SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0026
         (744 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M21243-1|AAC31758.1|  381|Homo sapiens CKB protein.                   171   2e-42
X15334-1|CAA33389.1|  381|Homo sapiens creatine kinase B protein.     171   3e-42
M21494-1|AAA96609.1|  381|Homo sapiens creatine kinase protein.       171   3e-42
M16364-1|AAA76850.1|  381|Homo sapiens protein ( Human creatine ...   171   3e-42
L47647-1|AAA76852.1|  381|Homo sapiens creatine kinase-B protein.     171   3e-42
DQ333313-1|ABC67465.1|  381|Homo sapiens creatine kinase, brain ...   171   3e-42
CR542268-1|CAG47064.1|  381|Homo sapiens CKB protein.                 171   3e-42
BC019281-1|AAH19281.1|  381|Homo sapiens creatine kinase, brain ...   171   3e-42
BC019259-1|AAH19259.1|  381|Homo sapiens creatine kinase, brain ...   171   3e-42
BC010002-1|AAH10002.1|  381|Homo sapiens creatine kinase, brain ...   171   3e-42
BC008323-1|AAH08323.1|  381|Homo sapiens creatine kinase, brain ...   171   3e-42
BC004914-1|AAH04914.1|  381|Homo sapiens creatine kinase, brain ...   171   3e-42
BC001190-1|AAH01190.1|  381|Homo sapiens creatine kinase, brain ...   171   3e-42
AY585238-1|AAS79321.1|  381|Homo sapiens creatine kinase, muscle...   171   3e-42
AC005781-1|AAC62841.1|  381|Homo sapiens KCRM_HUMAN protein.          171   3e-42
BT006793-1|AAP35439.1|  381|Homo sapiens creatine kinase, muscle...   168   2e-41
BC007462-1|AAH07462.1|  381|Homo sapiens creatine kinase, muscle...   168   2e-41
M14780-1|AAA52025.1|  381|Homo sapiens creatine kinase M protein.     164   3e-40
J04469-1|AAA98744.1|  417|Homo sapiens creatine kinase protein.       163   8e-40
BT006628-1|AAP35274.1|  417|Homo sapiens creatine kinase, mitoch...   163   8e-40
BC121002-1|AAI21003.1|  417|Homo sapiens creatine kinase, mitoch...   163   8e-40
BC121001-1|AAI21002.1|  417|Homo sapiens creatine kinase, mitoch...   163   8e-40
BC108652-1|AAI08653.1|  417|Homo sapiens creatine kinase, mitoch...   163   8e-40
BC006467-1|AAH06467.1|  417|Homo sapiens creatine kinase, mitoch...   163   8e-40
BC001926-1|AAH01926.1|  417|Homo sapiens creatine kinase, mitoch...   163   8e-40
AK223365-1|BAD97085.1|  417|Homo sapiens ubiquitous mitochondria...   163   8e-40
M16451-1|AAA76851.1|  381|Homo sapiens creatine kinase-B protein.     161   2e-39
J05401-1|AAA60561.1|  419|Homo sapiens CKMT protein.                  158   2e-38
CR450315-1|CAG29311.1|  419|Homo sapiens CKMT2 protein.               158   2e-38
BC029140-1|AAH29140.1|  419|Homo sapiens CKMT2 protein protein.       158   2e-38
M16440-1|AAA52026.1|   71|Homo sapiens CKM protein.                    46   1e-04
BC025689-1|AAH25689.1|  341|Homo sapiens coiled-coil domain cont...    31   4.4  
AF283374-1|AAL38108.1| 1731|Homo sapiens candidate tumor suppres...    31   4.4  
AF176832-1|AAF70379.1| 4599|Homo sapiens low density lipoprotein...    31   4.4  
AC117947-1|AAX88968.1|  346|Homo sapiens unknown protein.              31   4.4  

>M21243-1|AAC31758.1|  381|Homo sapiens CKB protein.
          Length = 381

 Score =  171 bits (417), Expect = 2e-42
 Identities = 88/193 (45%), Positives = 120/193 (62%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L  M++  QQQLIDDHFLF K     + A+   R WP  RGI+HN+NKTFLVW NEEDHL
Sbjct: 176 LKSMTEAEQQQLIDDHFLFDKPVSPLLSASGMARDWPDARGIWHNDNKTFLVWVNEEDHL 235

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIE-----KKIPFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISMQ GG++++V+ R  + + +IE     K   F  +  LG++  CP+NLGT +RA V
Sbjct: 236 RVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGV 295

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           HI             EV  +  LQ RGT G  T A GGV+D+SN  R+G +E + V+ + 
Sbjct: 296 HI-KLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVV 354

Query: 217 DGIAELIKIEKSL 179
           DG+  LI++E+ L
Sbjct: 355 DGVKLLIEMEQRL 367


>X15334-1|CAA33389.1|  381|Homo sapiens creatine kinase B protein.
          Length = 381

 Score =  171 bits (415), Expect = 3e-42
 Identities = 88/193 (45%), Positives = 120/193 (62%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L  M++  QQQLIDDHFLF K     + A+   R WP  RGI+HN+NKTFLVW NEEDHL
Sbjct: 176 LKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHL 235

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIE-----KKIPFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISMQ GG++++V+ R  + + +IE     K   F  +  LG++  CP+NLGT +RA V
Sbjct: 236 RVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGV 295

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           HI             EV  +  LQ RGT G  T A GGV+D+SN  R+G +E + V+ + 
Sbjct: 296 HI-KLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVV 354

Query: 217 DGIAELIKIEKSL 179
           DG+  LI++E+ L
Sbjct: 355 DGVKLLIEMEQRL 367


>M21494-1|AAA96609.1|  381|Homo sapiens creatine kinase protein.
          Length = 381

 Score =  171 bits (415), Expect = 3e-42
 Identities = 85/194 (43%), Positives = 124/194 (63%), Gaps = 6/194 (3%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDH 566
           PL  M+++ QQQLIDDHFLF K     + A+   R WP  RGI+HN+NK+FLVW NEEDH
Sbjct: 175 PLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDH 234

Query: 565 LRIISMQMGGDLQQVYKRL---VSAVNEIEKKI--PFSHHDRLGFLTFCPTNLGTTVRAS 401
           LR+ISM+ GG++++V++R    +  + EI KK   PF  +  LG++  CP+NLGT +R  
Sbjct: 235 LRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGG 294

Query: 400 VHIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEM 221
           VH+            EE+ ++  LQ RGT G  T A G V+D+SN  R+G +E + V+ +
Sbjct: 295 VHV-KLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLV 353

Query: 220 YDGIAELIKIEKSL 179
            DG+  ++++EK L
Sbjct: 354 VDGVKLMVEMEKKL 367


>M16364-1|AAA76850.1|  381|Homo sapiens protein ( Human creatine
           kinase-B mRNA, complete cds. ).
          Length = 381

 Score =  171 bits (415), Expect = 3e-42
 Identities = 88/193 (45%), Positives = 120/193 (62%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L  M++  QQQLIDDHFLF K     + A+   R WP  RGI+HN+NKTFLVW NEEDHL
Sbjct: 176 LKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHL 235

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIE-----KKIPFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISMQ GG++++V+ R  + + +IE     K   F  +  LG++  CP+NLGT +RA V
Sbjct: 236 RVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGV 295

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           HI             EV  +  LQ RGT G  T A GGV+D+SN  R+G +E + V+ + 
Sbjct: 296 HI-KLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVV 354

Query: 217 DGIAELIKIEKSL 179
           DG+  LI++E+ L
Sbjct: 355 DGVKLLIEMEQRL 367


>L47647-1|AAA76852.1|  381|Homo sapiens creatine kinase-B protein.
          Length = 381

 Score =  171 bits (415), Expect = 3e-42
 Identities = 88/193 (45%), Positives = 120/193 (62%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L  M++  QQQLIDDHFLF K     + A+   R WP  RGI+HN+NKTFLVW NEEDHL
Sbjct: 176 LKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHL 235

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIE-----KKIPFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISMQ GG++++V+ R  + + +IE     K   F  +  LG++  CP+NLGT +RA V
Sbjct: 236 RVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGV 295

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           HI             EV  +  LQ RGT G  T A GGV+D+SN  R+G +E + V+ + 
Sbjct: 296 HI-KLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVV 354

Query: 217 DGIAELIKIEKSL 179
           DG+  LI++E+ L
Sbjct: 355 DGVKLLIEMEQRL 367


>DQ333313-1|ABC67465.1|  381|Homo sapiens creatine kinase, brain
           protein.
          Length = 381

 Score =  171 bits (415), Expect = 3e-42
 Identities = 88/193 (45%), Positives = 120/193 (62%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L  M++  QQQLIDDHFLF K     + A+   R WP  RGI+HN+NKTFLVW NEEDHL
Sbjct: 176 LKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHL 235

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIE-----KKIPFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISMQ GG++++V+ R  + + +IE     K   F  +  LG++  CP+NLGT +RA V
Sbjct: 236 RVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGV 295

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           HI             EV  +  LQ RGT G  T A GGV+D+SN  R+G +E + V+ + 
Sbjct: 296 HI-KLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVV 354

Query: 217 DGIAELIKIEKSL 179
           DG+  LI++E+ L
Sbjct: 355 DGVKLLIEMEQRL 367


>CR542268-1|CAG47064.1|  381|Homo sapiens CKB protein.
          Length = 381

 Score =  171 bits (415), Expect = 3e-42
 Identities = 88/193 (45%), Positives = 120/193 (62%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L  M++  QQQLIDDHFLF K     + A+   R WP  RGI+HN+NKTFLVW NEEDHL
Sbjct: 176 LKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHL 235

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIE-----KKIPFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISMQ GG++++V+ R  + + +IE     K   F  +  LG++  CP+NLGT +RA V
Sbjct: 236 RVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGV 295

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           HI             EV  +  LQ RGT G  T A GGV+D+SN  R+G +E + V+ + 
Sbjct: 296 HI-KLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVV 354

Query: 217 DGIAELIKIEKSL 179
           DG+  LI++E+ L
Sbjct: 355 DGVKLLIEMEQRL 367


>BC019281-1|AAH19281.1|  381|Homo sapiens creatine kinase, brain
           protein.
          Length = 381

 Score =  171 bits (415), Expect = 3e-42
 Identities = 88/193 (45%), Positives = 120/193 (62%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L  M++  QQQLIDDHFLF K     + A+   R WP  RGI+HN+NKTFLVW NEEDHL
Sbjct: 176 LKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHL 235

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIE-----KKIPFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISMQ GG++++V+ R  + + +IE     K   F  +  LG++  CP+NLGT +RA V
Sbjct: 236 RVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGV 295

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           HI             EV  +  LQ RGT G  T A GGV+D+SN  R+G +E + V+ + 
Sbjct: 296 HI-KLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVV 354

Query: 217 DGIAELIKIEKSL 179
           DG+  LI++E+ L
Sbjct: 355 DGVKLLIEMEQRL 367


>BC019259-1|AAH19259.1|  381|Homo sapiens creatine kinase, brain
           protein.
          Length = 381

 Score =  171 bits (415), Expect = 3e-42
 Identities = 88/193 (45%), Positives = 120/193 (62%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L  M++  QQQLIDDHFLF K     + A+   R WP  RGI+HN+NKTFLVW NEEDHL
Sbjct: 176 LKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHL 235

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIE-----KKIPFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISMQ GG++++V+ R  + + +IE     K   F  +  LG++  CP+NLGT +RA V
Sbjct: 236 RVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGV 295

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           HI             EV  +  LQ RGT G  T A GGV+D+SN  R+G +E + V+ + 
Sbjct: 296 HI-KLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVV 354

Query: 217 DGIAELIKIEKSL 179
           DG+  LI++E+ L
Sbjct: 355 DGVKLLIEMEQRL 367


>BC010002-1|AAH10002.1|  381|Homo sapiens creatine kinase, brain
           protein.
          Length = 381

 Score =  171 bits (415), Expect = 3e-42
 Identities = 88/193 (45%), Positives = 120/193 (62%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L  M++  QQQLIDDHFLF K     + A+   R WP  RGI+HN+NKTFLVW NEEDHL
Sbjct: 176 LKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHL 235

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIE-----KKIPFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISMQ GG++++V+ R  + + +IE     K   F  +  LG++  CP+NLGT +RA V
Sbjct: 236 RVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGV 295

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           HI             EV  +  LQ RGT G  T A GGV+D+SN  R+G +E + V+ + 
Sbjct: 296 HI-KLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVV 354

Query: 217 DGIAELIKIEKSL 179
           DG+  LI++E+ L
Sbjct: 355 DGVKLLIEMEQRL 367


>BC008323-1|AAH08323.1|  381|Homo sapiens creatine kinase, brain
           protein.
          Length = 381

 Score =  171 bits (415), Expect = 3e-42
 Identities = 88/193 (45%), Positives = 120/193 (62%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L  M++  QQQLIDDHFLF K     + A+   R WP  RGI+HN+NKTFLVW NEEDHL
Sbjct: 176 LKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHL 235

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIE-----KKIPFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISMQ GG++++V+ R  + + +IE     K   F  +  LG++  CP+NLGT +RA V
Sbjct: 236 RVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGV 295

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           HI             EV  +  LQ RGT G  T A GGV+D+SN  R+G +E + V+ + 
Sbjct: 296 HI-KLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVV 354

Query: 217 DGIAELIKIEKSL 179
           DG+  LI++E+ L
Sbjct: 355 DGVKLLIEMEQRL 367


>BC004914-1|AAH04914.1|  381|Homo sapiens creatine kinase, brain
           protein.
          Length = 381

 Score =  171 bits (415), Expect = 3e-42
 Identities = 88/193 (45%), Positives = 120/193 (62%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L  M++  QQQLIDDHFLF K     + A+   R WP  RGI+HN+NKTFLVW NEEDHL
Sbjct: 176 LKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHL 235

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIE-----KKIPFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISMQ GG++++V+ R  + + +IE     K   F  +  LG++  CP+NLGT +RA V
Sbjct: 236 RVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGV 295

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           HI             EV  +  LQ RGT G  T A GGV+D+SN  R+G +E + V+ + 
Sbjct: 296 HI-KLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVV 354

Query: 217 DGIAELIKIEKSL 179
           DG+  LI++E+ L
Sbjct: 355 DGVKLLIEMEQRL 367


>BC001190-1|AAH01190.1|  381|Homo sapiens creatine kinase, brain
           protein.
          Length = 381

 Score =  171 bits (415), Expect = 3e-42
 Identities = 88/193 (45%), Positives = 120/193 (62%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L  M++  QQQLIDDHFLF K     + A+   R WP  RGI+HN+NKTFLVW NEEDHL
Sbjct: 176 LKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHL 235

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIE-----KKIPFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISMQ GG++++V+ R  + + +IE     K   F  +  LG++  CP+NLGT +RA V
Sbjct: 236 RVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGV 295

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           HI             EV  +  LQ RGT G  T A GGV+D+SN  R+G +E + V+ + 
Sbjct: 296 HI-KLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVV 354

Query: 217 DGIAELIKIEKSL 179
           DG+  LI++E+ L
Sbjct: 355 DGVKLLIEMEQRL 367


>AY585238-1|AAS79321.1|  381|Homo sapiens creatine kinase, muscle
           protein.
          Length = 381

 Score =  171 bits (415), Expect = 3e-42
 Identities = 85/194 (43%), Positives = 124/194 (63%), Gaps = 6/194 (3%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDH 566
           PL  M+++ QQQLIDDHFLF K     + A+   R WP  RGI+HN+NK+FLVW NEEDH
Sbjct: 175 PLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDH 234

Query: 565 LRIISMQMGGDLQQVYKRL---VSAVNEIEKKI--PFSHHDRLGFLTFCPTNLGTTVRAS 401
           LR+ISM+ GG++++V++R    +  + EI KK   PF  +  LG++  CP+NLGT +R  
Sbjct: 235 LRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGG 294

Query: 400 VHIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEM 221
           VH+            EE+ ++  LQ RGT G  T A G V+D+SN  R+G +E + V+ +
Sbjct: 295 VHV-KLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLV 353

Query: 220 YDGIAELIKIEKSL 179
            DG+  ++++EK L
Sbjct: 354 VDGVKLMVEMEKKL 367


>AC005781-1|AAC62841.1|  381|Homo sapiens KCRM_HUMAN protein.
          Length = 381

 Score =  171 bits (415), Expect = 3e-42
 Identities = 85/194 (43%), Positives = 124/194 (63%), Gaps = 6/194 (3%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDH 566
           PL  M+++ QQQLIDDHFLF K     + A+   R WP  RGI+HN+NK+FLVW NEEDH
Sbjct: 175 PLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDH 234

Query: 565 LRIISMQMGGDLQQVYKRL---VSAVNEIEKKI--PFSHHDRLGFLTFCPTNLGTTVRAS 401
           LR+ISM+ GG++++V++R    +  + EI KK   PF  +  LG++  CP+NLGT +R  
Sbjct: 235 LRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGG 294

Query: 400 VHIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEM 221
           VH+            EE+ ++  LQ RGT G  T A G V+D+SN  R+G +E + V+ +
Sbjct: 295 VHV-KLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLV 353

Query: 220 YDGIAELIKIEKSL 179
            DG+  ++++EK L
Sbjct: 354 VDGVKLMVEMEKKL 367


>BT006793-1|AAP35439.1|  381|Homo sapiens creatine kinase, muscle
           protein.
          Length = 381

 Score =  168 bits (409), Expect = 2e-41
 Identities = 84/194 (43%), Positives = 123/194 (63%), Gaps = 6/194 (3%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDH 566
           PL  M+++ QQQLIDDHFLF K     + A+   R WP  RGI+HN+NK+ LVW NEEDH
Sbjct: 175 PLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDH 234

Query: 565 LRIISMQMGGDLQQVYKRL---VSAVNEIEKKI--PFSHHDRLGFLTFCPTNLGTTVRAS 401
           LR+ISM+ GG++++V++R    +  + EI KK   PF  +  LG++  CP+NLGT +R  
Sbjct: 235 LRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGG 294

Query: 400 VHIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEM 221
           VH+            EE+ ++  LQ RGT G  T A G V+D+SN  R+G +E + V+ +
Sbjct: 295 VHV-KLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLV 353

Query: 220 YDGIAELIKIEKSL 179
            DG+  ++++EK L
Sbjct: 354 VDGVKLMVEMEKKL 367


>BC007462-1|AAH07462.1|  381|Homo sapiens creatine kinase, muscle
           protein.
          Length = 381

 Score =  168 bits (409), Expect = 2e-41
 Identities = 84/194 (43%), Positives = 123/194 (63%), Gaps = 6/194 (3%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDH 566
           PL  M+++ QQQLIDDHFLF K     + A+   R WP  RGI+HN+NK+ LVW NEEDH
Sbjct: 175 PLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDH 234

Query: 565 LRIISMQMGGDLQQVYKRL---VSAVNEIEKKI--PFSHHDRLGFLTFCPTNLGTTVRAS 401
           LR+ISM+ GG++++V++R    +  + EI KK   PF  +  LG++  CP+NLGT +R  
Sbjct: 235 LRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGG 294

Query: 400 VHIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEM 221
           VH+            EE+ ++  LQ RGT G  T A G V+D+SN  R+G +E + V+ +
Sbjct: 295 VHV-KLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLV 353

Query: 220 YDGIAELIKIEKSL 179
            DG+  ++++EK L
Sbjct: 354 VDGVKLMVEMEKKL 367


>M14780-1|AAA52025.1|  381|Homo sapiens creatine kinase M protein.
          Length = 381

 Score =  164 bits (398), Expect = 3e-40
 Identities = 82/194 (42%), Positives = 121/194 (62%), Gaps = 6/194 (3%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDH 566
           PL  M+++ QQQLIDDHF F K     + A+   R WP   GI+HN+NK+FLVW NEEDH
Sbjct: 175 PLKSMTEKEQQQLIDDHFQFDKPVSPLLLASGMARHWPDAPGIWHNDNKSFLVWVNEEDH 234

Query: 565 LRIISMQMGGDLQQVYKRL---VSAVNEIEKKI--PFSHHDRLGFLTFCPTNLGTTVRAS 401
           LR+ISM+ GG++++V++R    +  + EI KK   PF  +  LG++  CP+NLGT +R  
Sbjct: 235 LRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGG 294

Query: 400 VHIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEM 221
           VH+            EE+ ++  LQ RGT    T A G V+D+SN  R+G +E + V+ +
Sbjct: 295 VHV-KLAHLSKHPKFEEILTRLRLQKRGTGAVDTAAVGSVFDVSNADRLGSSEVEQVQLV 353

Query: 220 YDGIAELIKIEKSL 179
            DG+  ++++EK L
Sbjct: 354 VDGVKLMVEMEKKL 367


>J04469-1|AAA98744.1|  417|Homo sapiens creatine kinase protein.
          Length = 417

 Score =  163 bits (395), Expect = 8e-40
 Identities = 84/193 (43%), Positives = 118/193 (61%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L+ M++  QQQLIDDHFLF K     + AA   R WP  RGI+HN  K+FL+W NEEDH 
Sbjct: 209 LSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHT 268

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKI-----PFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISM+ GG++++V++R    + E+E+ I      F  ++RLG++  CP+NLGT +RA V
Sbjct: 269 RVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGV 328

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           HI             ++     LQ RGT G  T A GGV+DISN  R+G +E + V+ + 
Sbjct: 329 HI-KLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVI 387

Query: 217 DGIAELIKIEKSL 179
           DG+  LI  E+ L
Sbjct: 388 DGVNYLIDCERRL 400


>BT006628-1|AAP35274.1|  417|Homo sapiens creatine kinase,
           mitochondrial 1 (ubiquitous) protein.
          Length = 417

 Score =  163 bits (395), Expect = 8e-40
 Identities = 84/193 (43%), Positives = 118/193 (61%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L+ M++  QQQLIDDHFLF K     + AA   R WP  RGI+HN  K+FL+W NEEDH 
Sbjct: 209 LSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHT 268

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKI-----PFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISM+ GG++++V++R    + E+E+ I      F  ++RLG++  CP+NLGT +RA V
Sbjct: 269 RVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGV 328

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           HI             ++     LQ RGT G  T A GGV+DISN  R+G +E + V+ + 
Sbjct: 329 HI-KLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVI 387

Query: 217 DGIAELIKIEKSL 179
           DG+  LI  E+ L
Sbjct: 388 DGVNYLIDCERRL 400


>BC121002-1|AAI21003.1|  417|Homo sapiens creatine kinase,
           mitochondrial 1B protein.
          Length = 417

 Score =  163 bits (395), Expect = 8e-40
 Identities = 84/193 (43%), Positives = 118/193 (61%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L+ M++  QQQLIDDHFLF K     + AA   R WP  RGI+HN  K+FL+W NEEDH 
Sbjct: 209 LSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHT 268

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKI-----PFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISM+ GG++++V++R    + E+E+ I      F  ++RLG++  CP+NLGT +RA V
Sbjct: 269 RVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGV 328

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           HI             ++     LQ RGT G  T A GGV+DISN  R+G +E + V+ + 
Sbjct: 329 HI-KLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVI 387

Query: 217 DGIAELIKIEKSL 179
           DG+  LI  E+ L
Sbjct: 388 DGVNYLIDCERRL 400


>BC121001-1|AAI21002.1|  417|Homo sapiens creatine kinase,
           mitochondrial 1B protein.
          Length = 417

 Score =  163 bits (395), Expect = 8e-40
 Identities = 84/193 (43%), Positives = 118/193 (61%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L+ M++  QQQLIDDHFLF K     + AA   R WP  RGI+HN  K+FL+W NEEDH 
Sbjct: 209 LSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHT 268

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKI-----PFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISM+ GG++++V++R    + E+E+ I      F  ++RLG++  CP+NLGT +RA V
Sbjct: 269 RVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGV 328

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           HI             ++     LQ RGT G  T A GGV+DISN  R+G +E + V+ + 
Sbjct: 329 HI-KLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVI 387

Query: 217 DGIAELIKIEKSL 179
           DG+  LI  E+ L
Sbjct: 388 DGVNYLIDCERRL 400


>BC108652-1|AAI08653.1|  417|Homo sapiens creatine kinase,
           mitochondrial 1B protein.
          Length = 417

 Score =  163 bits (395), Expect = 8e-40
 Identities = 84/193 (43%), Positives = 118/193 (61%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L+ M++  QQQLIDDHFLF K     + AA   R WP  RGI+HN  K+FL+W NEEDH 
Sbjct: 209 LSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHT 268

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKI-----PFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISM+ GG++++V++R    + E+E+ I      F  ++RLG++  CP+NLGT +RA V
Sbjct: 269 RVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGV 328

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           HI             ++     LQ RGT G  T A GGV+DISN  R+G +E + V+ + 
Sbjct: 329 HI-KLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVI 387

Query: 217 DGIAELIKIEKSL 179
           DG+  LI  E+ L
Sbjct: 388 DGVNYLIDCERRL 400


>BC006467-1|AAH06467.1|  417|Homo sapiens creatine kinase,
           mitochondrial 1A protein.
          Length = 417

 Score =  163 bits (395), Expect = 8e-40
 Identities = 84/193 (43%), Positives = 118/193 (61%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L+ M++  QQQLIDDHFLF K     + AA   R WP  RGI+HN  K+FL+W NEEDH 
Sbjct: 209 LSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHT 268

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKI-----PFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISM+ GG++++V++R    + E+E+ I      F  ++RLG++  CP+NLGT +RA V
Sbjct: 269 RVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGV 328

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           HI             ++     LQ RGT G  T A GGV+DISN  R+G +E + V+ + 
Sbjct: 329 HI-KLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVI 387

Query: 217 DGIAELIKIEKSL 179
           DG+  LI  E+ L
Sbjct: 388 DGVNYLIDCERRL 400


>BC001926-1|AAH01926.1|  417|Homo sapiens creatine kinase,
           mitochondrial 1A protein.
          Length = 417

 Score =  163 bits (395), Expect = 8e-40
 Identities = 84/193 (43%), Positives = 118/193 (61%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L+ M++  QQQLIDDHFLF K     + AA   R WP  RGI+HN  K+FL+W NEEDH 
Sbjct: 209 LSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHT 268

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKI-----PFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISM+ GG++++V++R    + E+E+ I      F  ++RLG++  CP+NLGT +RA V
Sbjct: 269 RVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGV 328

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           HI             ++     LQ RGT G  T A GGV+DISN  R+G +E + V+ + 
Sbjct: 329 HI-KLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVI 387

Query: 217 DGIAELIKIEKSL 179
           DG+  LI  E+ L
Sbjct: 388 DGVNYLIDCERRL 400


>AK223365-1|BAD97085.1|  417|Homo sapiens ubiquitous mitochondrial
           creatine kinase precursor variant protein.
          Length = 417

 Score =  163 bits (395), Expect = 8e-40
 Identities = 84/193 (43%), Positives = 118/193 (61%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L+ M++  QQQLIDDHFLF K     + AA   R WP  RGI+HN  K+FL+W NEEDH 
Sbjct: 209 LSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHT 268

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKI-----PFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISM+ GG++++V++R    + E+E+ I      F  ++RLG++  CP+NLGT +RA V
Sbjct: 269 RVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGV 328

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           HI             ++     LQ RGT G  T A GGV+DISN  R+G +E + V+ + 
Sbjct: 329 HI-KLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVI 387

Query: 217 DGIAELIKIEKSL 179
           DG+  LI  E+ L
Sbjct: 388 DGVNYLIDCERRL 400


>M16451-1|AAA76851.1|  381|Homo sapiens creatine kinase-B protein.
          Length = 381

 Score =  161 bits (392), Expect = 2e-39
 Identities = 85/193 (44%), Positives = 117/193 (60%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L  M++  QQQLIDDHFLF K     + A+   R WP    I+HN+NKTFLVW NEEDHL
Sbjct: 176 LKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDAARIWHNDNKTFLVWVNEEDHL 235

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIE-----KKIPFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISMQ GG++++V+ R  + + +IE     K   F  +  LG++  CP+NLGT +RA V
Sbjct: 236 RVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGV 295

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
            I             EV  +  LQ RGT G  T A GGV+D+SN  R+G +E + V+ + 
Sbjct: 296 DI-KLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVV 354

Query: 217 DGIAELIKIEKSL 179
           DG+  LI++E+ L
Sbjct: 355 DGVKLLIEMEQRL 367


>J05401-1|AAA60561.1|  419|Homo sapiens CKMT protein.
          Length = 419

 Score =  158 bits (384), Expect = 2e-38
 Identities = 81/193 (41%), Positives = 117/193 (60%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L+ M+++ QQ+LIDDHFLF K     +  A   R WP  RGI+HN +KTFL+W NEEDH 
Sbjct: 210 LSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHT 269

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKI-----PFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISM+ GG++++V++R    + E+E+ I      F  ++RLG++  CP+NLGT +RA V
Sbjct: 270 RVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGV 329

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           H+             ++     LQ RGT G  T A   VYDISN  R+G +E + V+ + 
Sbjct: 330 HV-RIPKLSKDPRFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVI 388

Query: 217 DGIAELIKIEKSL 179
           DG+  L+  EK L
Sbjct: 389 DGVNYLVDCEKKL 401


>CR450315-1|CAG29311.1|  419|Homo sapiens CKMT2 protein.
          Length = 419

 Score =  158 bits (384), Expect = 2e-38
 Identities = 81/193 (41%), Positives = 117/193 (60%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L+ M+++ QQ+LIDDHFLF K     +  A   R WP  RGI+HN +KTFL+W NEEDH 
Sbjct: 210 LSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHT 269

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKI-----PFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISM+ GG++++V++R    + E+E+ I      F  ++RLG++  CP+NLGT +RA V
Sbjct: 270 RVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGV 329

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           H+             ++     LQ RGT G  T A   VYDISN  R+G +E + V+ + 
Sbjct: 330 HV-RIPKLSKDPRFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVI 388

Query: 217 DGIAELIKIEKSL 179
           DG+  L+  EK L
Sbjct: 389 DGVNYLVDCEKKL 401


>BC029140-1|AAH29140.1|  419|Homo sapiens CKMT2 protein protein.
          Length = 419

 Score =  158 bits (384), Expect = 2e-38
 Identities = 81/193 (41%), Positives = 117/193 (60%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L+ M+++ QQ+LIDDHFLF K     +  A   R WP  RGI+HN +KTFL+W NEEDH 
Sbjct: 210 LSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHT 269

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKI-----PFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISM+ GG++++V++R    + E+E+ I      F  ++RLG++  CP+NLGT +RA V
Sbjct: 270 RVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGV 329

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           H+             ++     LQ RGT G  T A   VYDISN  R+G +E + V+ + 
Sbjct: 330 HV-RIPKLSKDPRFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVI 388

Query: 217 DGIAELIKIEKSL 179
           DG+  L+  EK L
Sbjct: 389 DGVNYLVDCEKKL 401


>M16440-1|AAA52026.1|   71|Homo sapiens CKM protein.
          Length = 71

 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 27/69 (39%), Positives = 37/69 (53%), Gaps = 2/69 (2%)
 Frame = -3

Query: 499 VNEIEKKI--PFSHHDRLGFLTFCPTNLGTTVRASVHIXXXXXXXXXXXLEEVASKYHLQ 326
           + EI KK   PF  +  LG++  CP+NLGT +R  VH+            EE+ ++  LQ
Sbjct: 4   IEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHV-XLAHLSKHPKFEEILTRLRLQ 62

Query: 325 VRGTRGEHT 299
            RGT G  T
Sbjct: 63  KRGTGGVDT 71


>BC025689-1|AAH25689.1|  341|Homo sapiens coiled-coil domain
           containing 33 protein.
          Length = 341

 Score = 31.1 bits (67), Expect = 4.4
 Identities = 20/47 (42%), Positives = 24/47 (51%)
 Frame = -2

Query: 560 HHLDADGRRPAAGVQEAGERRQRDREEDPVLAPRPARLPHVLPDQPG 420
           HH  A G  PA G +  G RR+ DRE      PRP R+ H  P + G
Sbjct: 230 HHSAATG--PAGGPRGVGSRRRLDREATRDAWPRPLRV-HRDPARTG 273


>AF283374-1|AAL38108.1| 1731|Homo sapiens candidate tumor suppressor
            protein protein.
          Length = 1731

 Score = 31.1 bits (67), Expect = 4.4
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%)
 Frame = -3

Query: 637  WPTGRGIYHNENKTFLVWCN-EEDHLRIISMQMGGDLQQV 521
            WP G  I + ENK  L WC+   D +  I ++ GG+ + V
Sbjct: 1117 WPNGISIDYEENK--LYWCDARTDKIERIDLETGGNREMV 1154


>AF176832-1|AAF70379.1| 4599|Homo sapiens low density lipoprotein
            receptor related protein-deleted in tumor protein.
          Length = 4599

 Score = 31.1 bits (67), Expect = 4.4
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%)
 Frame = -3

Query: 637  WPTGRGIYHNENKTFLVWCN-EEDHLRIISMQMGGDLQQV 521
            WP G  I + ENK  L WC+   D +  I ++ GG+ + V
Sbjct: 2041 WPNGISIDYEENK--LYWCDARTDKIERIDLETGGNREMV 2078


>AC117947-1|AAX88968.1|  346|Homo sapiens unknown protein.
          Length = 346

 Score = 31.1 bits (67), Expect = 4.4
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%)
 Frame = -3

Query: 637 WPTGRGIYHNENKTFLVWCN-EEDHLRIISMQMGGDLQQV 521
           WP G  I + ENK  L WC+   D +  I ++ GG+ + V
Sbjct: 121 WPNGISIDYEENK--LYWCDARTDKIERIDLETGGNREMV 158


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 74,549,180
Number of Sequences: 237096
Number of extensions: 1416220
Number of successful extensions: 4652
Number of sequences better than 10.0: 35
Number of HSP's better than 10.0 without gapping: 4345
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4561
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8903143626
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).