SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0037
         (740 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK126213-1|BAC86488.1|  262|Homo sapiens protein ( Homo sapiens ...    38   0.050
U02478-1|AAC50059.1| 1612|Homo sapiens AF-6 protein.                   36   0.15 
AL731868-7|CAI40830.1| 1501|Homo sapiens myeloid/lymphoid or mix...    36   0.15 
AL731868-3|CAI40826.1| 1612|Homo sapiens myeloid/lymphoid or mix...    36   0.15 
AL731868-2|CAI40825.1| 1665|Homo sapiens myeloid/lymphoid or mix...    36   0.15 
AL731868-1|CAI40824.1| 1824|Homo sapiens myeloid/lymphoid or mix...    36   0.15 
AL161973-1|CAB82312.1| 1410|Homo sapiens hypothetical protein pr...    36   0.15 
AL049698-5|CAI42816.1| 1501|Homo sapiens myeloid/lymphoid or mix...    36   0.15 
AL049698-3|CAI42814.1| 1612|Homo sapiens myeloid/lymphoid or mix...    36   0.15 
AL049698-2|CAI42813.1| 1665|Homo sapiens myeloid/lymphoid or mix...    36   0.15 
AL049698-1|CAI42812.1| 1824|Homo sapiens myeloid/lymphoid or mix...    36   0.15 
AL009178-3|CAI20902.1| 1612|Homo sapiens myeloid/lymphoid or mix...    36   0.15 
AL009178-2|CAI20901.1| 1665|Homo sapiens myeloid/lymphoid or mix...    36   0.15 
AL009178-1|CAI20900.1| 1824|Homo sapiens myeloid/lymphoid or mix...    36   0.15 
AB209420-1|BAD92657.1| 1639|Homo sapiens Afadin variant protein.       36   0.15 
AB011399-3|BAA32485.1| 1611|Homo sapiens AF-6 protein.                 36   0.15 
AB011399-2|BAA32484.1| 1816|Homo sapiens AF-6 protein.                 36   0.15 
AB011399-1|BAA32483.1| 1743|Homo sapiens AF-6 protein.                 36   0.15 
AK125484-1|BAC86178.1|  148|Homo sapiens protein ( Homo sapiens ...    35   0.35 
AK124803-1|BAC85953.1|  180|Homo sapiens protein ( Homo sapiens ...    34   0.47 
AK128797-1|BAC87611.1|  201|Homo sapiens protein ( Homo sapiens ...    34   0.62 
AK128416-1|BAC87430.1|  303|Homo sapiens protein ( Homo sapiens ...    32   1.9  
BC008965-1|AAH08965.2|  837|Homo sapiens BAZ2A protein protein.        32   2.5  
AB065580-1|BAC05810.1|  346|Homo sapiens seven transmembrane hel...    32   2.5  
AB002312-1|BAA20773.2| 1899|Homo sapiens KIAA0314 protein protein.     32   2.5  
AK124805-1|BAC85954.1|  189|Homo sapiens protein ( Homo sapiens ...    31   3.3  
BC016950-1|AAH16950.1|   75|Homo sapiens KLHL23 protein protein.       31   4.3  
AK128694-1|BAC87575.1|  291|Homo sapiens protein ( Homo sapiens ...    30   7.6  
AJ404888-1|CAC15060.1|  411|Homo sapiens homeodomain transcripti...    30   7.6  

>AK126213-1|BAC86488.1|  262|Homo sapiens protein ( Homo sapiens
           cDNA FLJ44225 fis, clone THYMU3006168. ).
          Length = 262

 Score = 37.5 bits (83), Expect = 0.050
 Identities = 18/56 (32%), Positives = 34/56 (60%), Gaps = 1/56 (1%)
 Frame = +3

Query: 573 CIFRLSQVCLV*CLCYSLRGNSAYIAMYTGMYVCL-SYVYRHVCMSLVCISVCMYV 737
           CIF  + VC+  C C  +     YI +Y GM++C+ SY++R+  +  + I +C+++
Sbjct: 164 CIFIYTYVCMCVCSCIHVY-TCVYIHIYIGMHICVYSYMHRYTYV-YIHIYICIHM 217



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 15/50 (30%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = +2

Query: 605 LMSLLFSTRKLCLYR--YVYRYVCM---SLVCISACMYVSRMYIGMYVCL 739
           + + ++S  ++C++   ++Y YVCM   S + +  C+Y+  +YIGM++C+
Sbjct: 149 MRAYVYSYTRICIHICIFIYTYVCMCVCSCIHVYTCVYI-HIYIGMHICV 197


>U02478-1|AAC50059.1| 1612|Homo sapiens AF-6 protein.
          Length = 1612

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +3

Query: 168  VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVY 266
            +P GL EF+ PL + G C L     + G WT+Y
Sbjct: 932  IPNGLQEFLDPLCQRGFCRLIPHTRSPGTWTIY 964


>AL731868-7|CAI40830.1| 1501|Homo sapiens myeloid/lymphoid or
           mixed-lineage leukemia (trithorax homolog, Drosophila);
           tra protein.
          Length = 1501

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +3

Query: 168 VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVY 266
           +P GL EF+ PL + G C L     + G WT+Y
Sbjct: 614 IPNGLQEFLDPLCQRGFCRLIPHTRSPGTWTIY 646


>AL731868-3|CAI40826.1| 1612|Homo sapiens myeloid/lymphoid or
            mixed-lineage leukemia (trithorax homolog, Drosophila);
            tra protein.
          Length = 1612

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +3

Query: 168  VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVY 266
            +P GL EF+ PL + G C L     + G WT+Y
Sbjct: 932  IPNGLQEFLDPLCQRGFCRLIPHTRSPGTWTIY 964


>AL731868-2|CAI40825.1| 1665|Homo sapiens myeloid/lymphoid or
            mixed-lineage leukemia (trithorax homolog, Drosophila);
            tra protein.
          Length = 1665

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +3

Query: 168  VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVY 266
            +P GL EF+ PL + G C L     + G WT+Y
Sbjct: 948  IPNGLQEFLDPLCQRGFCRLIPHTRSPGTWTIY 980


>AL731868-1|CAI40824.1| 1824|Homo sapiens myeloid/lymphoid or
            mixed-lineage leukemia (trithorax homolog, Drosophila);
            tra protein.
          Length = 1824

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +3

Query: 168  VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVY 266
            +P GL EF+ PL + G C L     + G WT+Y
Sbjct: 948  IPNGLQEFLDPLCQRGFCRLIPHTRSPGTWTIY 980


>AL161973-1|CAB82312.1| 1410|Homo sapiens hypothetical protein
           protein.
          Length = 1410

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +3

Query: 168 VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVY 266
           +P GL EF+ PL + G C L     + G WT+Y
Sbjct: 614 IPNGLQEFLDPLCQRGFCRLIPHTRSPGTWTIY 646


>AL049698-5|CAI42816.1| 1501|Homo sapiens myeloid/lymphoid or
           mixed-lineage leukemia (trithorax homolog, Drosophila);
           tra protein.
          Length = 1501

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +3

Query: 168 VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVY 266
           +P GL EF+ PL + G C L     + G WT+Y
Sbjct: 614 IPNGLQEFLDPLCQRGFCRLIPHTRSPGTWTIY 646


>AL049698-3|CAI42814.1| 1612|Homo sapiens myeloid/lymphoid or
            mixed-lineage leukemia (trithorax homolog, Drosophila);
            tra protein.
          Length = 1612

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +3

Query: 168  VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVY 266
            +P GL EF+ PL + G C L     + G WT+Y
Sbjct: 932  IPNGLQEFLDPLCQRGFCRLIPHTRSPGTWTIY 964


>AL049698-2|CAI42813.1| 1665|Homo sapiens myeloid/lymphoid or
            mixed-lineage leukemia (trithorax homolog, Drosophila);
            tra protein.
          Length = 1665

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +3

Query: 168  VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVY 266
            +P GL EF+ PL + G C L     + G WT+Y
Sbjct: 948  IPNGLQEFLDPLCQRGFCRLIPHTRSPGTWTIY 980


>AL049698-1|CAI42812.1| 1824|Homo sapiens myeloid/lymphoid or
            mixed-lineage leukemia (trithorax homolog, Drosophila);
            tra protein.
          Length = 1824

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +3

Query: 168  VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVY 266
            +P GL EF+ PL + G C L     + G WT+Y
Sbjct: 948  IPNGLQEFLDPLCQRGFCRLIPHTRSPGTWTIY 980


>AL009178-3|CAI20902.1| 1612|Homo sapiens myeloid/lymphoid or
            mixed-lineage leukemia (trithorax homolog, Drosophila);
            tra protein.
          Length = 1612

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +3

Query: 168  VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVY 266
            +P GL EF+ PL + G C L     + G WT+Y
Sbjct: 932  IPNGLQEFLDPLCQRGFCRLIPHTRSPGTWTIY 964


>AL009178-2|CAI20901.1| 1665|Homo sapiens myeloid/lymphoid or
            mixed-lineage leukemia (trithorax homolog, Drosophila);
            tra protein.
          Length = 1665

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +3

Query: 168  VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVY 266
            +P GL EF+ PL + G C L     + G WT+Y
Sbjct: 948  IPNGLQEFLDPLCQRGFCRLIPHTRSPGTWTIY 980


>AL009178-1|CAI20900.1| 1824|Homo sapiens myeloid/lymphoid or
            mixed-lineage leukemia (trithorax homolog, Drosophila);
            tra protein.
          Length = 1824

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +3

Query: 168  VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVY 266
            +P GL EF+ PL + G C L     + G WT+Y
Sbjct: 948  IPNGLQEFLDPLCQRGFCRLIPHTRSPGTWTIY 980


>AB209420-1|BAD92657.1| 1639|Homo sapiens Afadin variant protein.
          Length = 1639

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +3

Query: 168  VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVY 266
            +P GL EF+ PL + G C L     + G WT+Y
Sbjct: 936  IPNGLQEFLDPLCQRGFCRLIPHTRSPGTWTIY 968


>AB011399-3|BAA32485.1| 1611|Homo sapiens AF-6 protein.
          Length = 1611

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +3

Query: 168  VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVY 266
            +P GL EF+ PL + G C L     + G WT+Y
Sbjct: 932  IPNGLQEFLDPLCQRGFCRLIPHTRSPGTWTIY 964


>AB011399-2|BAA32484.1| 1816|Homo sapiens AF-6 protein.
          Length = 1816

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +3

Query: 168  VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVY 266
            +P GL EF+ PL + G C L     + G WT+Y
Sbjct: 932  IPNGLQEFLDPLCQRGFCRLIPHTRSPGTWTIY 964


>AB011399-1|BAA32483.1| 1743|Homo sapiens AF-6 protein.
          Length = 1743

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +3

Query: 168  VPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVY 266
            +P GL EF+ PL + G C L     + G WT+Y
Sbjct: 932  IPNGLQEFLDPLCQRGFCRLIPHTRSPGTWTIY 964


>AK125484-1|BAC86178.1|  148|Homo sapiens protein ( Homo sapiens
           cDNA FLJ43495 fis, clone PEBLM2000338. ).
          Length = 148

 Score = 34.7 bits (76), Expect = 0.35
 Identities = 16/47 (34%), Positives = 28/47 (59%)
 Frame = +3

Query: 597 CLV*CLCYSLRGNSAYIAMYTGMYVCLSYVYRHVCMSLVCISVCMYV 737
           C+  C+   +     YI +Y  +YVC+ Y++  VC+ ++ I VC+YV
Sbjct: 12  CIYVCIYIHVFVYVCYIYLY--VYVCVIYIHVCVCVCVLYIHVCVYV 56



 Score = 31.9 bits (69), Expect = 2.5
 Identities = 11/32 (34%), Positives = 21/32 (65%)
 Frame = +2

Query: 644 YRYVYRYVCMSLVCISACMYVSRMYIGMYVCL 739
           Y Y+Y YVC+  + +  C+ V  +++ +YVC+
Sbjct: 27  YIYLYVYVCVIYIHVCVCVCVLYIHVCVYVCV 58


>AK124803-1|BAC85953.1|  180|Homo sapiens protein ( Homo sapiens
           cDNA FLJ42813 fis, clone BRCAN2012355. ).
          Length = 180

 Score = 34.3 bits (75), Expect = 0.47
 Identities = 13/36 (36%), Positives = 24/36 (66%), Gaps = 1/36 (2%)
 Frame = +2

Query: 635 LCLYRYVYRYVCMSL-VCISACMYVSRMYIGMYVCL 739
           +C+Y Y+Y Y+   + +C+   MYVS +Y+ +Y C+
Sbjct: 93  MCVYTYIYVYIYTHIHICVHINMYVS-IYVYIYTCI 127



 Score = 31.1 bits (67), Expect = 4.3
 Identities = 16/35 (45%), Positives = 23/35 (65%), Gaps = 3/35 (8%)
 Frame = +3

Query: 642 YIAMYTGMYVCL-SYV--YRHVCMSLVCISVCMYV 737
           YI MYT +YVC  +Y+  Y H+C+    I VC+Y+
Sbjct: 130 YIYMYT-LYVCTYTYMCTYIHICIHTSIIYVCVYI 163


>AK128797-1|BAC87611.1|  201|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45585 fis, clone BRTHA3013882. ).
          Length = 201

 Score = 33.9 bits (74), Expect = 0.62
 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
 Frame = +3

Query: 573 CIFRLSQVCLV*CLCYSLRGNSAYIAMYTGMYVCLSYVYRHVCMSL-VCISVCMYV 737
           C+     VC+  CLC  +   S  + +   + +C+  V   +C+ L VC+SVC+ V
Sbjct: 28  CVCLCVCVCVCVCLCLCVLSVSVCLCVCVSVCLCVCLVSVCLCVCLCVCVSVCLCV 83


>AK128416-1|BAC87430.1|  303|Homo sapiens protein ( Homo sapiens
           cDNA FLJ46559 fis, clone THYMU3040126. ).
          Length = 303

 Score = 32.3 bits (70), Expect = 1.9
 Identities = 15/46 (32%), Positives = 28/46 (60%)
 Frame = +2

Query: 602 CLMSLLFSTRKLCLYRYVYRYVCMSLVCISACMYVSRMYIGMYVCL 739
           C+ + ++    +C+Y  +Y Y CM   C+  C++ + +YI MYVC+
Sbjct: 162 CVHTHIYIHMCVCVYTRIYTYTCM---CV--CVH-THIYIHMYVCV 201



 Score = 30.7 bits (66), Expect = 5.7
 Identities = 15/46 (32%), Positives = 26/46 (56%)
 Frame = +2

Query: 602 CLMSLLFSTRKLCLYRYVYRYVCMSLVCISACMYVSRMYIGMYVCL 739
           C  + + +   +C+Y  +Y Y CM   C+  C+Y +R+Y   YVC+
Sbjct: 202 CTHAYIHTHVYVCVYTRIYTYTCM---CV--CVY-TRIYTYTYVCV 241


>BC008965-1|AAH08965.2|  837|Homo sapiens BAZ2A protein protein.
          Length = 837

 Score = 31.9 bits (69), Expect = 2.5
 Identities = 17/48 (35%), Positives = 21/48 (43%)
 Frame = -2

Query: 217 SPARCRGATNSASPGGTAADHLRAEPVPGDQQSGPQPTALLDSYLQNP 74
           SPAR RG      PG     HL++ PV G     PQ     ++ L  P
Sbjct: 120 SPARARGRPRKTKPGSMQPRHLKS-PVRGQDSEQPQAQLQPEAQLHAP 166


>AB065580-1|BAC05810.1|  346|Homo sapiens seven transmembrane helix
           receptor protein.
          Length = 346

 Score = 31.9 bits (69), Expect = 2.5
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 4/60 (6%)
 Frame = +3

Query: 573 CIFRLSQVCLV*CLCYSLRGNSAYIAMYTGMYVCLSY-VYRHVCMSL---VCISVCMYVS 740
           C+     VC+  C+C S+      + +   + VC+S  V   VC+ L   VC+SVC+YVS
Sbjct: 30  CVCICVSVCVCICVCVSV---FVCVCICVCVCVCVSMCVSISVCVYLCLCVCVSVCVYVS 86


>AB002312-1|BAA20773.2| 1899|Homo sapiens KIAA0314 protein protein.
          Length = 1899

 Score = 31.9 bits (69), Expect = 2.5
 Identities = 17/48 (35%), Positives = 21/48 (43%)
 Frame = -2

Query: 217  SPARCRGATNSASPGGTAADHLRAEPVPGDQQSGPQPTALLDSYLQNP 74
            SPAR RG      PG     HL++ PV G     PQ     ++ L  P
Sbjct: 1178 SPARARGRPRKTKPGSMQPRHLKS-PVRGQDSEQPQAQLQPEAQLHAP 1224


>AK124805-1|BAC85954.1|  189|Homo sapiens protein ( Homo sapiens
           cDNA FLJ42815 fis, clone BRCAN2014143. ).
          Length = 189

 Score = 31.5 bits (68), Expect = 3.3
 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
 Frame = +2

Query: 635 LCLYRYVYRYVCMSL-VCISACMYVSRMYIGMYVC 736
           +C+Y +VY Y+CM + +    CMYV   +I  Y+C
Sbjct: 23  ICIYLHVYTYICMYIHIYPYLCMYV---HIYPYIC 54



 Score = 31.5 bits (68), Expect = 3.3
 Identities = 15/43 (34%), Positives = 27/43 (62%), Gaps = 1/43 (2%)
 Frame = +1

Query: 610 VFAILYEETLLISLCIPVCMYVSRMYIGMYVC-LSYVYRYVCM 735
           V+A +Y  T +  +C+ VC+YV  ++  M VC  +Y + +VC+
Sbjct: 67  VYAYMYVRTYIHIMCMHVCVYVC-VHACMCVCTCAYTHVFVCV 108


>BC016950-1|AAH16950.1|   75|Homo sapiens KLHL23 protein protein.
          Length = 75

 Score = 31.1 bits (67), Expect = 4.3
 Identities = 13/34 (38%), Positives = 23/34 (67%), Gaps = 1/34 (2%)
 Frame = +2

Query: 641 LYRYVYRYVCM-SLVCISACMYVSRMYIGMYVCL 739
           +Y YVY YVCM + +CI  C+ +  + + +Y+C+
Sbjct: 23  VYIYVYTYVCMYTYMCIHTCVCI-HICVYIYMCV 55


>AK128694-1|BAC87575.1|  291|Homo sapiens protein ( Homo sapiens
           cDNA FLJ46861 fis, clone UTERU3011092. ).
          Length = 291

 Score = 30.3 bits (65), Expect = 7.6
 Identities = 16/57 (28%), Positives = 33/57 (57%), Gaps = 3/57 (5%)
 Frame = +3

Query: 573 CIFRLSQVCLV*CL-CYSLRGNSAYIAMYTGMYVCL-SYVYRHVCMSL-VCISVCMY 734
           C++    +C+  C+  Y       YI +Y G+++C+ SY++R+  + + +CI V +Y
Sbjct: 207 CVYIHIYICIHVCVYSYIHMYTYVYIHVYIGIHMCVYSYMHRYTYVYIHICICVHIY 263


>AJ404888-1|CAC15060.1|  411|Homo sapiens homeodomain transcription
           factor ALX4 protein.
          Length = 411

 Score = 30.3 bits (65), Expect = 7.6
 Identities = 19/51 (37%), Positives = 21/51 (41%), Gaps = 1/51 (1%)
 Frame = -2

Query: 217 SPARCRGATNSASPG-GTAADHLRAEPVPGDQQSGPQPTALLDSYLQNPTC 68
           S A  RG+ N   P   T       +P P  QQ  PQP A    YLQ   C
Sbjct: 79  SGAGARGSFNKFQPQPSTPQPQPSPQPQPQQQQPQPQPPAQPHLYLQRGAC 129


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 106,142,093
Number of Sequences: 237096
Number of extensions: 2272627
Number of successful extensions: 7080
Number of sequences better than 10.0: 29
Number of HSP's better than 10.0 without gapping: 6466
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7021
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8847149012
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).