCHWAKGLRFMQMVRNQAFDVSLQQSPFEAMFGYK 362


>AK131219-1|BAD18406.1|  492|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16113 fis, clone 3NB692004724. ).
          Length = 492

 Score = 52.0 bits (119), Expect = 3e-06
 Identities = 28/100 (28%), Positives = 51/100 (51%), Gaps = 2/100 (2%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHP-QTCGALERSHSTLKEYLRSY 650
           +G P ++ +D G  F+++V+ +L  L+    I +  YHP Q+ G+LE +   +K  + ++
Sbjct: 316 LGTPSVLDSDSGVEFTNQVVHELNELWPDLKIVSGKYHPGQSQGSLEGASRDVKNMISTW 375

Query: 649 IVENQHT-WDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
           +  N    W   LR   +  N     +   SP E +FG+K
Sbjct: 376 MQSNHSCHWAKGLRFMQMVRNQAFDVSLQQSPFEAMFGYK 415


>AF499232-2|AAP29639.1| 1183|Homo sapiens pol protein protein.
          Length = 1183

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 25/104 (24%), Positives = 47/104 (45%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  I +D G  F ++++++  ++ G      + Y PQ+ G +E+ + T+K        
Sbjct: 952  GLPLRIGSDNGPAFVADLVQKRAKVLGNTWKLHAAYRPQSSGKVEQMNWTIKNSKGKVCQ 1011

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI 512
            E    W   L   +          TG+SP E+L+   P I + +
Sbjct: 1012 ETGLKWIQALPMVLFKIRCTPSKRTGYSPYEILYHRPPPILRGL 1055


>AF333072-2|AAL60056.1|  702|Homo sapiens pol protein protein.
          Length = 702

 Score = 38.7 bits (86), Expect = 0.025
 Identities = 19/56 (33%), Positives = 30/56 (53%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYL 659
           +G+PK I TD G  + S+  ++    + I H    PY+ Q    +ER++ TLK  L
Sbjct: 591 MGVPKKIKTDNGPGYCSKAFQKFLSQWKISHTTGIPYNSQGQAIVERTNRTLKTQL 646


>AK131330-1|BAD18490.1|  153|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16337 fis, clone TESTI1000266. ).
          Length = 153

 Score = 38.3 bits (85), Expect = 0.033
 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 5/72 (6%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRS-- 653
           +G P  I T+    ++S   +Q   ++ I+H    PY+PQ    +E +HSTLK  L+   
Sbjct: 71  MGQPTKIKTNNDLAYASSQFQQFCHMWNIQHSTGIPYNPQGQAIVECAHSTLKNMLKKQK 130

Query: 652 ---YIVENQHTW 626
              ++   QH W
Sbjct: 131 RGVWVRTLQHYW 142


>AK131478-1|BAD18623.1|  266|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16646 fis, clone TESTI4032090. ).
          Length = 266

 Score = 37.9 bits (84), Expect = 0.044
 Identities = 21/64 (32%), Positives = 33/64 (51%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
           IGI   I TD    ++S+ +     +  IKHI   PY+ Q    +ER + +LK+ L+   
Sbjct: 190 IGILASIKTDNAPGYTSQALATFFSIRNIKHITGIPYNSQGQAIVERMNLSLKQQLQKQK 249

Query: 646 VENQ 635
            EN+
Sbjct: 250 GENR 253


>M14123-4|AAA88033.1| 1361|Homo sapiens protein ( Human endogenous
           retrovirus HERV-K10. ).
          Length = 1361

 Score = 37.1 bits (82), Expect = 0.077
 Identities = 18/56 (32%), Positives = 30/56 (53%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYL 659
           +G+P+ I TD G  + S+  ++    + I H    PY+ Q    +ER++ TLK  L
Sbjct: 603 MGVPEKIKTDNGPGYCSKAFQKFLSQWKISHTTGIPYNSQGQAIVERTNRTLKTQL 658


>BC111741-1|AAI11742.1| 1325|Homo sapiens zinc finger protein 452
           protein.
          Length = 1325

 Score = 37.1 bits (82), Expect = 0.077
 Identities = 22/96 (22%), Positives = 41/96 (42%), Gaps = 1/96 (1%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLF-GIKHIFASPYHPQTCGALERSHSTLKEYLRSY 650
           IG P ++ +D G  FSS+V+ +L  ++  +K +       Q+  + E++    K      
Sbjct: 428 IGAPSVLQSDNGREFSSQVVSELSNIWPELKIVHGKSQTCQSQSSAEQTEDIRKRIFSWM 487

Query: 649 IVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLF 542
              N   W  +L    ++ N   H +   +P E  F
Sbjct: 488 QTNNSSHWTEFLWFIQMSQNQPYHRSMQQTPCESAF 523


>BC110834-1|AAI10835.1| 1325|Homo sapiens zinc finger protein 452
           protein.
          Length = 1325

 Score = 37.1 bits (82), Expect = 0.077
 Identities = 22/96 (22%), Positives = 41/96 (42%), Gaps = 1/96 (1%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLF-GIKHIFASPYHPQTCGALERSHSTLKEYLRSY 650
           IG P ++ +D G  FSS+V+ +L  ++  +K +       Q+  + E++    K      
Sbjct: 428 IGAPSVLQSDNGREFSSQVVSELSNIWPELKIVHGKSQTCQSQSSAEQTEDIRKRIFSWM 487

Query: 649 IVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLF 542
              N   W  +L    ++ N   H +   +P E  F
Sbjct: 488 QTNNSSHWTEFLWFIQMSQNQPYHRSMQQTPCESAF 523


>AY517631-1|AAS01734.1| 1325|Homo sapiens zinc finger protein 452
           protein.
          Length = 1325

 Score = 37.1 bits (82), Expect = 0.077
 Identities = 22/96 (22%), Positives = 41/96 (42%), Gaps = 1/96 (1%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLF-GIKHIFASPYHPQTCGALERSHSTLKEYLRSY 650
           IG P ++ +D G  FSS+V+ +L  ++  +K +       Q+  + E++    K      
Sbjct: 428 IGAPSVLQSDNGREFSSQVVSELSNIWPELKIVHGKSQTCQSQSSAEQTEDIRKRIFSWM 487

Query: 649 IVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLF 542
              N   W  +L    ++ N   H +   +P E  F
Sbjct: 488 QTNNSSHWTEFLWFIQMSQNQPYHRSMQQTPCESAF 523


>AY186778-1|AAO27434.1|  727|Homo sapiens polymerase protein.
          Length = 727

 Score = 37.1 bits (82), Expect = 0.077
 Identities = 18/56 (32%), Positives = 30/56 (53%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYL 659
           +G+P+ I TD G  + S+  ++    + I H    PY+ Q    +ER++ TLK  L
Sbjct: 564 MGVPEKIKTDNGPGYCSKAFQKFLSQWKISHTTGIPYNSQGQAIVERTNRTLKTQL 619


>AL671879-1|CAI17641.2|  794|Homo sapiens zinc finger protein 452
           protein.
          Length = 794

 Score = 37.1 bits (82), Expect = 0.077
 Identities = 22/96 (22%), Positives = 41/96 (42%), Gaps = 1/96 (1%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLF-GIKHIFASPYHPQTCGALERSHSTLKEYLRSY 650
           IG P ++ +D G  FSS+V+ +L  ++  +K +       Q+  + E++    K      
Sbjct: 428 IGAPSVLQSDNGREFSSQVVSELSNIWPELKIVHGKSQTCQSQSSAEQTEDIRKRIFSWM 487

Query: 649 IVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLF 542
              N   W  +L    ++ N   H +   +P E  F
Sbjct: 488 QTNNSSHWTEFLWFIQMSQNQPYHRSMQQTPCESAF 523


>AK056369-1|BAB71166.1|  782|Homo sapiens protein ( Homo sapiens
           cDNA FLJ31807 fis, clone NT2RI2009215, moderately
           similar to ZINC FINGER PROTEIN 165. ).
          Length = 782

 Score = 37.1 bits (82), Expect = 0.077
 Identities = 22/96 (22%), Positives = 41/96 (42%), Gaps = 1/96 (1%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLF-GIKHIFASPYHPQTCGALERSHSTLKEYLRSY 650
           IG P ++ +D G  FSS+V+ +L  ++  +K +       Q+  + E++    K      
Sbjct: 428 IGAPSVLQSDNGREFSSQVVSELSNIWPELKIVHGKSQTCQSQSSAEQTEDIRKRIFSWM 487

Query: 649 IVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLF 542
              N   W  +L    ++ N   H +   +P E  F
Sbjct: 488 QTNNSSHWTEFLWFIQMSQNQPYHRSMQQTPCESAF 523


>AF298588-1|AAK11554.1|  956|Homo sapiens polymerase protein.
          Length = 956

 Score = 37.1 bits (82), Expect = 0.077
 Identities = 18/56 (32%), Positives = 30/56 (53%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYL 659
           +G+P+ I TD G  + S+  ++    + I H    PY+ Q    +ER++ TLK  L
Sbjct: 701 MGVPEKIKTDNGPGYCSKAFQKFLSQWKISHTTGIPYNSQGQAIVERTNRTLKTQL 756


>AF298587-1|AAK11553.1|  956|Homo sapiens polymerase protein.
          Length = 956

 Score = 37.1 bits (82), Expect = 0.077
 Identities = 18/56 (32%), Positives = 30/56 (53%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYL 659
           +G+P+ I TD G  + S+  ++    + I H    PY+ Q    +ER++ TLK  L
Sbjct: 701 MGVPEKIKTDNGPGYCSKAFQKFLSQWKISHTTGIPYNSQGQAIVERTNRTLKTQL 756


>AF164614-1|AAD51797.1| 1879|Homo sapiens Gag-Pro-Pol protein protein.
          Length = 1879

 Score = 37.1 bits (82), Expect = 0.077
 Identities = 18/56 (32%), Positives = 30/56 (53%)
 Frame = -1

Query: 826  IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYL 659
            +G+P+ I TD G  + S+  ++    + I H    PY+ Q    +ER++ TLK  L
Sbjct: 1624 MGVPEKIKTDNGPGYCSKAFQKFLSQWKISHTTGIPYNSQGQAIVERTNRTLKTQL 1679


>AF164613-1|AAD51796.1| 1755|Homo sapiens Gag-Pro-Pol protein protein.
          Length = 1755

 Score = 37.1 bits (82), Expect = 0.077
 Identities = 18/56 (32%), Positives = 30/56 (53%)
 Frame = -1

Query: 826  IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYL 659
            +G+P+ I TD G  + S+  ++    + I H    PY+ Q    +ER++ TLK  L
Sbjct: 1626 MGVPEKIKTDNGPGYCSKAFQKFLSQWKISHTTGIPYNSQGQAIVERTNRTLKTQL 1681


>AF164611-1|AAD51793.1| 2294|Homo sapiens Gag-Pro-Pol-Env protein
            protein.
          Length = 2294

 Score = 37.1 bits (82), Expect = 0.077
 Identities = 18/56 (32%), Positives = 30/56 (53%)
 Frame = -1

Query: 826  IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYL 659
            +G+P+ I TD G  + S+  ++    + I H    PY+ Q    +ER++ TLK  L
Sbjct: 1624 MGVPEKIKTDNGPGYCSKAFQKFLSQWKISHTTGIPYNSQGQAIVERTNRTLKTQL 1679


>AF074086-7|AAD21097.1|  956|Homo sapiens polymerase protein.
          Length = 956

 Score = 37.1 bits (82), Expect = 0.077
 Identities = 18/56 (32%), Positives = 30/56 (53%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYL 659
           +G+P+ I TD G  + S+  ++    + I H    PY+ Q    +ER++ TLK  L
Sbjct: 701 MGVPEKIKTDNGPGYCSKAFQKFLSQWKISHTTGIPYNSQGQAIVERTNRTLKTQL 756


>AF074086-3|AAF88167.1|  956|Homo sapiens polymerase protein.
          Length = 956

 Score = 37.1 bits (82), Expect = 0.077
 Identities = 18/56 (32%), Positives = 30/56 (53%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYL 659
           +G+P+ I TD G  + S+  ++    + I H    PY+ Q    +ER++ TLK  L
Sbjct: 701 MGVPEKIKTDNGPGYCSKAFQKFLSQWKISHTTGIPYNSQGQAIVERTNRTLKTQL 756


>AB067512-1|BAB67818.1| 1147|Homo sapiens KIAA1925 protein protein.
          Length = 1147

 Score = 37.1 bits (82), Expect = 0.077
 Identities = 22/96 (22%), Positives = 41/96 (42%), Gaps = 1/96 (1%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLF-GIKHIFASPYHPQTCGALERSHSTLKEYLRSY 650
           IG P ++ +D G  FSS+V+ +L  ++  +K +       Q+  + E++    K      
Sbjct: 250 IGAPSVLQSDNGREFSSQVVSELSNIWPELKIVHGKSQTCQSQSSAEQTEDIRKRIFSWM 309

Query: 649 IVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLF 542
              N   W  +L    ++ N   H +   +P E  F
Sbjct: 310 QTNNSSHWTEFLWFIQMSQNQPYHRSMQQTPCESAF 345


>BC111742-1|AAI11743.1| 1325|Homo sapiens zinc finger protein 452
           protein.
          Length = 1325

 Score = 36.7 bits (81), Expect = 0.10
 Identities = 22/96 (22%), Positives = 41/96 (42%), Gaps = 1/96 (1%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLF-GIKHIFASPYHPQTCGALERSHSTLKEYLRSY 650
           IG P ++ +D G  FSS+V+ +L  ++  +K +       Q+  + E++    K      
Sbjct: 428 IGAPSVLQSDNGREFSSQVVSELSNIWPELKIVHGKSKTCQSQSSAEQTEDIRKRIFSWM 487

Query: 649 IVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLF 542
              N   W  +L    ++ N   H +   +P E  F
Sbjct: 488 QTNNSSHWTEFLWFIQMSQNQPYHRSMQQTPCESAF 523


>AK057704-1|BAB71549.1|  120|Homo sapiens protein ( Homo sapiens
           cDNA FLJ33142 fis, clone UTERU1000192. ).
          Length = 120

 Score = 35.5 bits (78), Expect = 0.24
 Identities = 17/66 (25%), Positives = 33/66 (50%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P  I +D G  F +++++++ ++ GI     + Y PQ+    E+ + T+K  L     
Sbjct: 47  GLPLRISSDNGLTFVADLVQKIAKVLGIIWKLHAAYRPQSSRKAEQMNQTIKNSLGKVCQ 106

Query: 643 ENQHTW 626
           E    W
Sbjct: 107 ETGLKW 112


>AF480924-3|AAM81188.1|  863|Homo sapiens pol protein protein.
          Length = 863

 Score = 33.9 bits (74), Expect = 0.72
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYL 659
           G+P +I  D  + ++S       + F I HI + PY+PQ    +  +H  LK  +
Sbjct: 698 GVPHVIKMDNSSAYTSTRFAAFLKEFRISHITSIPYNPQGQAVVGHTHLYLKNLI 752


>BC078154-1|AAH78154.1|  595|Homo sapiens zinc finger protein 317
           protein.
          Length = 595

 Score = 33.5 bits (73), Expect = 0.95
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 2/66 (3%)
 Frame = -1

Query: 736 HIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHST--TGF 563
           H+       + CG   R+ STLK ++RS+  E  +  D   +   +  N N+H    TG 
Sbjct: 496 HLVKKRVECRQCGKAFRNQSTLKTHMRSHTGEKPYECDHCGKAFSIGSNLNVHRRIHTGE 555

Query: 562 SPLELL 545
            P E L
Sbjct: 556 KPYECL 561


>AF307097-1|AAL29191.1|  510|Homo sapiens ZNF317-4 protein protein.
          Length = 510

 Score = 33.5 bits (73), Expect = 0.95
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 2/66 (3%)
 Frame = -1

Query: 736 HIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHST--TGF 563
           H+       + CG   R+ STLK ++RS+  E  +  D   +   +  N N+H    TG 
Sbjct: 411 HLVKKRVECRQCGKAFRNQSTLKTHMRSHTGEKPYECDHCGKAFSIGSNLNVHRRIHTGE 470

Query: 562 SPLELL 545
            P E L
Sbjct: 471 KPYECL 476


>AF307096-1|AAL29190.1|  478|Homo sapiens ZNF317-3 protein protein.
          Length = 478

 Score = 33.5 bits (73), Expect = 0.95
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 2/66 (3%)
 Frame = -1

Query: 736 HIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHST--TGF 563
           H+       + CG   R+ STLK ++RS+  E  +  D   +   +  N N+H    TG 
Sbjct: 379 HLVKKRVECRQCGKAFRNQSTLKTHMRSHTGEKPYECDHCGKAFSIGSNLNVHRRIHTGE 438

Query: 562 SPLELL 545
            P E L
Sbjct: 439 KPYECL 444


>AF275255-1|AAL29188.1|  595|Homo sapiens ZNF317-2 protein protein.
          Length = 595

 Score = 33.5 bits (73), Expect = 0.95
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 2/66 (3%)
 Frame = -1

Query: 736 HIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHST--TGF 563
           H+       + CG   R+ STLK ++RS+  E  +  D   +   +  N N+H    TG 
Sbjct: 496 HLVKKRVECRQCGKAFRNQSTLKTHMRSHTGEKPYECDHCGKAFSIGSNLNVHRRIHTGE 555

Query: 562 SPLELL 545
            P E L
Sbjct: 556 KPYECL 561


>AF148135-1|AAL29182.1|  563|Homo sapiens ZNF317-1 protein protein.
          Length = 563

 Score = 33.5 bits (73), Expect = 0.95
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 2/66 (3%)
 Frame = -1

Query: 736 HIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHST--TGF 563
           H+       + CG   R+ STLK ++RS+  E  +  D   +   +  N N+H    TG 
Sbjct: 464 HLVKKRVECRQCGKAFRNQSTLKTHMRSHTGEKPYECDHCGKAFSIGSNLNVHRRIHTGE 523

Query: 562 SPLELL 545
            P E L
Sbjct: 524 KPYECL 529


>AB046808-1|BAB13414.1|  613|Homo sapiens KIAA1588 protein protein.
          Length = 613

 Score = 33.5 bits (73), Expect = 0.95
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 2/66 (3%)
 Frame = -1

Query: 736 HIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHST--TGF 563
           H+       + CG   R+ STLK ++RS+  E  +  D   +   +  N N+H    TG 
Sbjct: 514 HLVKKRVECRQCGKAFRNQSTLKTHMRSHTGEKPYECDHCGKAFSIGSNLNVHRRIHTGE 573

Query: 562 SPLELL 545
            P E L
Sbjct: 574 KPYECL 579


>BC093825-1|AAH93825.1| 1037|Homo sapiens caspase recruitment domain
           family, member 6 protein.
          Length = 1037

 Score = 30.3 bits (65), Expect = 8.8
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = -1

Query: 739 KHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQ 635
           +H+ A P  PQ  G LERS +   +   SY +++Q
Sbjct: 824 QHVQACPERPQMMGTLERSRAVASKIGHSYSLDSQ 858


>AF356193-1|AAK32718.1| 1037|Homo sapiens caspase recruitment domain
           protein 6 protein.
          Length = 1037

 Score = 30.3 bits (65), Expect = 8.8
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = -1

Query: 739 KHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQ 635
           +H+ A P  PQ  G LERS +   +   SY +++Q
Sbjct: 824 QHVQACPERPQMMGTLERSRAVASKIGHSYSLDSQ 858


>AB209844-1|BAD93081.1|  872|Homo sapiens caspase recruitment domain
           family, member 6 variant protein.
          Length = 872

 Score = 30.3 bits (65), Expect = 8.8
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = -1

Query: 739 KHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQ 635
           +H+ A P  PQ  G LERS +   +   SY +++Q
Sbjct: 789 QHVQACPERPQMMGTLERSRAVASKIGHSYSLDSQ 823


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 104,006,149
Number of Sequences: 237096
Number of extensions: 2192670
Number of successful extensions: 9489
Number of sequences better than 10.0: 36
Number of HSP's better than 10.0 without gapping: 8839
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9474
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 10315140830
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).