SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0036
         (830 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X63745-1|CAA45277.1|  212|Homo sapiens KDEL receptor protein.          31   3.9  
BC071982-1|AAH71982.1|  186|Homo sapiens KDELR2 protein protein.       31   3.9  
BC012994-1|AAH12994.1|  212|Homo sapiens KDEL (Lys-Asp-Glu-Leu) ...    31   3.9  
BC008081-1|AAH08081.1|  212|Homo sapiens KDEL (Lys-Asp-Glu-Leu) ...    31   3.9  
AC072052-1|AAS02002.1|  212|Homo sapiens unknown protein.              31   3.9  

>X63745-1|CAA45277.1|  212|Homo sapiens KDEL receptor protein.
          Length = 212

 Score = 31.5 bits (68), Expect = 3.9
 Identities = 19/49 (38%), Positives = 25/49 (51%)
 Frame = -2

Query: 247 LKV*KNMKMLGII*KQTILFFL*CPPRRTDSFCIFLSLFYTKV*VFYLS 101
           LK+ K     GI  K  +LF L    R  D F  F+SL+ T + V YL+
Sbjct: 21  LKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKVIYLA 69


>BC071982-1|AAH71982.1|  186|Homo sapiens KDELR2 protein protein.
          Length = 186

 Score = 31.5 bits (68), Expect = 3.9
 Identities = 19/49 (38%), Positives = 25/49 (51%)
 Frame = -2

Query: 247 LKV*KNMKMLGII*KQTILFFL*CPPRRTDSFCIFLSLFYTKV*VFYLS 101
           LK+ K     GI  K  +LF L    R  D F  F+SL+ T + V YL+
Sbjct: 21  LKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKVIYLA 69


>BC012994-1|AAH12994.1|  212|Homo sapiens KDEL (Lys-Asp-Glu-Leu)
           endoplasmic reticulum protein retention receptor 2
           protein.
          Length = 212

 Score = 31.5 bits (68), Expect = 3.9
 Identities = 19/49 (38%), Positives = 25/49 (51%)
 Frame = -2

Query: 247 LKV*KNMKMLGII*KQTILFFL*CPPRRTDSFCIFLSLFYTKV*VFYLS 101
           LK+ K     GI  K  +LF L    R  D F  F+SL+ T + V YL+
Sbjct: 21  LKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKVIYLA 69


>BC008081-1|AAH08081.1|  212|Homo sapiens KDEL (Lys-Asp-Glu-Leu)
           endoplasmic reticulum protein retention receptor 2
           protein.
          Length = 212

 Score = 31.5 bits (68), Expect = 3.9
 Identities = 19/49 (38%), Positives = 25/49 (51%)
 Frame = -2

Query: 247 LKV*KNMKMLGII*KQTILFFL*CPPRRTDSFCIFLSLFYTKV*VFYLS 101
           LK+ K     GI  K  +LF L    R  D F  F+SL+ T + V YL+
Sbjct: 21  LKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKVIYLA 69


>AC072052-1|AAS02002.1|  212|Homo sapiens unknown protein.
          Length = 212

 Score = 31.5 bits (68), Expect = 3.9
 Identities = 19/49 (38%), Positives = 25/49 (51%)
 Frame = -2

Query: 247 LKV*KNMKMLGII*KQTILFFL*CPPRRTDSFCIFLSLFYTKV*VFYLS 101
           LK+ K     GI  K  +LF L    R  D F  F+SL+ T + V YL+
Sbjct: 21  LKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKVIYLA 69


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 111,429,427
Number of Sequences: 237096
Number of extensions: 2241535
Number of successful extensions: 7722
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 7632
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7722
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 10426655866
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).