SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0033
         (887 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Y00472-1|CAA68533.1|  222|Homo sapiens protein ( Human mRNA for ...   310   6e-84
BT006967-1|AAP35613.1|  222|Homo sapiens superoxide dismutase 2,...   309   1e-83
BC012423-1|AAH12423.1|  222|Homo sapiens superoxide dismutase 2,...   309   1e-83
AY267901-1|AAP03428.1|  222|Homo sapiens superoxide dismutase 2,...   309   1e-83
AL135914-1|CAI21845.1|  222|Homo sapiens superoxide dismutase 2,...   309   1e-83
AY280721-1|AAP34410.1|  213|Homo sapiens manganese-containing su...   308   1e-83
X59445-1|CAA42066.1|  222|Homo sapiens manganese superoxide dism...   308   2e-83
X15132-1|CAA33228.1|  222|Homo sapiens protein ( Human mRNA for ...   308   2e-83
X07834-1|CAA30687.1|  222|Homo sapiens protein ( Human mRNA for ...   307   4e-83
Y00985-1|CAA68791.1|  222|Homo sapiens protein ( Human mRNA for ...   306   6e-83
X14322-1|CAA32502.1|  222|Homo sapiens Manganese superoxide dism...   306   6e-83
M36693-1|AAA36622.1|  222|Homo sapiens protein ( Human manganese...   306   6e-83
AY280719-1|AAP34408.1|  210|Homo sapiens manganese-containing su...   303   7e-82
AY280718-1|AAP34407.1|  213|Homo sapiens manganese-containing su...   303   7e-82
DQ003134-1|AAY21807.1|  212|Homo sapiens manganese-containing su...   302   9e-82
AY280720-1|AAP34409.1|  209|Homo sapiens manganese-containing su...   301   3e-81
AL135914-2|CAI21846.1|  161|Homo sapiens superoxide dismutase 2,...    92   3e-18
BC016934-1|AAH16934.1|  140|Homo sapiens SOD2 protein protein.         91   4e-18
L34157-1|AAA83933.1|   75|Homo sapiens manganese superoxide dism...    89   2e-17
D83493-1|BAA18955.1|   38|Homo sapiens MnSOD precursor protein.        35   0.45 
U02619-1|AAA17985.1| 2109|Homo sapiens TFIIIC Box B-binding subu...    31   5.6  
M81695-1|AAA59180.1| 1163|Homo sapiens eukocyte adhesion glycopr...    31   5.6  
BC044857-1|AAH44857.1|  978|Homo sapiens GTF3C1 protein protein.       31   5.6  
AK131479-1|BAD18624.1|  279|Homo sapiens Da (GTF3C1).  protein.        31   5.6  
AC002303-1|AAB67637.1| 1857|Homo sapiens Transcription factor (T...    31   5.6  
Y15635-1|CAA75729.1| 2273|Homo sapiens ABCR protein.                   31   7.4  
AF001945-1|AAC05632.1| 2273|Homo sapiens rim ABC transporter pro...    31   7.4  
AF000148-1|AAC23915.1| 2273|Homo sapiens ATP-binding cassette tr...    31   7.4  
AB210040-1|BAE06122.1| 2303|Homo sapiens ABCA4 variant protein p...    31   7.4  
U88667-1|AAC51144.1| 2273|Homo sapiens ATP-binding cassette tran...    30   9.8  
BC150246-1|AAI50247.1| 1563|Homo sapiens WDFY3 protein protein.        30   9.8  
BC148294-1|AAI48295.1|  281|Homo sapiens WD repeat and FYVE doma...    30   9.8  
BC119633-1|AAI19634.1|  281|Homo sapiens WD repeat and FYVE doma...    30   9.8  
BC065502-1|AAH65502.1|  778|Homo sapiens WDFY3 protein protein.        30   9.8  
BC015214-1|AAH15214.2|  437|Homo sapiens WDFY3 protein protein.        30   9.8  
BC013377-1|AAH13377.1|  281|Homo sapiens WD repeat and FYVE doma...    30   9.8  
AK055806-1|BAB71020.1|  722|Homo sapiens protein ( Homo sapiens ...    30   9.8  
AF538685-1|AAN15137.1| 3526|Homo sapiens ALFY protein.                 30   9.8  
AF411979-1|AAL04163.1|  420|Homo sapiens WD40- and FYVE-domain c...    30   9.8  
AB023210-1|BAA76837.2| 1556|Homo sapiens KIAA0993 protein protein.     30   9.8  

>Y00472-1|CAA68533.1|  222|Homo sapiens protein ( Human mRNA for Mn
           superoxide dismutase (EC 1.15.1.1.). ).
          Length = 222

 Score =  310 bits (760), Expect = 6e-84
 Identities = 136/196 (69%), Positives = 161/196 (82%), Gaps = 1/196 (0%)
 Frame = +3

Query: 138 SRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTI 317
           SRQKH+LP+LPY+Y ALEP I+ +IM LHHSKHHA Y+NNLNV EEK  +A AKGD+   
Sbjct: 22  SRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQ 81

Query: 318 INLAPALKFNGGGHINHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQLSTASVA 494
           I L PALKFNGGGHINHSIFW NLSPNGG +P   L +A+++DFGS+D  K +L+ ASV 
Sbjct: 82  IALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVG 141

Query: 495 VQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYV 674
           VQGSGWGWLG+NKQ   LQIA C NQDPLQ TTGL+PL GIDVWEHAYYLQYKNVR DY+
Sbjct: 142 VQGSGWGWLGFNKQRGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYL 201

Query: 675 KAIFDVANWNDISQRY 722
           KAI++V NW ++++RY
Sbjct: 202 KAIWNVINWENVTERY 217


>BT006967-1|AAP35613.1|  222|Homo sapiens superoxide dismutase 2,
           mitochondrial protein.
          Length = 222

 Score =  309 bits (758), Expect = 1e-83
 Identities = 137/209 (65%), Positives = 168/209 (80%), Gaps = 1/209 (0%)
 Frame = +3

Query: 99  SQRIGSLIRVAGASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEK 278
           S+++  ++   G SRQKH+LP+LPY+Y ALEP I+ +IM LHHSKHHA Y+NNLNV EEK
Sbjct: 10  SRQLAPVLGYLG-SRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEK 68

Query: 279 LAQAQAKGDIDTIINLAPALKFNGGGHINHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSW 455
             +A AKGD+   I L PALKFNGGGHINHSIFW NLSPNGG +P   L +A+++DFGS+
Sbjct: 69  YQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSF 128

Query: 456 DNIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHA 635
           D  K +L+ ASV VQGSGWGWLG+NK+   LQIA C NQDPLQ TTGL+PL GIDVWEHA
Sbjct: 129 DKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHA 188

Query: 636 YYLQYKNVRADYVKAIFDVANWNDISQRY 722
           YYLQYKNVR DY+KAI++V NW ++++RY
Sbjct: 189 YYLQYKNVRPDYLKAIWNVINWENVTERY 217


>BC012423-1|AAH12423.1|  222|Homo sapiens superoxide dismutase 2,
           mitochondrial protein.
          Length = 222

 Score =  309 bits (758), Expect = 1e-83
 Identities = 137/209 (65%), Positives = 168/209 (80%), Gaps = 1/209 (0%)
 Frame = +3

Query: 99  SQRIGSLIRVAGASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEK 278
           S+++  ++   G SRQKH+LP+LPY+Y ALEP I+ +IM LHHSKHHA Y+NNLNV EEK
Sbjct: 10  SRQLAPVLGYLG-SRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEK 68

Query: 279 LAQAQAKGDIDTIINLAPALKFNGGGHINHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSW 455
             +A AKGD+   I L PALKFNGGGHINHSIFW NLSPNGG +P   L +A+++DFGS+
Sbjct: 69  YQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSF 128

Query: 456 DNIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHA 635
           D  K +L+ ASV VQGSGWGWLG+NK+   LQIA C NQDPLQ TTGL+PL GIDVWEHA
Sbjct: 129 DKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHA 188

Query: 636 YYLQYKNVRADYVKAIFDVANWNDISQRY 722
           YYLQYKNVR DY+KAI++V NW ++++RY
Sbjct: 189 YYLQYKNVRPDYLKAIWNVINWENVTERY 217


>AY267901-1|AAP03428.1|  222|Homo sapiens superoxide dismutase 2,
           mitochondrial protein.
          Length = 222

 Score =  309 bits (758), Expect = 1e-83
 Identities = 137/209 (65%), Positives = 168/209 (80%), Gaps = 1/209 (0%)
 Frame = +3

Query: 99  SQRIGSLIRVAGASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEK 278
           S+++  ++   G SRQKH+LP+LPY+Y ALEP I+ +IM LHHSKHHA Y+NNLNV EEK
Sbjct: 10  SRQLAPVLGYLG-SRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEK 68

Query: 279 LAQAQAKGDIDTIINLAPALKFNGGGHINHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSW 455
             +A AKGD+   I L PALKFNGGGHINHSIFW NLSPNGG +P   L +A+++DFGS+
Sbjct: 69  YQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSF 128

Query: 456 DNIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHA 635
           D  K +L+ ASV VQGSGWGWLG+NK+   LQIA C NQDPLQ TTGL+PL GIDVWEHA
Sbjct: 129 DKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHA 188

Query: 636 YYLQYKNVRADYVKAIFDVANWNDISQRY 722
           YYLQYKNVR DY+KAI++V NW ++++RY
Sbjct: 189 YYLQYKNVRPDYLKAIWNVINWENVTERY 217


>AL135914-1|CAI21845.1|  222|Homo sapiens superoxide dismutase 2,
           mitochondrial protein.
          Length = 222

 Score =  309 bits (758), Expect = 1e-83
 Identities = 137/209 (65%), Positives = 168/209 (80%), Gaps = 1/209 (0%)
 Frame = +3

Query: 99  SQRIGSLIRVAGASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEK 278
           S+++  ++   G SRQKH+LP+LPY+Y ALEP I+ +IM LHHSKHHA Y+NNLNV EEK
Sbjct: 10  SRQLAPVLGYLG-SRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEK 68

Query: 279 LAQAQAKGDIDTIINLAPALKFNGGGHINHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSW 455
             +A AKGD+   I L PALKFNGGGHINHSIFW NLSPNGG +P   L +A+++DFGS+
Sbjct: 69  YQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSF 128

Query: 456 DNIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHA 635
           D  K +L+ ASV VQGSGWGWLG+NK+   LQIA C NQDPLQ TTGL+PL GIDVWEHA
Sbjct: 129 DKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHA 188

Query: 636 YYLQYKNVRADYVKAIFDVANWNDISQRY 722
           YYLQYKNVR DY+KAI++V NW ++++RY
Sbjct: 189 YYLQYKNVRPDYLKAIWNVINWENVTERY 217


>AY280721-1|AAP34410.1|  213|Homo sapiens manganese-containing
           superoxide dismutase protein.
          Length = 213

 Score =  308 bits (757), Expect = 1e-83
 Identities = 135/196 (68%), Positives = 161/196 (82%), Gaps = 1/196 (0%)
 Frame = +3

Query: 138 SRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTI 317
           SRQKH+LP+LPY+Y ALEP I+ +IM LHHSKHHA Y+NNLNV EEK  +A AKGD+   
Sbjct: 18  SRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQ 77

Query: 318 INLAPALKFNGGGHINHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQLSTASVA 494
           I L PALKFNGGGHINHSIFW NLSPNGG +P   L +A+++DFGS+D  K +L+ ASV 
Sbjct: 78  IALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVG 137

Query: 495 VQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYV 674
           VQGSGWGWLG+NK+   LQIA C NQDPLQ TTGL+PL GIDVWEHAYYLQYKNVR DY+
Sbjct: 138 VQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYL 197

Query: 675 KAIFDVANWNDISQRY 722
           KAI++V NW ++++RY
Sbjct: 198 KAIWNVINWENVTERY 213


>X59445-1|CAA42066.1|  222|Homo sapiens manganese superoxide
           dismutase (MnSOD) protein.
          Length = 222

 Score =  308 bits (755), Expect = 2e-83
 Identities = 135/196 (68%), Positives = 161/196 (82%), Gaps = 1/196 (0%)
 Frame = +3

Query: 138 SRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTI 317
           SRQKH+LP+LPY+Y ALEP I+ +IM LHHSKHHA Y+NNLNV EEK  +A AKGD+   
Sbjct: 22  SRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVNEEKYQEALAKGDVTAQ 81

Query: 318 INLAPALKFNGGGHINHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQLSTASVA 494
           I L PALKFNGGGHINHSIFW NLSPNGG +P   L +A+++DFGS+D  K +L+ ASV 
Sbjct: 82  IALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVG 141

Query: 495 VQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYV 674
           VQGSGWGWLG+NK+   LQIA C NQDPLQ TTGL+PL GIDVWEHAYYLQYKNVR DY+
Sbjct: 142 VQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYL 201

Query: 675 KAIFDVANWNDISQRY 722
           KAI++V NW ++++RY
Sbjct: 202 KAIWNVINWENVTERY 217


>X15132-1|CAA33228.1|  222|Homo sapiens protein ( Human mRNA for
           manganese containing superoxide dismutase (EC
           1.15.1.1).  ).
          Length = 222

 Score =  308 bits (755), Expect = 2e-83
 Identities = 135/196 (68%), Positives = 161/196 (82%), Gaps = 1/196 (0%)
 Frame = +3

Query: 138 SRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTI 317
           SRQKH+LP+LPY+Y ALEP I+ +IM LHHSKHHA Y+NNLNV EEK  +A AKGD+   
Sbjct: 22  SRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVNEEKYQEALAKGDVTAQ 81

Query: 318 INLAPALKFNGGGHINHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQLSTASVA 494
           I L PALKFNGGGHINHSIFW NLSPNGG +P   L +A+++DFGS+D  K +L+ ASV 
Sbjct: 82  IALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVG 141

Query: 495 VQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYV 674
           VQGSGWGWLG+NK+   LQIA C NQDPLQ TTGL+PL GIDVWEHAYYLQYKNVR DY+
Sbjct: 142 VQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYL 201

Query: 675 KAIFDVANWNDISQRY 722
           KAI++V NW ++++RY
Sbjct: 202 KAIWNVINWENVTERY 217


>X07834-1|CAA30687.1|  222|Homo sapiens protein ( Human mRNA for
           manganese superoxide dismutase (EC 1.15.1.1). ).
          Length = 222

 Score =  307 bits (753), Expect = 4e-83
 Identities = 135/196 (68%), Positives = 160/196 (81%), Gaps = 1/196 (0%)
 Frame = +3

Query: 138 SRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTI 317
           SRQKH+LP+LPY+Y ALEP I+ +IM LHHSKHHA Y+NNLNV EEK  +A AKGD+   
Sbjct: 22  SRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQ 81

Query: 318 INLAPALKFNGGGHINHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQLSTASVA 494
           I L PALKFNGGGHINHSIFW NLSPNGG +P   L +A++ DFGS+D  K +L+ ASV 
Sbjct: 82  IALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKLDFGSFDKFKEKLTAASVG 141

Query: 495 VQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYV 674
           VQGSGWGWLG+NK+   LQIA C NQDPLQ TTGL+PL GIDVWEHAYYLQYKNVR DY+
Sbjct: 142 VQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYL 201

Query: 675 KAIFDVANWNDISQRY 722
           KAI++V NW ++++RY
Sbjct: 202 KAIWNVINWENVTERY 217


>Y00985-1|CAA68791.1|  222|Homo sapiens protein ( Human mRNA for
           manganese-containing superoxide dismutase. ).
          Length = 222

 Score =  306 bits (752), Expect = 6e-83
 Identities = 134/196 (68%), Positives = 160/196 (81%), Gaps = 1/196 (0%)
 Frame = +3

Query: 138 SRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTI 317
           SRQKH+LP+LPY+Y ALEP I+ +IM LHHSKHHA Y+NNLNV EEK  +A AKGD+   
Sbjct: 22  SRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQ 81

Query: 318 INLAPALKFNGGGHINHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQLSTASVA 494
             L PALKFNGGGHINHSIFW NLSPNGG +P   L +A+++DFGS+D  K +L+ ASV 
Sbjct: 82  TALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVG 141

Query: 495 VQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYV 674
           VQGSGWGWLG+NK+   LQIA C NQDPLQ TTGL+PL GIDVWEHAYYLQYKNVR DY+
Sbjct: 142 VQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYL 201

Query: 675 KAIFDVANWNDISQRY 722
           KAI++V NW ++++RY
Sbjct: 202 KAIWNVINWENVTERY 217


>X14322-1|CAA32502.1|  222|Homo sapiens Manganese superoxide
           dismutase protein.
          Length = 222

 Score =  306 bits (752), Expect = 6e-83
 Identities = 134/196 (68%), Positives = 160/196 (81%), Gaps = 1/196 (0%)
 Frame = +3

Query: 138 SRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTI 317
           SRQKH+LP+LPY+Y ALEP I+ +IM LHHSKHHA Y+NNLNV EEK  +A AKGD+   
Sbjct: 22  SRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQ 81

Query: 318 INLAPALKFNGGGHINHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQLSTASVA 494
             L PALKFNGGGHINHSIFW NLSPNGG +P   L +A+++DFGS+D  K +L+ ASV 
Sbjct: 82  TALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVG 141

Query: 495 VQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYV 674
           VQGSGWGWLG+NK+   LQIA C NQDPLQ TTGL+PL GIDVWEHAYYLQYKNVR DY+
Sbjct: 142 VQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYL 201

Query: 675 KAIFDVANWNDISQRY 722
           KAI++V NW ++++RY
Sbjct: 202 KAIWNVINWENVTERY 217


>M36693-1|AAA36622.1|  222|Homo sapiens protein ( Human
           manganese-containing superoxide dismutase mRNA, complete
           cds. ).
          Length = 222

 Score =  306 bits (752), Expect = 6e-83
 Identities = 134/196 (68%), Positives = 160/196 (81%), Gaps = 1/196 (0%)
 Frame = +3

Query: 138 SRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTI 317
           SRQKH+LP+LPY+Y ALEP I+ +IM LHHSKHHA Y+NNLNV EEK  +A AKGD+   
Sbjct: 22  SRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQ 81

Query: 318 INLAPALKFNGGGHINHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQLSTASVA 494
             L PALKFNGGGHINHSIFW NLSPNGG +P   L +A+++DFGS+D  K +L+ ASV 
Sbjct: 82  TALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVG 141

Query: 495 VQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYV 674
           VQGSGWGWLG+NK+   LQIA C NQDPLQ TTGL+PL GIDVWEHAYYLQYKNVR DY+
Sbjct: 142 VQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYL 201

Query: 675 KAIFDVANWNDISQRY 722
           KAI++V NW ++++RY
Sbjct: 202 KAIWNVINWENVTERY 217


>AY280719-1|AAP34408.1|  210|Homo sapiens manganese-containing
           superoxide dismutase protein.
          Length = 210

 Score =  303 bits (743), Expect = 7e-82
 Identities = 133/193 (68%), Positives = 158/193 (81%), Gaps = 1/193 (0%)
 Frame = +3

Query: 138 SRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTI 317
           SRQKH+LP+LPY+Y ALEP I+ +IM LHHSKHHA Y+NNLNV EEK  +A AKGD+   
Sbjct: 18  SRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQ 77

Query: 318 INLAPALKFNGGGHINHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQLSTASVA 494
           I L PALKFNGGGHINHSIFW NLSPNGG +P   L +A+++DFGS+D  K +L+ ASV 
Sbjct: 78  IALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVG 137

Query: 495 VQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYV 674
           VQGSGWGWLG+NK+   LQIA C NQDPLQ TTGL+PL GIDVWEHAYYLQYKNVR DY+
Sbjct: 138 VQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYL 197

Query: 675 KAIFDVANWNDIS 713
           KAI++V NW +++
Sbjct: 198 KAIWNVINWENVT 210


>AY280718-1|AAP34407.1|  213|Homo sapiens manganese-containing
           superoxide dismutase protein.
          Length = 213

 Score =  303 bits (743), Expect = 7e-82
 Identities = 133/193 (68%), Positives = 158/193 (81%), Gaps = 1/193 (0%)
 Frame = +3

Query: 138 SRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTI 317
           SRQKH+LP+LPY+Y ALEP I+ +IM LHHSKHHA Y+NNLNV EEK  +A AKGD+   
Sbjct: 21  SRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQ 80

Query: 318 INLAPALKFNGGGHINHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQLSTASVA 494
           I L PALKFNGGGHINHSIFW NLSPNGG +P   L +A+++DFGS+D  K +L+ ASV 
Sbjct: 81  IALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVG 140

Query: 495 VQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYV 674
           VQGSGWGWLG+NK+   LQIA C NQDPLQ TTGL+PL GIDVWEHAYYLQYKNVR DY+
Sbjct: 141 VQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYL 200

Query: 675 KAIFDVANWNDIS 713
           KAI++V NW +++
Sbjct: 201 KAIWNVINWENVT 213


>DQ003134-1|AAY21807.1|  212|Homo sapiens manganese-containing
           superoxide dismutase protein.
          Length = 212

 Score =  302 bits (742), Expect = 9e-82
 Identities = 133/192 (69%), Positives = 157/192 (81%), Gaps = 1/192 (0%)
 Frame = +3

Query: 138 SRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTI 317
           SRQKH+LP+LPY+Y ALEP I+ +IM LHHSKHHA Y+NNLNV EEK  +A AKGD+   
Sbjct: 21  SRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQ 80

Query: 318 INLAPALKFNGGGHINHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQLSTASVA 494
           I L PALKFNGGGHINHSIFW NLSPNGG +P   L +A+++DFGS+D  K +L+ ASV 
Sbjct: 81  IALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVG 140

Query: 495 VQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYV 674
           VQGSGWGWLG+NK+   LQIA C NQDPLQ TTGL+PL GIDVWEHAYYLQYKNVR DY+
Sbjct: 141 VQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYL 200

Query: 675 KAIFDVANWNDI 710
           KAI++V NW ++
Sbjct: 201 KAIWNVINWENV 212


>AY280720-1|AAP34409.1|  209|Homo sapiens manganese-containing
           superoxide dismutase protein.
          Length = 209

 Score =  301 bits (738), Expect = 3e-81
 Identities = 134/205 (65%), Positives = 163/205 (79%), Gaps = 1/205 (0%)
 Frame = +3

Query: 99  SQRIGSLIRVAGASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEK 278
           S+++  ++   G SRQKH+LP+LPY+Y ALEP I+ +IM LHHSKHHA Y+NNLNV EEK
Sbjct: 6   SRQLAPVLGYLG-SRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEK 64

Query: 279 LAQAQAKGDIDTIINLAPALKFNGGGHINHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSW 455
             +A AKGD+     L PALKFNGGGHINHSIFW NLSPNGG +P   L +A+++DFGS+
Sbjct: 65  YQEALAKGDVTAQTALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSF 124

Query: 456 DNIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHA 635
           D  K +L+ ASV VQGSGWGWLG+NK+   LQIA C NQDPLQ TTGL+PL GIDVWEHA
Sbjct: 125 DKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHA 184

Query: 636 YYLQYKNVRADYVKAIFDVANWNDI 710
           YYLQYKNVR DY+KAI++V NW ++
Sbjct: 185 YYLQYKNVRPDYLKAIWNVINWENV 209


>AL135914-2|CAI21846.1|  161|Homo sapiens superoxide dismutase 2,
           mitochondrial protein.
          Length = 161

 Score = 91.9 bits (218), Expect = 3e-18
 Identities = 41/68 (60%), Positives = 53/68 (77%)
 Frame = +3

Query: 99  SQRIGSLIRVAGASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEK 278
           S+++  ++   G SRQKH+LP+LPY+Y ALEP I+ +IM LHHSKHHA Y+NNLNV EEK
Sbjct: 31  SRQLAPVLGYLG-SRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEK 89

Query: 279 LAQAQAKG 302
             +A AKG
Sbjct: 90  YQEALAKG 97


>BC016934-1|AAH16934.1|  140|Homo sapiens SOD2 protein protein.
          Length = 140

 Score = 91.5 bits (217), Expect = 4e-18
 Identities = 39/55 (70%), Positives = 46/55 (83%)
 Frame = +3

Query: 138 SRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKG 302
           SRQKH+LP+LPY+Y ALEP I+ +IM LHHSKHHA Y+NNLNV EEK  +A AKG
Sbjct: 22  SRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKG 76


>L34157-1|AAA83933.1|   75|Homo sapiens manganese superoxide
           dismutase protein.
          Length = 75

 Score = 89.0 bits (211), Expect = 2e-17
 Identities = 38/54 (70%), Positives = 45/54 (83%)
 Frame = +3

Query: 138 SRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAK 299
           SRQKH+LP+LPY+Y ALEP I+ +IM LHHSKHHA Y+NNLNV EEK  +A AK
Sbjct: 22  SRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAK 75


>D83493-1|BAA18955.1|   38|Homo sapiens MnSOD precursor protein.
          Length = 38

 Score = 34.7 bits (76), Expect = 0.45
 Identities = 13/17 (76%), Positives = 16/17 (94%)
 Frame = +3

Query: 138 SRQKHTLPELPYEYNAL 188
           SRQKH+LP+LPY+Y AL
Sbjct: 22  SRQKHSLPDLPYDYGAL 38


>U02619-1|AAA17985.1| 2109|Homo sapiens TFIIIC Box B-binding subunit
            protein.
          Length = 2109

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = +3

Query: 477  STASVAVQGSGWGWLGYNKQMKKLQIATCQNQDP 578
            +TA +   GS W WL ++ ++K  + A  Q +DP
Sbjct: 1799 NTARLVAMGSAWPWLLHSVRLKDREDADIQREDP 1832


>M81695-1|AAA59180.1| 1163|Homo sapiens eukocyte adhesion
           glycoprotein precursor protein.
          Length = 1163

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 28/121 (23%), Positives = 53/121 (43%), Gaps = 2/121 (1%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLA 329
           H L    Y   A++ V+ R   + + ++  AT I  +    +K   +    D+  + + A
Sbjct: 220 HQLQGFTYTATAIQNVVHRLFHASYGARRDATKILIVITDGKKEGDSLDYKDVIPMADAA 279

Query: 330 PALKFNGGGHI--NHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQG 503
             +++  G  +   +   W  L+    KPS      VE DF +  +I+NQL     A++G
Sbjct: 280 GIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVE-DFDALKDIQNQLKEKIFAIEG 338

Query: 504 S 506
           +
Sbjct: 339 T 339


>BC044857-1|AAH44857.1|  978|Homo sapiens GTF3C1 protein protein.
          Length = 978

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = +3

Query: 477 STASVAVQGSGWGWLGYNKQMKKLQIATCQNQDP 578
           +TA +   GS W WL ++ ++K  + A  Q +DP
Sbjct: 693 NTARLVAMGSAWPWLLHSVRLKDREDADIQREDP 726


>AK131479-1|BAD18624.1|  279|Homo sapiens Da (GTF3C1).  protein.
          Length = 279

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = +3

Query: 477 STASVAVQGSGWGWLGYNKQMKKLQIATCQNQDP 578
           +TA +   GS W WL ++ ++K  + A  Q +DP
Sbjct: 100 NTARLVAMGSAWPWLLHSVRLKDREDADIQREDP 133


>AC002303-1|AAB67637.1| 1857|Homo sapiens Transcription factor
            (TFIIIC) alpha chain, partial protein.
          Length = 1857

 Score = 31.1 bits (67), Expect = 5.6
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = +3

Query: 477  STASVAVQGSGWGWLGYNKQMKKLQIATCQNQDP 578
            +TA +   GS W WL ++ ++K  + A  Q +DP
Sbjct: 1547 NTARLVAMGSAWPWLLHSVRLKDREDADIQREDP 1580


>Y15635-1|CAA75729.1| 2273|Homo sapiens ABCR protein.
          Length = 2273

 Score = 30.7 bits (66), Expect = 7.4
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = -1

Query: 614  SEERDQSSGGLQRILVLACSYLQFLHLFVVAKPTPA*ALYCHRSCRQLILYVIPGSKVFL 435
            +EE    SGG+QR L +A +++    + ++ +PT     Y  RS   L+L    G  + +
Sbjct: 1056 NEEAQDLSGGMQRKLSVAIAFVGDAKVVILDEPTSGVDPYSRRSIWDLLLKYRSGRTIIM 1115

Query: 434  N 432
            +
Sbjct: 1116 S 1116


>AF001945-1|AAC05632.1| 2273|Homo sapiens rim ABC transporter protein.
          Length = 2273

 Score = 30.7 bits (66), Expect = 7.4
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = -1

Query: 614  SEERDQSSGGLQRILVLACSYLQFLHLFVVAKPTPA*ALYCHRSCRQLILYVIPGSKVFL 435
            +EE    SGG+QR L +A +++    + ++ +PT     Y  RS   L+L    G  + +
Sbjct: 1056 NEEAQDLSGGMQRKLSVAIAFVGDAKVVILDEPTSGVDPYSRRSIWDLLLKYRSGRTIIM 1115

Query: 434  N 432
            +
Sbjct: 1116 S 1116


>AF000148-1|AAC23915.1| 2273|Homo sapiens ATP-binding cassette
            transporter protein.
          Length = 2273

 Score = 30.7 bits (66), Expect = 7.4
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = -1

Query: 614  SEERDQSSGGLQRILVLACSYLQFLHLFVVAKPTPA*ALYCHRSCRQLILYVIPGSKVFL 435
            +EE    SGG+QR L +A +++    + ++ +PT     Y  RS   L+L    G  + +
Sbjct: 1056 NEEAQDLSGGMQRKLSVAIAFVGDAKVVILDEPTSGVDPYSRRSIWDLLLKYRSGRTIIM 1115

Query: 434  N 432
            +
Sbjct: 1116 S 1116


>AB210040-1|BAE06122.1| 2303|Homo sapiens ABCA4 variant protein
            protein.
          Length = 2303

 Score = 30.7 bits (66), Expect = 7.4
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = -1

Query: 614  SEERDQSSGGLQRILVLACSYLQFLHLFVVAKPTPA*ALYCHRSCRQLILYVIPGSKVFL 435
            +EE    SGG+QR L +A +++    + ++ +PT     Y  RS   L+L    G  + +
Sbjct: 1086 NEEAQDLSGGMQRKLSVAIAFVGDAKVVILDEPTSGVDPYSRRSIWDLLLKYRSGRTIIM 1145

Query: 434  N 432
            +
Sbjct: 1146 S 1146


>U88667-1|AAC51144.1| 2273|Homo sapiens ATP-binding cassette
            transporter protein.
          Length = 2273

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 17/60 (28%), Positives = 30/60 (50%)
 Frame = -1

Query: 614  SEERDQSSGGLQRILVLACSYLQFLHLFVVAKPTPA*ALYCHRSCRQLILYVIPGSKVFL 435
            +EE    SGG+QR L +A +++    + ++ +PT     Y  RS   L+L    G  + +
Sbjct: 1056 NEEAQDLSGGMQRKLSVAIAFVGDAKVVILDEPTSGVDPYSRRSIWDLLLKYRSGRTIIM 1115


>BC150246-1|AAI50247.1| 1563|Homo sapiens WDFY3 protein protein.
          Length = 1563

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 2/58 (3%)
 Frame = +2

Query: 554  SYMPEPGSSAGHHWIGPALRNRCMGARVLSSVQER--SCRLRESYFRCSQLE*YISEI 721
            S   +PG SA  HW+     + C G  V  S+ ER   CR     F C +   + SEI
Sbjct: 1475 SVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLF-CQKCSRFQSEI 1531


>BC148294-1|AAI48295.1|  281|Homo sapiens WD repeat and FYVE domain
           containing 3 protein.
          Length = 281

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 2/58 (3%)
 Frame = +2

Query: 554 SYMPEPGSSAGHHWIGPALRNRCMGARVLSSVQER--SCRLRESYFRCSQLE*YISEI 721
           S   +PG SA  HW+     + C G  V  S+ ER   CR     F C +   + SEI
Sbjct: 193 SVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLF-CQKCSRFQSEI 249


>BC119633-1|AAI19634.1|  281|Homo sapiens WD repeat and FYVE domain
           containing 3 protein.
          Length = 281

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 2/58 (3%)
 Frame = +2

Query: 554 SYMPEPGSSAGHHWIGPALRNRCMGARVLSSVQER--SCRLRESYFRCSQLE*YISEI 721
           S   +PG SA  HW+     + C G  V  S+ ER   CR     F C +   + SEI
Sbjct: 193 SVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLF-CQKCSRFQSEI 249


>BC065502-1|AAH65502.1|  778|Homo sapiens WDFY3 protein protein.
          Length = 778

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 2/58 (3%)
 Frame = +2

Query: 554 SYMPEPGSSAGHHWIGPALRNRCMGARVLSSVQER--SCRLRESYFRCSQLE*YISEI 721
           S   +PG SA  HW+     + C G  V  S+ ER   CR     F C +   + SEI
Sbjct: 690 SVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLF-CQKCSRFQSEI 746


>BC015214-1|AAH15214.2|  437|Homo sapiens WDFY3 protein protein.
          Length = 437

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 2/58 (3%)
 Frame = +2

Query: 554 SYMPEPGSSAGHHWIGPALRNRCMGARVLSSVQER--SCRLRESYFRCSQLE*YISEI 721
           S   +PG SA  HW+     + C G  V  S+ ER   CR     F C +   + SEI
Sbjct: 349 SVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLF-CQKCSRFQSEI 405


>BC013377-1|AAH13377.1|  281|Homo sapiens WD repeat and FYVE domain
           containing 3 protein.
          Length = 281

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 2/58 (3%)
 Frame = +2

Query: 554 SYMPEPGSSAGHHWIGPALRNRCMGARVLSSVQER--SCRLRESYFRCSQLE*YISEI 721
           S   +PG SA  HW+     + C G  V  S+ ER   CR     F C +   + SEI
Sbjct: 193 SVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLF-CQKCSRFQSEI 249


>AK055806-1|BAB71020.1|  722|Homo sapiens protein ( Homo sapiens
           cDNA FLJ31244 fis, clone KIDNE2005042, moderately
           similar to LYSOSOMAL TRAFFICKING REGULATOR. ).
          Length = 722

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 2/58 (3%)
 Frame = +2

Query: 554 SYMPEPGSSAGHHWIGPALRNRCMGARVLSSVQER--SCRLRESYFRCSQLE*YISEI 721
           S   +PG SA  HW+     + C G  V  S+ ER   CR     F C +   + SEI
Sbjct: 634 SVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLF-CQKCSRFQSEI 690


>AF538685-1|AAN15137.1| 3526|Homo sapiens ALFY protein.
          Length = 3526

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 2/58 (3%)
 Frame = +2

Query: 554  SYMPEPGSSAGHHWIGPALRNRCMGARVLSSVQER--SCRLRESYFRCSQLE*YISEI 721
            S   +PG SA  HW+     + C G  V  S+ ER   CR     F C +   + SEI
Sbjct: 3438 SVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLF-CQKCSRFQSEI 3494


>AF411979-1|AAL04163.1|  420|Homo sapiens WD40- and FYVE-domain
           containing protein 3 protein.
          Length = 420

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 2/58 (3%)
 Frame = +2

Query: 554 SYMPEPGSSAGHHWIGPALRNRCMGARVLSSVQER--SCRLRESYFRCSQLE*YISEI 721
           S   +PG SA  HW+     + C G  V  S+ ER   CR     F C +   + SEI
Sbjct: 332 SVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLF-CQKCSRFQSEI 388


>AB023210-1|BAA76837.2| 1556|Homo sapiens KIAA0993 protein protein.
          Length = 1556

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 2/58 (3%)
 Frame = +2

Query: 554  SYMPEPGSSAGHHWIGPALRNRCMGARVLSSVQER--SCRLRESYFRCSQLE*YISEI 721
            S   +PG SA  HW+     + C G  V  S+ ER   CR     F C +   + SEI
Sbjct: 1468 SVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLF-CQKCSRFQSEI 1524


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 125,957,372
Number of Sequences: 237096
Number of extensions: 2918918
Number of successful extensions: 6237
Number of sequences better than 10.0: 40
Number of HSP's better than 10.0 without gapping: 5933
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6221
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 11381686510
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).