SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0031
         (644 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR542235-1|CAG47031.1|  117|Homo sapiens GABARAP protein.             231   2e-60
CR457043-1|CAG33324.1|  117|Homo sapiens GABARAP protein.             231   2e-60
BC106749-1|AAI06750.1|  117|Homo sapiens GABA(A) receptor-associ...   231   2e-60
BC106748-1|AAI06749.1|  117|Homo sapiens GABA(A) receptor-associ...   231   2e-60
AF183425-1|AAG09694.1|  117|Homo sapiens HT004 protein protein.       231   2e-60
AF161586-1|AAD47641.1|  117|Homo sapiens GABA-A receptor-associa...   231   2e-60
AF044671-1|AAD02337.1|  117|Homo sapiens MM46 protein.                231   2e-60
AB030711-1|BAB21549.1|  117|Homo sapiens MAP1 light chain 3 rela...   231   2e-60
CR533480-1|CAG38511.1|  117|Homo sapiens GABARAPL1 protein.           220   3e-57
BC028315-1|AAH28315.1|  117|Homo sapiens GABA(A) receptor-associ...   220   3e-57
BC009309-1|AAH09309.1|  117|Homo sapiens GABA(A) receptor-associ...   220   3e-57
AF287012-1|AAK55962.1|  117|Homo sapiens early estrogen-regulate...   220   3e-57
AF087847-1|AAK20399.1|  117|Homo sapiens GABA-A receptor-associa...   220   3e-57
AF180519-1|AAK16237.1|  117|Homo sapiens GABA-A receptor-associa...   206   7e-53
CR542217-1|CAG47013.1|  117|Homo sapiens GABARAPL2 protein.           149   8e-36
BC029601-1|AAH29601.1|  117|Homo sapiens GABA(A) receptor-associ...   149   8e-36
BC014594-1|AAH14594.1|  117|Homo sapiens GABA(A) receptor-associ...   149   8e-36
BC005985-1|AAH05985.1|  117|Homo sapiens GABA(A) receptor-associ...   149   8e-36
AJ010569-1|CAA09249.1|  117|Homo sapiens GEF-2 protein protein.       149   8e-36
AF087848-1|AAK20400.1|  117|Homo sapiens GABA-A receptor-associa...   149   8e-36
AB030710-1|BAB21548.1|  117|Homo sapiens MAP1 light chain 3 rela...   149   8e-36
BX571673-3|CAH72477.1|  147|Homo sapiens microtubule-associated ...    94   4e-19
BC132988-1|AAI32989.1|  147|Homo sapiens microtubule-associated ...    94   4e-19
BC132986-1|AAI32987.1|  147|Homo sapiens microtubule-associated ...    94   4e-19
BC127722-1|AAI27723.1|  147|Homo sapiens microtubule-associated ...    94   4e-19
AF276659-1|AAK35152.1|  147|Homo sapiens MAP1 light chain 3-like...    94   4e-19
BT007452-1|AAP36120.1|  121|Homo sapiens microtubule-associated ...    81   3e-15
BC015810-1|AAH15810.1|  121|Homo sapiens microtubule-associated ...    81   3e-15
AL118520-2|CAI40290.1|  121|Homo sapiens microtubule-associated ...    81   3e-15
AF276658-1|AAK35151.1|  121|Homo sapiens MAP1 light chain 3-like...    81   3e-15
BC067797-1|AAH67797.1|  125|Homo sapiens microtubule-associated ...    79   1e-14
BC041874-1|AAH41874.1|  125|Homo sapiens microtubule-associated ...    77   5e-14
BC018634-1|AAH18634.1|  125|Homo sapiens microtubule-associated ...    77   5e-14
AK025556-1|BAB15169.1|  125|Homo sapiens protein ( Homo sapiens ...    77   5e-14
AF303888-1|AAG23182.1|  125|Homo sapiens microtubule-associated ...    77   5e-14
AF183417-1|AAG09686.1|  125|Homo sapiens microtubule-associated ...    77   5e-14
AF087871-1|AAM10499.1|  125|Homo sapiens microtubule-associated ...    77   5e-14
AL118520-1|CAC14078.1|  125|Homo sapiens microtubule-associated ...    74   4e-13
BC045759-1|AAH45759.1|   66|Homo sapiens MAP1LC3B protein protein.     40   0.008
DQ088982-1|AAY68223.1|  221|Homo sapiens glutathione peroxidase ...    31   4.6  
AY324826-1|AAP85543.1|  221|Homo sapiens glutathione peroxidase ...    31   4.6  

>CR542235-1|CAG47031.1|  117|Homo sapiens GABARAP protein.
          Length = 117

 Score =  231 bits (565), Expect = 2e-60
 Identities = 105/116 (90%), Positives = 112/116 (96%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MKF YKEEH FEKR++EGEKIR+KYPDRVPVIVEKAPKAR+GDLDKKKYLVPSDLTVGQF
Sbjct: 1   MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           YFLIRKRIHLR EDALFFFVNNVIPPTSATMG LYQEHH+EDFFLYIA+SDE+VYG
Sbjct: 61  YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG 116


>CR457043-1|CAG33324.1|  117|Homo sapiens GABARAP protein.
          Length = 117

 Score =  231 bits (565), Expect = 2e-60
 Identities = 105/116 (90%), Positives = 112/116 (96%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MKF YKEEH FEKR++EGEKIR+KYPDRVPVIVEKAPKAR+GDLDKKKYLVPSDLTVGQF
Sbjct: 1   MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           YFLIRKRIHLR EDALFFFVNNVIPPTSATMG LYQEHH+EDFFLYIA+SDE+VYG
Sbjct: 61  YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG 116


>BC106749-1|AAI06750.1|  117|Homo sapiens GABA(A)
           receptor-associated protein protein.
          Length = 117

 Score =  231 bits (565), Expect = 2e-60
 Identities = 105/116 (90%), Positives = 112/116 (96%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MKF YKEEH FEKR++EGEKIR+KYPDRVPVIVEKAPKAR+GDLDKKKYLVPSDLTVGQF
Sbjct: 1   MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           YFLIRKRIHLR EDALFFFVNNVIPPTSATMG LYQEHH+EDFFLYIA+SDE+VYG
Sbjct: 61  YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG 116


>BC106748-1|AAI06749.1|  117|Homo sapiens GABA(A)
           receptor-associated protein protein.
          Length = 117

 Score =  231 bits (565), Expect = 2e-60
 Identities = 105/116 (90%), Positives = 112/116 (96%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MKF YKEEH FEKR++EGEKIR+KYPDRVPVIVEKAPKAR+GDLDKKKYLVPSDLTVGQF
Sbjct: 1   MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           YFLIRKRIHLR EDALFFFVNNVIPPTSATMG LYQEHH+EDFFLYIA+SDE+VYG
Sbjct: 61  YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG 116


>AF183425-1|AAG09694.1|  117|Homo sapiens HT004 protein protein.
          Length = 117

 Score =  231 bits (565), Expect = 2e-60
 Identities = 105/116 (90%), Positives = 112/116 (96%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MKF YKEEH FEKR++EGEKIR+KYPDRVPVIVEKAPKAR+GDLDKKKYLVPSDLTVGQF
Sbjct: 1   MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           YFLIRKRIHLR EDALFFFVNNVIPPTSATMG LYQEHH+EDFFLYIA+SDE+VYG
Sbjct: 61  YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG 116


>AF161586-1|AAD47641.1|  117|Homo sapiens GABA-A receptor-associated
           protein protein.
          Length = 117

 Score =  231 bits (565), Expect = 2e-60
 Identities = 105/116 (90%), Positives = 112/116 (96%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MKF YKEEH FEKR++EGEKIR+KYPDRVPVIVEKAPKAR+GDLDKKKYLVPSDLTVGQF
Sbjct: 1   MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           YFLIRKRIHLR EDALFFFVNNVIPPTSATMG LYQEHH+EDFFLYIA+SDE+VYG
Sbjct: 61  YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG 116


>AF044671-1|AAD02337.1|  117|Homo sapiens MM46 protein.
          Length = 117

 Score =  231 bits (565), Expect = 2e-60
 Identities = 105/116 (90%), Positives = 112/116 (96%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MKF YKEEH FEKR++EGEKIR+KYPDRVPVIVEKAPKAR+GDLDKKKYLVPSDLTVGQF
Sbjct: 1   MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           YFLIRKRIHLR EDALFFFVNNVIPPTSATMG LYQEHH+EDFFLYIA+SDE+VYG
Sbjct: 61  YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG 116


>AB030711-1|BAB21549.1|  117|Homo sapiens MAP1 light chain 3 related
           protein protein.
          Length = 117

 Score =  231 bits (565), Expect = 2e-60
 Identities = 105/116 (90%), Positives = 112/116 (96%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MKF YKEEH FEKR++EGEKIR+KYPDRVPVIVEKAPKAR+GDLDKKKYLVPSDLTVGQF
Sbjct: 1   MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           YFLIRKRIHLR EDALFFFVNNVIPPTSATMG LYQEHH+EDFFLYIA+SDE+VYG
Sbjct: 61  YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG 116


>CR533480-1|CAG38511.1|  117|Homo sapiens GABARAPL1 protein.
          Length = 117

 Score =  220 bits (538), Expect = 3e-57
 Identities = 98/116 (84%), Positives = 110/116 (94%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MKFQYKE+H FE RK EGEKIR+KYPDRVPVIVEKAPKAR+ DLDK+KYLVPSDLTVGQF
Sbjct: 1   MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           YFLIRKRIHLRPEDALFFFVNN IPPTSATMG LY+++H+ED+FLY+A+SDE+VYG
Sbjct: 61  YFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYG 116


>BC028315-1|AAH28315.1|  117|Homo sapiens GABA(A)
           receptor-associated protein like 1 protein.
          Length = 117

 Score =  220 bits (538), Expect = 3e-57
 Identities = 98/116 (84%), Positives = 110/116 (94%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MKFQYKE+H FE RK EGEKIR+KYPDRVPVIVEKAPKAR+ DLDK+KYLVPSDLTVGQF
Sbjct: 1   MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           YFLIRKRIHLRPEDALFFFVNN IPPTSATMG LY+++H+ED+FLY+A+SDE+VYG
Sbjct: 61  YFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYG 116


>BC009309-1|AAH09309.1|  117|Homo sapiens GABA(A)
           receptor-associated protein like 1 protein.
          Length = 117

 Score =  220 bits (538), Expect = 3e-57
 Identities = 98/116 (84%), Positives = 110/116 (94%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MKFQYKE+H FE RK EGEKIR+KYPDRVPVIVEKAPKAR+ DLDK+KYLVPSDLTVGQF
Sbjct: 1   MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           YFLIRKRIHLRPEDALFFFVNN IPPTSATMG LY+++H+ED+FLY+A+SDE+VYG
Sbjct: 61  YFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYG 116


>AF287012-1|AAK55962.1|  117|Homo sapiens early estrogen-regulated
           protein protein.
          Length = 117

 Score =  220 bits (538), Expect = 3e-57
 Identities = 98/116 (84%), Positives = 110/116 (94%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MKFQYKE+H FE RK EGEKIR+KYPDRVPVIVEKAPKAR+ DLDK+KYLVPSDLTVGQF
Sbjct: 1   MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           YFLIRKRIHLRPEDALFFFVNN IPPTSATMG LY+++H+ED+FLY+A+SDE+VYG
Sbjct: 61  YFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYG 116


>AF087847-1|AAK20399.1|  117|Homo sapiens GABA-A receptor-associated
           protein like 1 protein.
          Length = 117

 Score =  220 bits (538), Expect = 3e-57
 Identities = 98/116 (84%), Positives = 110/116 (94%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MKFQYKE+H FE RK EGEKIR+KYPDRVPVIVEKAPKAR+ DLDK+KYLVPSDLTVGQF
Sbjct: 1   MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           YFLIRKRIHLRPEDALFFFVNN IPPTSATMG LY+++H+ED+FLY+A+SDE+VYG
Sbjct: 61  YFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYG 116


>AF180519-1|AAK16237.1|  117|Homo sapiens GABA-A receptor-associated
           protein protein.
          Length = 117

 Score =  206 bits (502), Expect = 7e-53
 Identities = 93/116 (80%), Positives = 105/116 (90%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MKFQYKE H FE RK EGEKIR+KYPDRVP+IVEKAPKAR+ DLD++KYLVPSDLT GQF
Sbjct: 1   MKFQYKEVHPFEYRKKEGEKIRKKYPDRVPLIVEKAPKARVPDLDRRKYLVPSDLTDGQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           Y LIRKRIHLRPEDALFFFVNN IPPTSATMG LY++ H+ED FLY+A+S+E+VYG
Sbjct: 61  YLLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDSHEEDDFLYVAYSNESVYG 116


>CR542217-1|CAG47013.1|  117|Homo sapiens GABARAPL2 protein.
          Length = 117

 Score =  149 bits (361), Expect = 8e-36
 Identities = 67/116 (57%), Positives = 87/116 (75%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MK+ +KE+HS E R  E  KIR KYPDRVPVIVEK   +++ D+DK+KYLVPSD+TV QF
Sbjct: 1   MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
            ++IRKRI L  E A+F FV+  +P +S TMG LY++  DED FLY+A+S EN +G
Sbjct: 61  MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFG 116


>BC029601-1|AAH29601.1|  117|Homo sapiens GABA(A)
           receptor-associated protein-like 2 protein.
          Length = 117

 Score =  149 bits (361), Expect = 8e-36
 Identities = 67/116 (57%), Positives = 87/116 (75%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MK+ +KE+HS E R  E  KIR KYPDRVPVIVEK   +++ D+DK+KYLVPSD+TV QF
Sbjct: 1   MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
            ++IRKRI L  E A+F FV+  +P +S TMG LY++  DED FLY+A+S EN +G
Sbjct: 61  MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFG 116


>BC014594-1|AAH14594.1|  117|Homo sapiens GABA(A)
           receptor-associated protein-like 2 protein.
          Length = 117

 Score =  149 bits (361), Expect = 8e-36
 Identities = 67/116 (57%), Positives = 87/116 (75%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MK+ +KE+HS E R  E  KIR KYPDRVPVIVEK   +++ D+DK+KYLVPSD+TV QF
Sbjct: 1   MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
            ++IRKRI L  E A+F FV+  +P +S TMG LY++  DED FLY+A+S EN +G
Sbjct: 61  MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFG 116


>BC005985-1|AAH05985.1|  117|Homo sapiens GABA(A)
           receptor-associated protein-like 2 protein.
          Length = 117

 Score =  149 bits (361), Expect = 8e-36
 Identities = 67/116 (57%), Positives = 87/116 (75%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MK+ +KE+HS E R  E  KIR KYPDRVPVIVEK   +++ D+DK+KYLVPSD+TV QF
Sbjct: 1   MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
            ++IRKRI L  E A+F FV+  +P +S TMG LY++  DED FLY+A+S EN +G
Sbjct: 61  MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFG 116


>AJ010569-1|CAA09249.1|  117|Homo sapiens GEF-2 protein protein.
          Length = 117

 Score =  149 bits (361), Expect = 8e-36
 Identities = 67/116 (57%), Positives = 87/116 (75%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MK+ +KE+HS E R  E  KIR KYPDRVPVIVEK   +++ D+DK+KYLVPSD+TV QF
Sbjct: 1   MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
            ++IRKRI L  E A+F FV+  +P +S TMG LY++  DED FLY+A+S EN +G
Sbjct: 61  MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFG 116


>AF087848-1|AAK20400.1|  117|Homo sapiens GABA-A receptor-associated
           protein like 2 protein.
          Length = 117

 Score =  149 bits (361), Expect = 8e-36
 Identities = 67/116 (57%), Positives = 87/116 (75%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MK+ +KE+HS E R  E  KIR KYPDRVPVIVEK   +++ D+DK+KYLVPSD+TV QF
Sbjct: 1   MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
            ++IRKRI L  E A+F FV+  +P +S TMG LY++  DED FLY+A+S EN +G
Sbjct: 61  MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFG 116


>AB030710-1|BAB21548.1|  117|Homo sapiens MAP1 light chain 3 related
           protein protein.
          Length = 117

 Score =  149 bits (361), Expect = 8e-36
 Identities = 67/116 (57%), Positives = 87/116 (75%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MK+ +KE+HS E R  E  KIR KYPDRVPVIVEK   +++ D+DK+KYLVPSD+TV QF
Sbjct: 1   MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
            ++IRKRI L  E A+F FV+  +P +S TMG LY++  DED FLY+A+S EN +G
Sbjct: 61  MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFG 116


>BX571673-3|CAH72477.1|  147|Homo sapiens microtubule-associated
           protein 1 light chain 3 gamma protein.
          Length = 147

 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 45/114 (39%), Positives = 73/114 (64%), Gaps = 2/114 (1%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKAR-LGDLDKKKYLVPSDLTVGQFYFL 232
           +K+  S   R+ E   IR K+P+++PV+VE+ P+   L  LDK K+LVP +LT+ QF  +
Sbjct: 13  FKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFLSI 72

Query: 233 IRKRIHLRPEDALFFFVNN-VIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           IR R+ LR  +A +  VNN  +   SATM  +Y+++ DED F+Y+ ++ +  +G
Sbjct: 73  IRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYASQETFG 126


>BC132988-1|AAI32989.1|  147|Homo sapiens microtubule-associated
           protein 1 light chain 3 gamma protein.
          Length = 147

 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 45/114 (39%), Positives = 73/114 (64%), Gaps = 2/114 (1%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKAR-LGDLDKKKYLVPSDLTVGQFYFL 232
           +K+  S   R+ E   IR K+P+++PV+VE+ P+   L  LDK K+LVP +LT+ QF  +
Sbjct: 13  FKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFLSI 72

Query: 233 IRKRIHLRPEDALFFFVNN-VIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           IR R+ LR  +A +  VNN  +   SATM  +Y+++ DED F+Y+ ++ +  +G
Sbjct: 73  IRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYASQETFG 126


>BC132986-1|AAI32987.1|  147|Homo sapiens microtubule-associated
           protein 1 light chain 3 gamma protein.
          Length = 147

 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 45/114 (39%), Positives = 73/114 (64%), Gaps = 2/114 (1%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKAR-LGDLDKKKYLVPSDLTVGQFYFL 232
           +K+  S   R+ E   IR K+P+++PV+VE+ P+   L  LDK K+LVP +LT+ QF  +
Sbjct: 13  FKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFLSI 72

Query: 233 IRKRIHLRPEDALFFFVNN-VIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           IR R+ LR  +A +  VNN  +   SATM  +Y+++ DED F+Y+ ++ +  +G
Sbjct: 73  IRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYASQETFG 126


>BC127722-1|AAI27723.1|  147|Homo sapiens microtubule-associated
           protein 1 light chain 3 gamma protein.
          Length = 147

 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 45/114 (39%), Positives = 73/114 (64%), Gaps = 2/114 (1%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKAR-LGDLDKKKYLVPSDLTVGQFYFL 232
           +K+  S   R+ E   IR K+P+++PV+VE+ P+   L  LDK K+LVP +LT+ QF  +
Sbjct: 13  FKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFLSI 72

Query: 233 IRKRIHLRPEDALFFFVNN-VIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           IR R+ LR  +A +  VNN  +   SATM  +Y+++ DED F+Y+ ++ +  +G
Sbjct: 73  IRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYASQETFG 126


>AF276659-1|AAK35152.1|  147|Homo sapiens MAP1 light chain 3-like
           protein 2 protein.
          Length = 147

 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 45/114 (39%), Positives = 73/114 (64%), Gaps = 2/114 (1%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKAR-LGDLDKKKYLVPSDLTVGQFYFL 232
           +K+  S   R+ E   IR K+P+++PV+VE+ P+   L  LDK K+LVP +LT+ QF  +
Sbjct: 13  FKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFLSI 72

Query: 233 IRKRIHLRPEDALFFFVNN-VIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           IR R+ LR  +A +  VNN  +   SATM  +Y+++ DED F+Y+ ++ +  +G
Sbjct: 73  IRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYASQETFG 126


>BT007452-1|AAP36120.1|  121|Homo sapiens microtubule-associated
           protein 1 light chain 3 alpha protein.
          Length = 121

 Score = 81.4 bits (192), Expect = 3e-15
 Identities = 38/114 (33%), Positives = 68/114 (59%), Gaps = 2/114 (1%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAP-KARLGDLDKKKYLVPSDLTVGQFYFL 232
           +K+  SF  R  E ++IR ++P ++PVI+E+   + +L  LDK K+LVP  + + +   +
Sbjct: 7   FKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKI 66

Query: 233 IRKRIHLRPEDALFFFVN-NVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           IR+R+ L P  A F  VN + +   S  +  +Y++  DED FLY+ ++ +  +G
Sbjct: 67  IRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG 120


>BC015810-1|AAH15810.1|  121|Homo sapiens microtubule-associated
           protein 1 light chain 3 alpha protein.
          Length = 121

 Score = 81.4 bits (192), Expect = 3e-15
 Identities = 38/114 (33%), Positives = 68/114 (59%), Gaps = 2/114 (1%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAP-KARLGDLDKKKYLVPSDLTVGQFYFL 232
           +K+  SF  R  E ++IR ++P ++PVI+E+   + +L  LDK K+LVP  + + +   +
Sbjct: 7   FKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKI 66

Query: 233 IRKRIHLRPEDALFFFVN-NVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           IR+R+ L P  A F  VN + +   S  +  +Y++  DED FLY+ ++ +  +G
Sbjct: 67  IRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG 120


>AL118520-2|CAI40290.1|  121|Homo sapiens microtubule-associated
           protein 1 light chain 3 alpha protein.
          Length = 121

 Score = 81.4 bits (192), Expect = 3e-15
 Identities = 38/114 (33%), Positives = 68/114 (59%), Gaps = 2/114 (1%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAP-KARLGDLDKKKYLVPSDLTVGQFYFL 232
           +K+  SF  R  E ++IR ++P ++PVI+E+   + +L  LDK K+LVP  + + +   +
Sbjct: 7   FKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKI 66

Query: 233 IRKRIHLRPEDALFFFVN-NVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           IR+R+ L P  A F  VN + +   S  +  +Y++  DED FLY+ ++ +  +G
Sbjct: 67  IRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG 120


>AF276658-1|AAK35151.1|  121|Homo sapiens MAP1 light chain 3-like
           protein 1 protein.
          Length = 121

 Score = 81.4 bits (192), Expect = 3e-15
 Identities = 38/114 (33%), Positives = 68/114 (59%), Gaps = 2/114 (1%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAP-KARLGDLDKKKYLVPSDLTVGQFYFL 232
           +K+  SF  R  E ++IR ++P ++PVI+E+   + +L  LDK K+LVP  + + +   +
Sbjct: 7   FKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKI 66

Query: 233 IRKRIHLRPEDALFFFVN-NVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           IR+R+ L P  A F  VN + +   S  +  +Y++  DED FLY+ ++ +  +G
Sbjct: 67  IRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG 120


>BC067797-1|AAH67797.1|  125|Homo sapiens microtubule-associated
           protein 1 light chain 3 beta protein.
          Length = 125

 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 37/114 (32%), Positives = 67/114 (58%), Gaps = 2/114 (1%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAP-KARLGDLDKKKYLVPSDLTVGQFYFL 232
           +K+  +FE+R  +   IR ++P ++PVI+E+   + +L  LDK K+LVP  + +G+   +
Sbjct: 7   FKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMGELIKI 66

Query: 233 IRKRIHLRPEDALFFFVN-NVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           IR+R+ L    A F  VN + +   S  +  +Y+   DED FLY+ ++ +  +G
Sbjct: 67  IRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFG 120


>BC041874-1|AAH41874.1|  125|Homo sapiens microtubule-associated
           protein 1 light chain 3 beta protein.
          Length = 125

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 36/114 (31%), Positives = 66/114 (57%), Gaps = 2/114 (1%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAP-KARLGDLDKKKYLVPSDLTVGQFYFL 232
           +K+  +FE+R  +   IR ++P ++PVI+E+   + +L  LDK K+LVP  + + +   +
Sbjct: 7   FKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKI 66

Query: 233 IRKRIHLRPEDALFFFVN-NVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           IR+R+ L    A F  VN + +   S  +  +Y+   DED FLY+ ++ +  +G
Sbjct: 67  IRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFG 120


>BC018634-1|AAH18634.1|  125|Homo sapiens microtubule-associated
           protein 1 light chain 3 beta protein.
          Length = 125

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 36/114 (31%), Positives = 66/114 (57%), Gaps = 2/114 (1%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAP-KARLGDLDKKKYLVPSDLTVGQFYFL 232
           +K+  +FE+R  +   IR ++P ++PVI+E+   + +L  LDK K+LVP  + + +   +
Sbjct: 7   FKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKI 66

Query: 233 IRKRIHLRPEDALFFFVN-NVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           IR+R+ L    A F  VN + +   S  +  +Y+   DED FLY+ ++ +  +G
Sbjct: 67  IRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFG 120


>AK025556-1|BAB15169.1|  125|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ21903 fis, clone HEP03579. ).
          Length = 125

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 36/114 (31%), Positives = 66/114 (57%), Gaps = 2/114 (1%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAP-KARLGDLDKKKYLVPSDLTVGQFYFL 232
           +K+  +FE+R  +   IR ++P ++PVI+E+   + +L  LDK K+LVP  + + +   +
Sbjct: 7   FKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKI 66

Query: 233 IRKRIHLRPEDALFFFVN-NVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           IR+R+ L    A F  VN + +   S  +  +Y+   DED FLY+ ++ +  +G
Sbjct: 67  IRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFG 120


>AF303888-1|AAG23182.1|  125|Homo sapiens microtubule-associated
           proteins 1A/1B light chain 3 protein.
          Length = 125

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 36/114 (31%), Positives = 66/114 (57%), Gaps = 2/114 (1%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAP-KARLGDLDKKKYLVPSDLTVGQFYFL 232
           +K+  +FE+R  +   IR ++P ++PVI+E+   + +L  LDK K+LVP  + + +   +
Sbjct: 7   FKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKI 66

Query: 233 IRKRIHLRPEDALFFFVN-NVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           IR+R+ L    A F  VN + +   S  +  +Y+   DED FLY+ ++ +  +G
Sbjct: 67  IRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFG 120


>AF183417-1|AAG09686.1|  125|Homo sapiens microtubule-associated
           proteins 1A/1B light chain 3 protein.
          Length = 125

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 36/114 (31%), Positives = 66/114 (57%), Gaps = 2/114 (1%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAP-KARLGDLDKKKYLVPSDLTVGQFYFL 232
           +K+  +FE+R  +   IR ++P ++PVI+E+   + +L  LDK K+LVP  + + +   +
Sbjct: 7   FKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKI 66

Query: 233 IRKRIHLRPEDALFFFVN-NVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           IR+R+ L    A F  VN + +   S  +  +Y+   DED FLY+ ++ +  +G
Sbjct: 67  IRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFG 120


>AF087871-1|AAM10499.1|  125|Homo sapiens microtubule-associated
           proteins 1A and 1B light chain 3 subunit protein.
          Length = 125

 Score = 77.0 bits (181), Expect = 5e-14
 Identities = 36/114 (31%), Positives = 66/114 (57%), Gaps = 2/114 (1%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAP-KARLGDLDKKKYLVPSDLTVGQFYFL 232
           +K+  +FE+R  +   IR ++P ++PVI+E+   + +L  LDK K+LVP  + + +   +
Sbjct: 7   FKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKI 66

Query: 233 IRKRIHLRPEDALFFFVN-NVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           IR+R+ L    A F  VN + +   S  +  +Y+   DED FLY+ ++ +  +G
Sbjct: 67  IRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFG 120


>AL118520-1|CAC14078.1|  125|Homo sapiens microtubule-associated
           protein 1 light chain 3 alpha protein.
          Length = 125

 Score = 74.1 bits (174), Expect = 4e-13
 Identities = 35/105 (33%), Positives = 63/105 (60%), Gaps = 2/105 (1%)
 Frame = +2

Query: 83  RKAEGEKIRRKYPDRVPVIVEKAP-KARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRP 259
           R  E ++IR ++P ++PVI+E+   + +L  LDK K+LVP  + + +   +IR+R+ L P
Sbjct: 20  RCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNP 79

Query: 260 EDALFFFVN-NVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
             A F  VN + +   S  +  +Y++  DED FLY+ ++ +  +G
Sbjct: 80  TQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG 124


>BC045759-1|AAH45759.1|   66|Homo sapiens MAP1LC3B protein protein.
          Length = 66

 Score = 39.9 bits (89), Expect = 0.008
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 1/55 (1%)
 Frame = +2

Query: 230 LIRKRIHLRPEDALFFFVN-NVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           +IR+R+ L    A F  VN + +   S  +  +Y+   DED FLY+ ++ +  +G
Sbjct: 7   IIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFG 61


>DQ088982-1|AAY68223.1|  221|Homo sapiens glutathione peroxidase 6
           (olfactory) protein.
          Length = 221

 Score = 30.7 bits (66), Expect = 4.6
 Identities = 16/49 (32%), Positives = 23/49 (46%)
 Frame = +2

Query: 185 KYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQ 331
           KY+ P    V  F    +  ++   E  +F F+ N  PPTS  +GS  Q
Sbjct: 120 KYVCPGSGFVPSFQLFEKGDVNGEKEQKVFTFLKNSCPPTSDLLGSSSQ 168


>AY324826-1|AAP85543.1|  221|Homo sapiens glutathione peroxidase 6
           protein.
          Length = 221

 Score = 30.7 bits (66), Expect = 4.6
 Identities = 16/49 (32%), Positives = 23/49 (46%)
 Frame = +2

Query: 185 KYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQ 331
           KY+ P    V  F    +  ++   E  +F F+ N  PPTS  +GS  Q
Sbjct: 120 KYVCPGSGFVPSFQLFEKGDVNGEKEQKVFTFLKNSCPPTSDLLGSSSQ 168


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 87,711,609
Number of Sequences: 237096
Number of extensions: 1940574
Number of successful extensions: 3810
Number of sequences better than 10.0: 41
Number of HSP's better than 10.0 without gapping: 3605
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3776
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7141427170
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).