SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0034
         (840 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK131480-1|BAD18625.1|  325|Homo sapiens protein ( Homo sapiens ...    41   0.006
AK125605-1|BAC86216.1|  358|Homo sapiens protein ( Homo sapiens ...    36   0.18 
AK094020-1|BAC04270.1|  145|Homo sapiens protein ( Homo sapiens ...    35   0.32 
L09190-1|AAA65582.1| 1898|Homo sapiens trichohyalin protein.           33   0.97 
BC117238-1|AAI17239.1|  676|Homo sapiens LIM domains containing ...    31   3.9  
BC117236-1|AAI17237.1|  676|Homo sapiens LIM domains containing ...    31   3.9  
AJ312686-1|CAC35917.1|  503|Homo sapiens LIM domains containing ...    31   3.9  
AJ132408-1|CAB63652.1|  676|Homo sapiens LIM domains containing ...    31   3.9  
BC025959-1|AAH25959.1|  492|Homo sapiens dynein, cytoplasmic 1, ...    31   6.9  
AF035812-1|AAB88513.1|  492|Homo sapiens dynein light intermedia...    31   6.9  
BC052963-1|AAH52963.1| 1394|Homo sapiens SRCAP protein protein.        30   9.1  
AL589986-1|CAH70024.1| 1943|Homo sapiens trichohyalin protein.         30   9.1  
AF143946-1|AAD39760.1| 2971|Homo sapiens transcriptional activat...    30   9.1  
AB002307-1|BAA20768.2| 3053|Homo sapiens KIAA0309 protein.             30   9.1  

>AK131480-1|BAD18625.1|  325|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16652 fis, clone TESTI4036767. ).
          Length = 325

 Score = 40.7 bits (91), Expect = 0.006
 Identities = 49/166 (29%), Positives = 62/166 (37%), Gaps = 4/166 (2%)
 Frame = -3

Query: 553 RGPQGHRRRLLPERIPTHTRPTDN*AHRQTLQSSSQTGC*RWRVQRPPDLGRRKRLHQPP 374
           R PQ       P+R PTH  P  +  HR   +  +     R    R P   +R   H+PP
Sbjct: 27  RAPQRDPTHRAPQRDPTHRAPQRDPTHRAPQRDPTHRAPQRDPTHRAP---QRDPTHRPP 83

Query: 373 CQLATHLSLGRQQRDIQDTEHRI--RDVLETGRERGQLRR--QEDLGIEWFQ*EETHLVF 206
            +  TH +  R      D  HR   RD      +RG   R  Q        Q + TH   
Sbjct: 84  QRDPTHRAPQR------DPTHRAPQRDPTHRAPQRGPRHRAPQRSPRHRAPQRDPTHRA- 136

Query: 205 IPGKGGRPTAVPHREPGVPAGTEAGRERGLIRGPPCVGEQRDSRRQ 68
            P +G R  A P R+P   A     R R   RGP     QR  R +
Sbjct: 137 -PQRGPRHRA-PQRDPTHRAPQRGPRHRAPQRGPTHRAPQRGPRHR 180



 Score = 33.1 bits (72), Expect = 1.3
 Identities = 49/180 (27%), Positives = 64/180 (35%), Gaps = 6/180 (3%)
 Frame = -3

Query: 583 HHVVRVQAVARGPQGHRRRLLPERIPTHTRPTDN*AHRQTLQSSSQTGC*RWRVQRPPDL 404
           H   +     R PQ       P+R PTH  P  +  HR   +  +     R    R P  
Sbjct: 35  HRAPQRDPTHRAPQRDPTHRAPQRDPTHRAPQRDPTHRAPQRDPTHRPPQRDPTHRAP-- 92

Query: 403 GRRKRLHQPPCQLATHLSLGRQQR---DIQDTEHRI--RDVLETGRERGQLRRQEDLGIE 239
            +R   H+ P +  TH +  R  R     +   HR   RD      +RG   R       
Sbjct: 93  -QRDPTHRAPQRDPTHRAPQRGPRHRAPQRSPRHRAPQRDPTHRAPQRGPRHRAP----- 146

Query: 238 WFQ*EETHLVFIPGKGGRPTAVPHREPGVPAGTEAGRERGLIRGPPCVGEQR-DSRRQPR 62
             Q + TH    P +G R  A P R P   A     R R   RGP     QR  + R P+
Sbjct: 147 --QRDPTHRA--PQRGPRHRA-PQRGPTHRAPQRGPRHRAPQRGPRHRAPQRGPTHRAPQ 201


>AK125605-1|BAC86216.1|  358|Homo sapiens protein ( Homo sapiens
           cDNA FLJ43617 fis, clone SPLEN2016863. ).
          Length = 358

 Score = 35.9 bits (79), Expect = 0.18
 Identities = 32/118 (27%), Positives = 47/118 (39%), Gaps = 2/118 (1%)
 Frame = -3

Query: 454 SSQTGC*RWRVQRPPDLGRRKRLHQPPCQLATHLSLGRQQRDIQDTEHRIRDVLETGRER 275
           +++TG   W VQR P   R  R H+  C+   H +       +Q +  R RD    G   
Sbjct: 223 AAETGV-LWAVQRSPPRSRDGRPHRQ-CRGHHHTAETGVLWAVQRSPPRSRDRRPVGSAE 280

Query: 274 GQLRRQEDLGIEWFQ*EETHLVFIPGKGGRPTAVPHREPGVPAG--TEAGRERGLIRG 107
                Q  LG+ W +     + F P K  +P+     +   P     EA   RGL +G
Sbjct: 281 VTTLSQTVLGLPWVEHRMKTMCFEPWKDNQPSQSQSLKQAAPRAQLQEAASSRGLQQG 338


>AK094020-1|BAC04270.1|  145|Homo sapiens protein ( Homo sapiens
           cDNA FLJ36701 fis, clone UTERU2009147. ).
          Length = 145

 Score = 35.1 bits (77), Expect = 0.32
 Identities = 21/49 (42%), Positives = 25/49 (51%)
 Frame = -3

Query: 184 PTAVPHREPGVPAGTEAGRERGLIRGPPCVGEQRDSRRQPRVLRLHNPA 38
           P   PH   G PA TEAGR   L+R  P VG +  + + PR L    PA
Sbjct: 39  PCWAPHSPCGSPAATEAGR---LMRRLPSVGGRMTAPKTPRFLTRRPPA 84


>L09190-1|AAA65582.1| 1898|Homo sapiens trichohyalin protein.
          Length = 1898

 Score = 33.5 bits (73), Expect = 0.97
 Identities = 21/87 (24%), Positives = 41/87 (47%), Gaps = 1/87 (1%)
 Frame = -3

Query: 478  AHRQTLQSSSQTG-C*RWRVQRPPDLGRRKRLHQPPCQLATHLSLGRQQRDIQDTEHRIR 302
            AHRQ  +   +     +W+ +   + GR++   +PP +      L  ++R  Q  E R  
Sbjct: 772  AHRQQQEEEQRRDFTWQWQAEEKSERGRQRLSARPPLREQRERQLRAEER--QQREQRFL 829

Query: 301  DVLETGRERGQLRRQEDLGIEWFQ*EE 221
               E   +RG+ RR+ +  +++ + EE
Sbjct: 830  PEEEEKEQRGRQRREREKELQFLEEEE 856


>BC117238-1|AAI17239.1|  676|Homo sapiens LIM domains containing 1
           protein.
          Length = 676

 Score = 31.5 bits (68), Expect = 3.9
 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 1/36 (2%)
 Frame = +3

Query: 99  QGGPRMS-PRSRPASVPAGTPGSR*GTAVGLPPLPG 203
           Q GP+     S P+S PAG  GS+ G   GL P PG
Sbjct: 338 QDGPKSYLSSSAPSSSPAGLDGSQQGAVPGLGPKPG 373


>BC117236-1|AAI17237.1|  676|Homo sapiens LIM domains containing 1
           protein.
          Length = 676

 Score = 31.5 bits (68), Expect = 3.9
 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 1/36 (2%)
 Frame = +3

Query: 99  QGGPRMS-PRSRPASVPAGTPGSR*GTAVGLPPLPG 203
           Q GP+     S P+S PAG  GS+ G   GL P PG
Sbjct: 338 QDGPKSYLSSSAPSSSPAGLDGSQQGAVPGLGPKPG 373


>AJ312686-1|CAC35917.1|  503|Homo sapiens LIM domains containing 1
           protein.
          Length = 503

 Score = 31.5 bits (68), Expect = 3.9
 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 1/36 (2%)
 Frame = +3

Query: 99  QGGPRMS-PRSRPASVPAGTPGSR*GTAVGLPPLPG 203
           Q GP+     S P+S PAG  GS+ G   GL P PG
Sbjct: 338 QDGPKSYLSSSAPSSSPAGLDGSQQGAVPGLGPKPG 373


>AJ132408-1|CAB63652.1|  676|Homo sapiens LIM domains containing
           protein 1 protein.
          Length = 676

 Score = 31.5 bits (68), Expect = 3.9
 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 1/36 (2%)
 Frame = +3

Query: 99  QGGPRMS-PRSRPASVPAGTPGSR*GTAVGLPPLPG 203
           Q GP+     S P+S PAG  GS+ G   GL P PG
Sbjct: 338 QDGPKSYLSSSAPSSSPAGLDGSQQGAVPGLGPKPG 373


>BC025959-1|AAH25959.1|  492|Homo sapiens dynein, cytoplasmic 1,
           light intermediate chain 2 protein.
          Length = 492

 Score = 30.7 bits (66), Expect = 6.9
 Identities = 19/45 (42%), Positives = 23/45 (51%)
 Frame = +3

Query: 90  SPTQGGPRMSPRSRPASVPAGTPGSR*GTAVGLPPLPGIKTRCVS 224
           SP +G P  SPR++    PA  P S  GT+V  P  P IK    S
Sbjct: 383 SPARG-PSGSPRTQGRGGPASVPSSSPGTSVKKPD-PNIKNNAAS 425


>AF035812-1|AAB88513.1|  492|Homo sapiens dynein light intermediate
           chain 2 protein.
          Length = 492

 Score = 30.7 bits (66), Expect = 6.9
 Identities = 19/45 (42%), Positives = 23/45 (51%)
 Frame = +3

Query: 90  SPTQGGPRMSPRSRPASVPAGTPGSR*GTAVGLPPLPGIKTRCVS 224
           SP +G P  SPR++    PA  P S  GT+V  P  P IK    S
Sbjct: 383 SPARG-PSGSPRTQGRGGPASVPSSSPGTSVKKPD-PNIKNNAAS 425


>BC052963-1|AAH52963.1| 1394|Homo sapiens SRCAP protein protein.
          Length = 1394

 Score = 30.3 bits (65), Expect = 9.1
 Identities = 19/49 (38%), Positives = 24/49 (48%), Gaps = 3/49 (6%)
 Frame = +3

Query: 21  KGVTATAGL*SRSTRGCRRLSRCSPTQGG-PRMSPRSRP--ASVPAGTP 158
           +G   T  + +  TR      RCSP +   PR +PR RP  AS PA  P
Sbjct: 571 QGANHTPVISAHQTRSTTTPPRCSPARERVPRPAPRPRPTPASAPAAIP 619


>AL589986-1|CAH70024.1| 1943|Homo sapiens trichohyalin protein.
          Length = 1943

 Score = 30.3 bits (65), Expect = 9.1
 Identities = 20/87 (22%), Positives = 40/87 (45%), Gaps = 1/87 (1%)
 Frame = -3

Query: 478  AHRQTLQSSSQTG-C*RWRVQRPPDLGRRKRLHQPPCQLATHLSLGRQQRDIQDTEHRIR 302
            AHRQ  +   +     +W+ +   + GR++   +PP +      L  ++R  Q  E R  
Sbjct: 754  AHRQQQEEEQRRDFTWQWQAEEKSERGRQRLSARPPLREQRERQLRAEER--QQREQRFL 811

Query: 301  DVLETGRERGQLRRQEDLGIEWFQ*EE 221
               E   +R + RR+ +  +++ + EE
Sbjct: 812  PEEEEKEQRRRQRREREKELQFLEEEE 838


>AF143946-1|AAD39760.1| 2971|Homo sapiens transcriptional activator
            SRCAP protein.
          Length = 2971

 Score = 30.3 bits (65), Expect = 9.1
 Identities = 19/49 (38%), Positives = 24/49 (48%), Gaps = 3/49 (6%)
 Frame = +3

Query: 21   KGVTATAGL*SRSTRGCRRLSRCSPTQGG-PRMSPRSRP--ASVPAGTP 158
            +G   T  + +  TR      RCSP +   PR +PR RP  AS PA  P
Sbjct: 2148 QGANHTPVISAHQTRSTTTPPRCSPARERVPRPAPRPRPTPASAPAAIP 2196


>AB002307-1|BAA20768.2| 3053|Homo sapiens KIAA0309 protein.
          Length = 3053

 Score = 30.3 bits (65), Expect = 9.1
 Identities = 19/49 (38%), Positives = 24/49 (48%), Gaps = 3/49 (6%)
 Frame = +3

Query: 21   KGVTATAGL*SRSTRGCRRLSRCSPTQGG-PRMSPRSRP--ASVPAGTP 158
            +G   T  + +  TR      RCSP +   PR +PR RP  AS PA  P
Sbjct: 2230 QGANHTPVISAHQTRSTTTPPRCSPARERVPRPAPRPRPTPASAPAAIP 2278


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 118,126,476
Number of Sequences: 237096
Number of extensions: 2600809
Number of successful extensions: 11058
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 8987
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11017
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 10593928420
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).