SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0028
         (956 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC042045-1|AAH42045.1|  890|Homo sapiens GARNL1 protein protein.      100   7e-21
AY596971-1|AAT49272.1| 2083|Homo sapiens tuberin-like protein 1 ...   100   7e-21
AY596970-1|AAT49271.1| 2036|Homo sapiens tuberin-like protein 1 ...   100   7e-21
DQ310704-1|ABC33805.1| 1873|Homo sapiens akt substrate AS250 pro...    85   4e-16
AL161658-3|CAI40814.1| 1739|Homo sapiens RP11-470C13.2 protein.        85   4e-16
AL121896-1|CAI39939.1| 1739|Homo sapiens RP11-470C13.2 protein.        85   4e-16
AL078634-2|CAI95626.1| 1739|Homo sapiens RP11-470C13.2 protein.        85   4e-16
AB033098-1|BAA86586.1| 1023|Homo sapiens KIAA1272 protein protein.     85   4e-16
AK126975-1|BAC86772.1|  702|Homo sapiens protein ( Homo sapiens ...    85   5e-16
J05500-2|AAA60578.1| 2106|Homo sapiens SPTB protein.                   31   6.2  
J05500-1|AAA60579.1| 2137|Homo sapiens SPTB protein.                   31   6.2  
AK092426-1|BAC03887.1|  258|Homo sapiens protein ( Homo sapiens ...    31   6.2  
AB209415-1|BAD92652.1| 2332|Homo sapiens spectrin, beta, erythro...    31   6.2  

>BC042045-1|AAH42045.1|  890|Homo sapiens GARNL1 protein protein.
          Length = 890

 Score =  100 bits (240), Expect = 7e-21
 Identities = 85/306 (27%), Positives = 147/306 (48%), Gaps = 38/306 (12%)
 Frame = +3

Query: 15   PRLPSYVTCLLQMLMMKNKNIAKVVSDCILVLADYTDRIVEMYPGLAGKIIRWICACLAQ 194
            P++   +  +   L   NK +A V  + + +L  Y  R+    P    KII+ + A +  
Sbjct: 166  PQIKEALNVICVSLKFTNKTVAHVACNMLHMLVHYVPRLQIYQPDSPLKIIQILIATITH 225

Query: 195  LSTSCHRDTV---KPLAGSLLLCLAEFAVRCGPQYLME-------EKDG-EQTLLLLIFK 341
            L  S    +    K L  SLLLCL ++ +    + L++       E D  E+++L  I+K
Sbjct: 226  LLPSTEASSYEMDKRLVVSLLLCLLDWIMALPLKTLLQPFHATGAESDKTEKSVLNCIYK 285

Query: 342  VLYAVMKGANG-SDIEGLSLPVDD----DFDPTIQLDNL-------------GPKTIPAS 467
            VL+  + GA   S+     + + D    D+DP + L++L               K  P +
Sbjct: 286  VLHGCVYGAQCFSNPRYFPMSLSDLASVDYDPFMHLESLKEPEPLHSPDSERSSKLQPVT 345

Query: 468  TID-------VKLWAQTICTQLVLYLGHWPLWSG-CQLSCRVSEQHDSP-SLGEELGPAV 620
             +        + + A+T+ T LV +LGH+P+  G   L+ +V E HD+  S   EL P +
Sbjct: 346  EVKTQMQHGLISIAARTVITHLVNHLGHYPMSGGPAMLTSQVCENHDNHYSESTELSPEL 405

Query: 621  LTAPNIQLMRFSDSTLASLIELPALDLPARAGTTPGLTTSERQVRVLLRDIGGKACWDAS 800
              +PNIQ    +++TL S I++ + +     G + GL ++   VR+++RD+ GK  WD++
Sbjct: 406  FESPNIQFFVLNNTTLVSCIQIRSEENMPGGGLSAGLASANSNVRIIVRDLSGKYSWDSA 465

Query: 801  ALYFDP 818
             LY  P
Sbjct: 466  ILYGPP 471


>AY596971-1|AAT49272.1| 2083|Homo sapiens tuberin-like protein 1
            isoform 2 protein.
          Length = 2083

 Score =  100 bits (240), Expect = 7e-21
 Identities = 85/306 (27%), Positives = 147/306 (48%), Gaps = 38/306 (12%)
 Frame = +3

Query: 15   PRLPSYVTCLLQMLMMKNKNIAKVVSDCILVLADYTDRIVEMYPGLAGKIIRWICACLAQ 194
            P++   +  +   L   NK +A V  + + +L  Y  R+    P    KII+ + A +  
Sbjct: 1312 PQIKEALNVICVSLKFTNKTVAHVACNMLHMLVHYVPRLQIYQPDSPLKIIQILIATITH 1371

Query: 195  LSTSCHRDTV---KPLAGSLLLCLAEFAVRCGPQYLME-------EKDG-EQTLLLLIFK 341
            L  S    +    K L  SLLLCL ++ +    + L++       E D  E+++L  I+K
Sbjct: 1372 LLPSTEASSYEMDKRLVVSLLLCLLDWIMALPLKTLLQPFHATGAESDKTEKSVLNCIYK 1431

Query: 342  VLYAVMKGANG-SDIEGLSLPVDD----DFDPTIQLDNL-------------GPKTIPAS 467
            VL+  + GA   S+     + + D    D+DP + L++L               K  P +
Sbjct: 1432 VLHGCVYGAQCFSNPRYFPMSLSDLASVDYDPFMHLESLKEPEPLHSPDSERSSKLQPVT 1491

Query: 468  TID-------VKLWAQTICTQLVLYLGHWPLWSG-CQLSCRVSEQHDSP-SLGEELGPAV 620
             +        + + A+T+ T LV +LGH+P+  G   L+ +V E HD+  S   EL P +
Sbjct: 1492 EVKTQMQHGLISIAARTVITHLVNHLGHYPMSGGPAMLTSQVCENHDNHYSESTELSPEL 1551

Query: 621  LTAPNIQLMRFSDSTLASLIELPALDLPARAGTTPGLTTSERQVRVLLRDIGGKACWDAS 800
              +PNIQ    +++TL S I++ + +     G + GL ++   VR+++RD+ GK  WD++
Sbjct: 1552 FESPNIQFFVLNNTTLVSCIQIRSEENMPGGGLSAGLASANSNVRIIVRDLSGKYSWDSA 1611

Query: 801  ALYFDP 818
             LY  P
Sbjct: 1612 ILYGPP 1617


>AY596970-1|AAT49271.1| 2036|Homo sapiens tuberin-like protein 1
            isoform 1 protein.
          Length = 2036

 Score =  100 bits (240), Expect = 7e-21
 Identities = 85/306 (27%), Positives = 147/306 (48%), Gaps = 38/306 (12%)
 Frame = +3

Query: 15   PRLPSYVTCLLQMLMMKNKNIAKVVSDCILVLADYTDRIVEMYPGLAGKIIRWICACLAQ 194
            P++   +  +   L   NK +A V  + + +L  Y  R+    P    KII+ + A +  
Sbjct: 1312 PQIKEALNVICVSLKFTNKTVAHVACNMLHMLVHYVPRLQIYQPDSPLKIIQILIATITH 1371

Query: 195  LSTSCHRDTV---KPLAGSLLLCLAEFAVRCGPQYLME-------EKDG-EQTLLLLIFK 341
            L  S    +    K L  SLLLCL ++ +    + L++       E D  E+++L  I+K
Sbjct: 1372 LLPSTEASSYEMDKRLVVSLLLCLLDWIMALPLKTLLQPFHATGAESDKTEKSVLNCIYK 1431

Query: 342  VLYAVMKGANG-SDIEGLSLPVDD----DFDPTIQLDNL-------------GPKTIPAS 467
            VL+  + GA   S+     + + D    D+DP + L++L               K  P +
Sbjct: 1432 VLHGCVYGAQCFSNPRYFPMSLSDLASVDYDPFMHLESLKEPEPLHSPDSERSSKLQPVT 1491

Query: 468  TID-------VKLWAQTICTQLVLYLGHWPLWSG-CQLSCRVSEQHDSP-SLGEELGPAV 620
             +        + + A+T+ T LV +LGH+P+  G   L+ +V E HD+  S   EL P +
Sbjct: 1492 EVKTQMQHGLISIAARTVITHLVNHLGHYPMSGGPAMLTSQVCENHDNHYSESTELSPEL 1551

Query: 621  LTAPNIQLMRFSDSTLASLIELPALDLPARAGTTPGLTTSERQVRVLLRDIGGKACWDAS 800
              +PNIQ    +++TL S I++ + +     G + GL ++   VR+++RD+ GK  WD++
Sbjct: 1552 FESPNIQFFVLNNTTLVSCIQIRSEENMPGGGLSAGLASANSNVRIIVRDLSGKYSWDSA 1611

Query: 801  ALYFDP 818
             LY  P
Sbjct: 1612 ILYGPP 1617


>DQ310704-1|ABC33805.1| 1873|Homo sapiens akt substrate AS250 protein.
          Length = 1873

 Score = 85.0 bits (201), Expect = 4e-16
 Identities = 91/325 (28%), Positives = 144/325 (44%), Gaps = 39/325 (12%)
 Frame = +3

Query: 6    TACPRLPSYVTCLLQMLMMKNKNIAKVVSDCILVLADYTDRIVEMYPGLAGKIIRWICAC 185
            T+ P++   +  +   L   NK +A+V  D + +L  Y +++      L  K+   + A 
Sbjct: 1177 TSHPQVKEAINVIGVTLKFPNKIVAQVACDVLQLLVSYWEKLQMFETSLPRKMAEILVAT 1236

Query: 186  LAQLSTSCHRDTV---KPLAGSLLLCLAEFAVRCGPQYLM---------EEKDGEQTLLL 329
            +A L  S    +V   K    SLLLCL ++ +      L+         E+      LL 
Sbjct: 1237 VAFLLPSAEYSSVETDKKFIVSLLLCLLDWCMALPVSVLLHPVSTAVLEEQHSARAPLLD 1296

Query: 330  LIFKVLYAVMKGANGSDIEG---LSLP--VDDDFDPTIQLDNLG---PKTIPAS------ 467
             I++VL+  + G++    +    L+L      D+DP + L N+    P    +S      
Sbjct: 1297 YIYRVLHCCVCGSSTYTQQSHYILTLADLSSTDYDPFLPLANVKSSEPVQYHSSAELGNL 1356

Query: 468  -TID----------VKLWAQTICTQLVLYLGHWPLWSG-CQLSCRVSEQHDSPSL-GEEL 608
             T++          + L A+ +   LV +LGH+PL  G   L   VSE HD+  + G EL
Sbjct: 1357 LTVEEEKKRRSLELIPLTARMVMAHLVNHLGHYPLSGGPAILHSLVSENHDNAHVEGSEL 1416

Query: 609  GPAVLTAPNIQLMRFSDSTLASLIELPALDLPARAGTTPGLTTSERQVRVLLRDIGGKAC 788
               V  +PN+QL  F+DSTL S ++ P        G +P  + S+  VRV++RDI GK  
Sbjct: 1417 SFEVFRSPNLQLFVFNDSTLISYLQTPT---EGPVGGSPVGSLSD--VRVIVRDISGKYS 1471

Query: 789  WDASALYFDPSGGQLEGGPGTQFAL 863
            WD   LY    G     G    F +
Sbjct: 1472 WDGKVLYGPLEGCLAPSGRNPSFLI 1496


>AL161658-3|CAI40814.1| 1739|Homo sapiens RP11-470C13.2 protein.
          Length = 1739

 Score = 85.0 bits (201), Expect = 4e-16
 Identities = 91/325 (28%), Positives = 144/325 (44%), Gaps = 39/325 (12%)
 Frame = +3

Query: 6    TACPRLPSYVTCLLQMLMMKNKNIAKVVSDCILVLADYTDRIVEMYPGLAGKIIRWICAC 185
            T+ P++   +  +   L   NK +A+V  D + +L  Y +++      L  K+   + A 
Sbjct: 993  TSHPQVKEAINVIGVTLKFPNKIVAQVACDVLQLLVSYWEKLQMFETSLPRKMAEILVAT 1052

Query: 186  LAQLSTSCHRDTV---KPLAGSLLLCLAEFAVRCGPQYLM---------EEKDGEQTLLL 329
            +A L  S    +V   K    SLLLCL ++ +      L+         E+      LL 
Sbjct: 1053 VAFLLPSAEYSSVETDKKFIVSLLLCLLDWCMALPVSVLLHPVSTAVLEEQHSARAPLLD 1112

Query: 330  LIFKVLYAVMKGANGSDIEG---LSLP--VDDDFDPTIQLDNLG---PKTIPAS------ 467
             I++VL+  + G++    +    L+L      D+DP + L N+    P    +S      
Sbjct: 1113 YIYRVLHCCVCGSSTYTQQSHYILTLADLSSTDYDPFLPLANVKSSEPVQYHSSAELGNL 1172

Query: 468  -TID----------VKLWAQTICTQLVLYLGHWPLWSG-CQLSCRVSEQHDSPSL-GEEL 608
             T++          + L A+ +   LV +LGH+PL  G   L   VSE HD+  + G EL
Sbjct: 1173 LTVEEEKKRRSLELIPLTARMVMAHLVNHLGHYPLSGGPAILHSLVSENHDNAHVEGSEL 1232

Query: 609  GPAVLTAPNIQLMRFSDSTLASLIELPALDLPARAGTTPGLTTSERQVRVLLRDIGGKAC 788
               V  +PN+QL  F+DSTL S ++ P        G +P  + S+  VRV++RDI GK  
Sbjct: 1233 SFEVFRSPNLQLFVFNDSTLISYLQTPT---EGPVGGSPVGSLSD--VRVIVRDISGKYS 1287

Query: 789  WDASALYFDPSGGQLEGGPGTQFAL 863
            WD   LY    G     G    F +
Sbjct: 1288 WDGKVLYGPLEGCLAPNGRNPSFLI 1312


>AL121896-1|CAI39939.1| 1739|Homo sapiens RP11-470C13.2 protein.
          Length = 1739

 Score = 85.0 bits (201), Expect = 4e-16
 Identities = 91/325 (28%), Positives = 144/325 (44%), Gaps = 39/325 (12%)
 Frame = +3

Query: 6    TACPRLPSYVTCLLQMLMMKNKNIAKVVSDCILVLADYTDRIVEMYPGLAGKIIRWICAC 185
            T+ P++   +  +   L   NK +A+V  D + +L  Y +++      L  K+   + A 
Sbjct: 993  TSHPQVKEAINVIGVTLKFPNKIVAQVACDVLQLLVSYWEKLQMFETSLPRKMAEILVAT 1052

Query: 186  LAQLSTSCHRDTV---KPLAGSLLLCLAEFAVRCGPQYLM---------EEKDGEQTLLL 329
            +A L  S    +V   K    SLLLCL ++ +      L+         E+      LL 
Sbjct: 1053 VAFLLPSAEYSSVETDKKFIVSLLLCLLDWCMALPVSVLLHPVSTAVLEEQHSARAPLLD 1112

Query: 330  LIFKVLYAVMKGANGSDIEG---LSLP--VDDDFDPTIQLDNLG---PKTIPAS------ 467
             I++VL+  + G++    +    L+L      D+DP + L N+    P    +S      
Sbjct: 1113 YIYRVLHCCVCGSSTYTQQSHYILTLADLSSTDYDPFLPLANVKSSEPVQYHSSAELGNL 1172

Query: 468  -TID----------VKLWAQTICTQLVLYLGHWPLWSG-CQLSCRVSEQHDSPSL-GEEL 608
             T++          + L A+ +   LV +LGH+PL  G   L   VSE HD+  + G EL
Sbjct: 1173 LTVEEEKKRRSLELIPLTARMVMAHLVNHLGHYPLSGGPAILHSLVSENHDNAHVEGSEL 1232

Query: 609  GPAVLTAPNIQLMRFSDSTLASLIELPALDLPARAGTTPGLTTSERQVRVLLRDIGGKAC 788
               V  +PN+QL  F+DSTL S ++ P        G +P  + S+  VRV++RDI GK  
Sbjct: 1233 SFEVFRSPNLQLFVFNDSTLISYLQTPT---EGPVGGSPVGSLSD--VRVIVRDISGKYS 1287

Query: 789  WDASALYFDPSGGQLEGGPGTQFAL 863
            WD   LY    G     G    F +
Sbjct: 1288 WDGKVLYGPLEGCLAPNGRNPSFLI 1312


>AL078634-2|CAI95626.1| 1739|Homo sapiens RP11-470C13.2 protein.
          Length = 1739

 Score = 85.0 bits (201), Expect = 4e-16
 Identities = 91/325 (28%), Positives = 144/325 (44%), Gaps = 39/325 (12%)
 Frame = +3

Query: 6    TACPRLPSYVTCLLQMLMMKNKNIAKVVSDCILVLADYTDRIVEMYPGLAGKIIRWICAC 185
            T+ P++   +  +   L   NK +A+V  D + +L  Y +++      L  K+   + A 
Sbjct: 993  TSHPQVKEAINVIGVTLKFPNKIVAQVACDVLQLLVSYWEKLQMFETSLPRKMAEILVAT 1052

Query: 186  LAQLSTSCHRDTV---KPLAGSLLLCLAEFAVRCGPQYLM---------EEKDGEQTLLL 329
            +A L  S    +V   K    SLLLCL ++ +      L+         E+      LL 
Sbjct: 1053 VAFLLPSAEYSSVETDKKFIVSLLLCLLDWCMALPVSVLLHPVSTAVLEEQHSARAPLLD 1112

Query: 330  LIFKVLYAVMKGANGSDIEG---LSLP--VDDDFDPTIQLDNLG---PKTIPAS------ 467
             I++VL+  + G++    +    L+L      D+DP + L N+    P    +S      
Sbjct: 1113 YIYRVLHCCVCGSSTYTQQSHYILTLADLSSTDYDPFLPLANVKSSEPVQYHSSAELGNL 1172

Query: 468  -TID----------VKLWAQTICTQLVLYLGHWPLWSG-CQLSCRVSEQHDSPSL-GEEL 608
             T++          + L A+ +   LV +LGH+PL  G   L   VSE HD+  + G EL
Sbjct: 1173 LTVEEEKKRRSLELIPLTARMVMAHLVNHLGHYPLSGGPAILHSLVSENHDNAHVEGSEL 1232

Query: 609  GPAVLTAPNIQLMRFSDSTLASLIELPALDLPARAGTTPGLTTSERQVRVLLRDIGGKAC 788
               V  +PN+QL  F+DSTL S ++ P        G +P  + S+  VRV++RDI GK  
Sbjct: 1233 SFEVFRSPNLQLFVFNDSTLISYLQTPT---EGPVGGSPVGSLSD--VRVIVRDISGKYS 1287

Query: 789  WDASALYFDPSGGQLEGGPGTQFAL 863
            WD   LY    G     G    F +
Sbjct: 1288 WDGKVLYGPLEGCLAPNGRNPSFLI 1312


>AB033098-1|BAA86586.1| 1023|Homo sapiens KIAA1272 protein protein.
          Length = 1023

 Score = 85.0 bits (201), Expect = 4e-16
 Identities = 91/325 (28%), Positives = 144/325 (44%), Gaps = 39/325 (12%)
 Frame = +3

Query: 6    TACPRLPSYVTCLLQMLMMKNKNIAKVVSDCILVLADYTDRIVEMYPGLAGKIIRWICAC 185
            T+ P++   +  +   L   NK +A+V  D + +L  Y +++      L  K+   + A 
Sbjct: 365  TSHPQVKEAINVIGVTLKFPNKIVAQVACDVLQLLVSYWEKLQMFETSLPRKMAEILVAT 424

Query: 186  LAQLSTSCHRDTV---KPLAGSLLLCLAEFAVRCGPQYLM---------EEKDGEQTLLL 329
            +A L  S    +V   K    SLLLCL ++ +      L+         E+      LL 
Sbjct: 425  VAFLLPSAEYSSVETDKKFIVSLLLCLLDWCMALPVSVLLHPVSTAVLEEQHSARAPLLD 484

Query: 330  LIFKVLYAVMKGANGSDIEG---LSLP--VDDDFDPTIQLDNLG---PKTIPAS------ 467
             I++VL+  + G++    +    L+L      D+DP + L N+    P    +S      
Sbjct: 485  YIYRVLHCCVCGSSTYTQQSHYILTLADLSSTDYDPFLPLANVKSSEPVQYHSSAELGNL 544

Query: 468  -TID----------VKLWAQTICTQLVLYLGHWPLWSG-CQLSCRVSEQHDSPSL-GEEL 608
             T++          + L A+ +   LV +LGH+PL  G   L   VSE HD+  + G EL
Sbjct: 545  LTVEEEKKRRSLELIPLTARMVMAHLVNHLGHYPLSGGPAILHSLVSENHDNAHVEGSEL 604

Query: 609  GPAVLTAPNIQLMRFSDSTLASLIELPALDLPARAGTTPGLTTSERQVRVLLRDIGGKAC 788
               V  +PN+QL  F+DSTL S ++ P        G +P  + S+  VRV++RDI GK  
Sbjct: 605  SFEVFRSPNLQLFVFNDSTLISYLQTPT---EGPVGGSPVGSLSD--VRVIVRDISGKYS 659

Query: 789  WDASALYFDPSGGQLEGGPGTQFAL 863
            WD   LY    G     G    F +
Sbjct: 660  WDGKVLYGPLEGCLAPSGRNPSFLI 684


>AK126975-1|BAC86772.1|  702|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45028 fis, clone BRAWH3018063, highly  similar
           to Rattus norvegicus tuberin-like protein 1 (Tulip1). ).
          Length = 702

 Score = 84.6 bits (200), Expect = 5e-16
 Identities = 69/233 (29%), Positives = 118/233 (50%), Gaps = 35/233 (15%)
 Frame = +3

Query: 225 KPLAGSLLLCLAEFAVRCGPQYLME-------EKDG-EQTLLLLIFKVLYAVMKGANG-S 377
           K L  SLLLCL ++ +    + L++       E D  E+++L  I+KVL+  + GA   S
Sbjct: 3   KRLVVSLLLCLLDWIMALPLKTLLQPFHATGAESDKTEKSVLNCIYKVLHGCVYGAQCFS 62

Query: 378 DIEGLSLPVDD----DFDPTIQLDNL-------------GPKTIPASTID-------VKL 485
           +     + + D    D+DP + L++L               K  P + +        + +
Sbjct: 63  NPRYFPMSLSDLASVDYDPFMHLESLKEPEPLHSPDSERSSKLQPVTEVKTQMQHGLISI 122

Query: 486 WAQTICTQLVLYLGHWPLWSG-CQLSCRVSEQHDSP-SLGEELGPAVLTAPNIQLMRFSD 659
            A+T+ T LV +LGH+P+  G   L+ +V E HD+  S   EL P +  +PNIQ    ++
Sbjct: 123 AARTVITHLVNHLGHYPMSGGPAMLTSQVCENHDNHYSESTELSPELFESPNIQFFVLNN 182

Query: 660 STLASLIELPALDLPARAGTTPGLTTSERQVRVLLRDIGGKACWDASALYFDP 818
           +TL S I++ + +     G + GL ++   VR+++RD+ GK  WD++ LY  P
Sbjct: 183 TTLVSCIQIRSEENMPGGGLSAGLASANSNVRIIVRDLSGKYSWDSAILYGPP 235


>J05500-2|AAA60578.1| 2106|Homo sapiens SPTB protein.
          Length = 2106

 Score = 31.1 bits (67), Expect = 6.2
 Identities = 22/97 (22%), Positives = 46/97 (47%)
 Frame = +3

Query: 45  LQMLMMKNKNIAKVVSDCILVLADYTDRIVEMYPGLAGKIIRWICACLAQLSTSCHRDTV 224
           +++L ++ K + KV+   I      T++++E Y GLA  ++ WI   +  L++    +++
Sbjct: 280 MKVLAVEGKRVGKVIDHAI-----ETEKMIEKYSGLASDLLTWIEQTITVLNSRKFANSL 334

Query: 225 KPLAGSLLLCLAEFAVRCGPQYLMEEKDGEQTLLLLI 335
             +   L        V   P++  +EK   + LL  I
Sbjct: 335 TGVQQQLQAFSTYRTVEKPPKF--QEKGNLEVLLFTI 369


>J05500-1|AAA60579.1| 2137|Homo sapiens SPTB protein.
          Length = 2137

 Score = 31.1 bits (67), Expect = 6.2
 Identities = 22/97 (22%), Positives = 46/97 (47%)
 Frame = +3

Query: 45  LQMLMMKNKNIAKVVSDCILVLADYTDRIVEMYPGLAGKIIRWICACLAQLSTSCHRDTV 224
           +++L ++ K + KV+   I      T++++E Y GLA  ++ WI   +  L++    +++
Sbjct: 280 MKVLAVEGKRVGKVIDHAI-----ETEKMIEKYSGLASDLLTWIEQTITVLNSRKFANSL 334

Query: 225 KPLAGSLLLCLAEFAVRCGPQYLMEEKDGEQTLLLLI 335
             +   L        V   P++  +EK   + LL  I
Sbjct: 335 TGVQQQLQAFSTYRTVEKPPKF--QEKGNLEVLLFTI 369


>AK092426-1|BAC03887.1|  258|Homo sapiens protein ( Homo sapiens
           cDNA FLJ35107 fis, clone PLACE6006871, moderately
           similar to SUPPRESSOR PROTEIN SRP40. ).
          Length = 258

 Score = 31.1 bits (67), Expect = 6.2
 Identities = 45/160 (28%), Positives = 66/160 (41%)
 Frame = -2

Query: 709 LAGRSRAGSSMSEARVESLNRISCMLGAVSTAGPSSSPRDGLSCCSETRQDSWHPLHRGQ 530
           +AG +  GS  S +   S +R       +S++ PSSS     S  S     S    H   
Sbjct: 24  IAGPNALGSGGSRSSSSS-SRSILSSSILSSSIPSSSSSSS-SPSSSHSSSSPSSSHSSS 81

Query: 529 CPRYSTS*VHIV*AQSLTSIVDAGIVLGPRLSSCIVGSKSSSTGRLRPSMSDPFAPFITA 350
            P  S+S        S +S   +     P  SS    S SSS+     S S   +P  ++
Sbjct: 82  SPSSSSS------TSSPSSSSSSSSSSSP--SSSNSSSSSSSSSPSSSSSSSSSSPSSSS 133

Query: 349 YNTLKINSKSVCSPSFSSIKY*GPQRTANSAKHSSSDPAS 230
            +    +S S  SPS SS     P  +++S+  SSS P+S
Sbjct: 134 SSPSSSSSSSSSSPSSSSSS---PSSSSSSSSSSSSSPSS 170


>AB209415-1|BAD92652.1| 2332|Homo sapiens spectrin, beta,
           erythrocytic (includes spherocytosis, clinical type I)
           variant protein.
          Length = 2332

 Score = 31.1 bits (67), Expect = 6.2
 Identities = 22/97 (22%), Positives = 46/97 (47%)
 Frame = +3

Query: 45  LQMLMMKNKNIAKVVSDCILVLADYTDRIVEMYPGLAGKIIRWICACLAQLSTSCHRDTV 224
           +++L ++ K + KV+   I      T++++E Y GLA  ++ WI   +  L++    +++
Sbjct: 284 MKVLAVEGKRVGKVIDHAI-----ETEKMIEKYSGLASDLLTWIEQTITVLNSRKFANSL 338

Query: 225 KPLAGSLLLCLAEFAVRCGPQYLMEEKDGEQTLLLLI 335
             +   L        V   P++  +EK   + LL  I
Sbjct: 339 TGVQQQLQAFSTYRTVEKPPKF--QEKGNLEVLLFTI 373


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 142,729,971
Number of Sequences: 237096
Number of extensions: 3328196
Number of successful extensions: 12197
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 11451
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12162
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 12658656216
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).