SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0024
         (892 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X63237-1|CAA44911.1|  156|Homo sapiens ubiquitin protein.             194   5e-49
S79522-1|AAB21188.1|  156|Homo sapiens ubiquitin carboxyl extens...   194   5e-49
M10939-1|AAA36788.1|  152|Homo sapiens protein ( Human ubiquitin...   194   5e-49
BC066293-1|AAH66293.1|  156|Homo sapiens ribosomal protein S27a ...   194   5e-49
BC001392-1|AAH01392.1|  156|Homo sapiens ribosomal protein S27a ...   194   5e-49
BC053371-1|AAH53371.1|  156|Homo sapiens ribosomal protein S27a ...   190   6e-48
AB061854-1|BAB79488.1|  121|Homo sapiens ribosomal protein S27A ...   155   2e-37
X56999-1|CAA40314.1|  128|Homo sapiens ubiquitin-52 amino acid  ...   112   2e-24
X56998-1|CAA40313.1|  128|Homo sapiens ubiquitin-52 amino acid  ...   112   2e-24
X56997-1|CAA40312.1|  128|Homo sapiens ubiquitin-52 amino acid f...   112   2e-24
X04803-1|CAA28495.1|  229|Homo sapiens ubiquitin protein.             112   2e-24
M26880-1|AAA36789.1|  685|Homo sapiens protein ( Human ubiquitin...   112   2e-24
M17597-1|AAA36787.1|  269|Homo sapiens protein ( Human poly-ubiq...   112   2e-24
D63791-1|BAA09860.1|  611|Homo sapiens polyubiquitin protein.         112   2e-24
DQ479851-1|ABE96835.1|  128|Homo sapiens ubiquitin A-52 residue ...   112   2e-24
BT020104-1|AAV38907.1|  229|Homo sapiens ubiquitin B protein.         112   2e-24
BC101832-1|AAI01833.1|  128|Homo sapiens ubiquitin A-52 residue ...   112   2e-24
BC101830-1|AAI01831.1|  128|Homo sapiens ubiquitin A-52 residue ...   112   2e-24
BC080583-1|AAH80583.1|  698|Homo sapiens Unknown (protein for IM...   112   2e-24
BC046123-1|AAH46123.1|  229|Homo sapiens ubiquitin B protein.         112   2e-24
BC039193-1|AAH39193.1|  685|Homo sapiens ubiquitin C protein.         112   2e-24
BC038999-1|AAH38999.1|  229|Homo sapiens ubiquitin B protein.         112   2e-24
BC031027-1|AAH31027.1|  229|Homo sapiens ubiquitin B protein.         112   2e-24
BC026301-1|AAH26301.1|  229|Homo sapiens ubiquitin B protein.         112   2e-24
BC015127-1|AAH15127.1|  229|Homo sapiens ubiquitin B protein.         112   2e-24
BC014880-1|AAH14880.1|  305|Homo sapiens UBC protein protein.         112   2e-24
BC009301-1|AAH09301.1|  229|Homo sapiens ubiquitin B protein.         112   2e-24
BC008955-1|AAH08955.2|  546|Homo sapiens UBC protein protein.         112   2e-24
BC000379-1|AAH00379.1|  229|Homo sapiens ubiquitin B protein.         112   2e-24
AY819759-1|AAV68344.1|  229|Homo sapiens ubiquitin C splice vari...   112   2e-24
AY732488-1|AAV33127.1|  153|Homo sapiens ubiquitin C splice vari...   112   2e-24
AL117514-1|CAB55973.1|  239|Homo sapiens hypothetical protein pr...   112   2e-24
AK056939-1|BAB71316.1|  388|Homo sapiens protein ( Homo sapiens ...   112   2e-24
AF348700-1|AAK31162.1|  141|Homo sapiens ubiquitin A-52 residue ...   112   2e-24
AC005253-2|AAC25582.1|  128|Homo sapiens ubiquitin-52 amino acid...   112   2e-24
AB209782-1|BAD93019.1| 1309|Homo sapiens ubiquitin C variant pro...   112   2e-24
AB089617-1|BAC56955.1|  229|Homo sapiens polyubiquitin B protein.     112   2e-24
AB089613-1|BAC56951.1|  685|Homo sapiens polyubiquitin C protein.     112   2e-24
AB009010-1|BAA23632.1|  685|Homo sapiens polyubiquitin UbC protein.   112   2e-24
AB003730-1|BAA23486.1|  609|Homo sapiens polyubiquitin protein.       112   2e-24
AK127995-1|BAC87221.1|  186|Homo sapiens protein ( Homo sapiens ...   110   6e-24
BC042362-1|AAH42362.1|   95|Homo sapiens RPS27A protein protein.       99   2e-20
AB007163-1|BAA25826.1|   51|Homo sapiens ribosomal protein S27a ...    83   1e-15
D23662-1|BAA04889.1|   81|Homo sapiens ubiquitin-like protein pr...    73   2e-12
CR407662-1|CAG28590.1|   81|Homo sapiens NEDD8 protein.                73   2e-12
BC104664-1|AAI04665.1|   81|Homo sapiens neural precursor cell e...    73   2e-12
BC104201-1|AAI04202.1|   81|Homo sapiens neural precursor cell e...    73   2e-12
BC104200-1|AAI04201.1|   81|Homo sapiens neural precursor cell e...    73   2e-12
Y00361-1|CAA68439.1|   89|Homo sapiens ubiquitin precursor protein.    66   1e-10
L44140-7|AAA92650.1|  157|Homo sapiens protein ( , complete cds'...    50   9e-06
J03589-1|AAA36790.1|  157|Homo sapiens protein ( Human ubiquitin...    50   9e-06
BX664739-2|CAI43235.1|  157|Homo sapiens ubiquitin-like 4 protein.     50   9e-06
BX664739-1|CAI43234.1|  180|Homo sapiens ubiquitin-like 4 protein.     50   9e-06
BC053589-1|AAH53589.1|  157|Homo sapiens ubiquitin-like 4A protein.    50   9e-06
BC043346-1|AAH43346.1|  157|Homo sapiens ubiquitin-like 4A protein.    50   9e-06
BC045587-1|AAH45587.2|  727|Homo sapiens ANUBL1 protein protein.       50   1e-05
AL445201-5|CAH72970.1|  115|Homo sapiens AN1, ubiquitin-like, ho...    50   1e-05
AL445201-4|CAH72968.1|  224|Homo sapiens AN1, ubiquitin-like, ho...    50   1e-05
AL445201-3|CAH72967.1|  727|Homo sapiens AN1, ubiquitin-like, ho...    50   1e-05
AF311324-1|AAG33850.1|  727|Homo sapiens ubiquitin-like fusion p...    50   1e-05
EF560733-1|ABQ59043.1|  793|Homo sapiens UHRF1 protein protein.        49   3e-05
BC113875-1|AAI13876.2|  806|Homo sapiens ubiquitin-like, contain...    49   3e-05
AY787925-1|AAV40831.1|  793|Homo sapiens ubiquitin-like, contain...    49   3e-05
AF274048-1|AAK55744.1|  793|Homo sapiens nuclear zinc finger pro...    49   3e-05
AF129507-1|AAF28469.1|  793|Homo sapiens transcription factor IC...    49   3e-05
AB177624-1|BAF36720.1|  793|Homo sapiens hNP95 protein.                49   3e-05
AB177623-1|BAF36719.1|  793|Homo sapiens hNP95 protein.                49   3e-05
Y12653-1|CAA73200.1|  165|Homo sapiens diubiquitin protein.            47   1e-04
BX000688-3|CAI18599.1|  165|Homo sapiens ubiquitin D protein.          47   1e-04
BC012472-1|AAH12472.1|  165|Homo sapiens ubiquitin D protein.          47   1e-04
AL662826-3|CAI17384.1|  165|Homo sapiens ubiquitin D protein.          47   1e-04
AL645936-2|CAI18010.1|  165|Homo sapiens ubiquitin D protein.          47   1e-04
AL031983-3|CAA21458.1|  165|Homo sapiens ubiquitin D protein.          47   1e-04
AF123050-1|AAD52982.1|  165|Homo sapiens ubiquitin-like protein ...    47   1e-04
BC117410-1|AAI17411.1|  514|Homo sapiens 2'-5'-oligoadenylate sy...    44   7e-04
BC117408-1|AAI17409.1|  514|Homo sapiens 2'-5'-oligoadenylate sy...    44   7e-04
AJ225089-1|CAA12396.1|  514|Homo sapiens 2'-5' oligoadenylate sy...    44   7e-04
AF063611-1|AAD28541.1|  513|Homo sapiens 2'-5'oligoadenylate syn...    44   7e-04
EF375726-1|ABN46990.1|  465|Homo sapiens parkin 2 protein.             43   0.002
BC022014-1|AAH22014.1|  387|Homo sapiens PARK2 protein protein.        43   0.002
AL445215-2|CAH73682.1|  437|Homo sapiens Parkinson disease (auto...    43   0.002
AL445215-1|CAH73681.1|  465|Homo sapiens Parkinson disease (auto...    43   0.002
AL132982-2|CAI23602.1|  437|Homo sapiens Parkinson disease (auto...    43   0.002
AL132982-1|CAI23601.1|  465|Homo sapiens Parkinson disease (auto...    43   0.002
AL035697-3|CAI21386.1|  437|Homo sapiens Parkinson disease (auto...    43   0.002
AL035697-2|CAI21385.1|  465|Homo sapiens Parkinson disease (auto...    43   0.002
AL035697-1|CAI21384.1|  368|Homo sapiens Parkinson disease (auto...    43   0.002
AB245403-1|BAF43729.1|  465|Homo sapiens parkin 2 protein.             43   0.002
AB009973-1|BAA25751.1|  465|Homo sapiens Parkin protein.               43   0.002
BC007331-1|AAH07331.1|  227|Homo sapiens ubiquitin domain contai...    41   0.005
AL359388-3|CAI14191.1|  227|Homo sapiens ubiquitin domain contai...    41   0.005
AK021869-1|BAB13921.1|  227|Homo sapiens protein ( Homo sapiens ...    41   0.005
AK222597-1|BAD96317.1|  227|Homo sapiens ubiquitin domain contai...    40   0.012
AB062071-1|BAB79490.1|   34|Homo sapiens ribosomal protein S27a ...    40   0.012
BC028397-1|AAH28397.1|  503|Homo sapiens UHRF2 protein protein.        40   0.016
AL353718-4|CAH74119.1|  802|Homo sapiens ubiquitin-like, contain...    40   0.016
AL133480-6|CAI13294.1|  136|Homo sapiens ubiquitin-like, contain...    40   0.016
AL133480-5|CAI13293.1|  802|Homo sapiens ubiquitin-like, contain...    40   0.016
AL118499-2|CAC00663.1|   18|Homo sapiens chromosome 20 open read...    40   0.016
AF274049-1|AAM33799.1|  802|Homo sapiens nuclear zinc finger pro...    40   0.016
AB071698-1|BAB68317.1|  802|Homo sapiens Np95-like ring finger p...    40   0.016
X65923-1|CAA46716.1|  133|Homo sapiens fau protein.                    39   0.028
X65921-1|CAA46714.1|  133|Homo sapiens fau 1 protein.                  39   0.028
CR541974-1|CAG46772.1|  133|Homo sapiens FAU protein.                  39   0.028
BC033877-1|AAH33877.1|  133|Homo sapiens Finkel-Biskis-Reilly mu...    39   0.028
AY398663-1|AAQ87877.1|  133|Homo sapiens Finkel-Biskis-Reilly mu...    39   0.028
AK026639-1|BAB15515.1|  133|Homo sapiens protein ( Homo sapiens ...    39   0.028
X85237-1|CAA59494.1|  793|Homo sapiens human splicing factor pro...    38   0.037
D21235-1|BAA04767.1|  363|Homo sapiens HHR23A protein protein.         38   0.037
CR456575-1|CAG30461.1|  793|Homo sapiens SF3A1 protein.                38   0.037
BC088364-1|AAH88364.1|  362|Homo sapiens RAD23 homolog A (S. cer...    38   0.037
BC058929-1|AAH58929.1|  174|Homo sapiens ubiquitin-like 4B protein.    38   0.037
BC014026-1|AAH14026.1|  363|Homo sapiens RAD23 homolog A (S. cer...    38   0.037
BC007684-1|AAH07684.1|  793|Homo sapiens splicing factor 3a, sub...    38   0.037
BC001976-1|AAH01976.1|  793|Homo sapiens splicing factor 3a, sub...    38   0.037
AK098556-1|BAC05331.1|  174|Homo sapiens protein ( Homo sapiens ...    38   0.037
AF549209-1|AAN39383.1|  363|Homo sapiens RAD23 homolog A (S. cer...    38   0.037
AD000092-7|AAB51177.1|  363|Homo sapiens human RAD23A homolog pr...    38   0.037
AC004997-4|AAC23435.1|  793|Homo sapiens spliceosome associated ...    38   0.037
AB209713-1|BAD92950.1|  379|Homo sapiens UV excision repair prot...    38   0.037
BC019910-1|AAH19910.1|  190|Homo sapiens UBTD2 protein protein.        38   0.065
AF251700-1|AAL99389.1|  106|Homo sapiens ubiquitin-like protein ...    38   0.065
M33521-1|AAA35588.1| 1132|Homo sapiens protein ( Human HLA-B-ass...    37   0.085
M33519-1|AAA35587.1| 1132|Homo sapiens protein ( Human HLA-B-ass...    37   0.085
BC063841-1|AAH63841.1|  601|Homo sapiens ubiquilin 4 protein.          37   0.11 
BC036743-1|AAH36743.1|  655|Homo sapiens ubiquilin 3 protein.          37   0.11 
BC018403-1|AAH18403.1|  601|Homo sapiens ubiquilin 4 protein.          37   0.11 
AL355388-14|CAH72633.1|  601|Homo sapiens ubiquilin 4 protein.         37   0.11 
AL355388-13|CAH72634.1|  226|Homo sapiens ubiquilin 4 protein.         37   0.11 
AK023354-1|BAB14539.1|  314|Homo sapiens protein ( Homo sapiens ...    37   0.11 
AF230481-1|AAF67143.1|  655|Homo sapiens ubiquilin 3 protein.          37   0.11 
AF188240-1|AAF80171.1|  601|Homo sapiens A1U protein.                  37   0.11 
AF137396-1|AAG41675.1|  670|Homo sapiens ubiquilin 3 protein.          37   0.11 
AB209566-1|BAD92803.1|  600|Homo sapiens ataxin-1 ubiquitin-like...    37   0.11 
BX511262-22|CAM45813.1|  158|Homo sapiens HLA-B associated trans...    36   0.15 
BX511262-21|CAM45812.1|  233|Homo sapiens HLA-B associated trans...    36   0.15 
BX511262-20|CAM45807.1|  262|Homo sapiens HLA-B associated trans...    36   0.15 
BX511262-19|CAM45805.1|  262|Homo sapiens HLA-B associated trans...    36   0.15 
BX511262-18|CAM45803.1|  259|Homo sapiens HLA-B associated trans...    36   0.15 
BX511262-17|CAM45811.1|  215|Homo sapiens HLA-B associated trans...    36   0.15 
BX511262-16|CAM45810.1|  206|Homo sapiens HLA-B associated trans...    36   0.15 
BX511262-15|CAM45809.1|  244|Homo sapiens HLA-B associated trans...    36   0.15 
BX511262-14|CAM45808.1|  244|Homo sapiens HLA-B associated trans...    36   0.15 
BX511262-13|CAM45806.1|  197|Homo sapiens HLA-B associated trans...    36   0.15 
BX511262-12|CAM45804.1|  258|Homo sapiens HLA-B associated trans...    36   0.15 
BX511262-11|CAM45802.1|  515|Homo sapiens HLA-B associated trans...    36   0.15 
BX511262-10|CAM45801.1|  743|Homo sapiens HLA-B associated trans...    36   0.15 
BX511262-9|CAM45800.1| 1132|Homo sapiens HLA-B associated transc...    36   0.15 
BX511262-8|CAM45799.1| 1126|Homo sapiens HLA-B associated transc...    36   0.15 
BC003133-1|AAH03133.1| 1126|Homo sapiens HLA-B associated transc...    36   0.15 
BA000025-30|BAB63390.1| 1126|Homo sapiens BAT3 protein.                36   0.15 
AL805934-24|CAO03665.1|  158|Homo sapiens HLA-B associated trans...    36   0.15 
AL805934-23|CAO03664.1|  233|Homo sapiens HLA-B associated trans...    36   0.15 
AL805934-22|CAO03663.1|  259|Homo sapiens HLA-B associated trans...    36   0.15 
AL805934-21|CAI18503.2|  206|Homo sapiens HLA-B associated trans...    36   0.15 
AL805934-20|CAI18505.2|  262|Homo sapiens HLA-B associated trans...    36   0.15 
AL805934-19|CAI18509.1|  262|Homo sapiens HLA-B associated trans...    36   0.15 
AL805934-18|CAO03662.1|  244|Homo sapiens HLA-B associated trans...    36   0.15 
AL805934-17|CAO03661.1|  215|Homo sapiens HLA-B associated trans...    36   0.15 
AL805934-16|CAO03660.1|  258|Homo sapiens HLA-B associated trans...    36   0.15 
AL805934-15|CAO03659.1|  244|Homo sapiens HLA-B associated trans...    36   0.15 
AL805934-14|CAO03658.1|  197|Homo sapiens HLA-B associated trans...    36   0.15 
AL805934-13|CAI18506.2|  515|Homo sapiens HLA-B associated trans...    36   0.15 
AL805934-12|CAI18508.2|  743|Homo sapiens HLA-B associated trans...    36   0.15 
AL805934-11|CAI18504.1| 1132|Homo sapiens HLA-B associated trans...    36   0.15 
AL805934-10|CAI18501.1| 1126|Homo sapiens HLA-B associated trans...    36   0.15 
AL670886-15|CAM25024.1|  158|Homo sapiens HLA-B associated trans...    36   0.15 
AL670886-14|CAM25023.1|  233|Homo sapiens HLA-B associated trans...    36   0.15 
AL670886-13|CAM25018.1|  258|Homo sapiens HLA-B associated trans...    36   0.15 
AL670886-12|CAM25021.1|  197|Homo sapiens HLA-B associated trans...    36   0.15 
AL670886-11|CAM25017.1|  206|Homo sapiens HLA-B associated trans...    36   0.15 
AL670886-10|CAM25015.1|  215|Homo sapiens HLA-B associated trans...    36   0.15 
AL670886-9|CAM25022.1|  262|Homo sapiens HLA-B associated transc...    36   0.15 
AL670886-8|CAM25019.1|  244|Homo sapiens HLA-B associated transc...    36   0.15 
AL670886-7|CAM25016.1|  244|Homo sapiens HLA-B associated transc...    36   0.15 
AL670886-6|CAI17786.1|  262|Homo sapiens HLA-B associated transc...    36   0.15 
AL670886-5|CAM25020.1|  259|Homo sapiens HLA-B associated transc...    36   0.15 
AL670886-4|CAI17787.2|  515|Homo sapiens HLA-B associated transc...    36   0.15 
AL670886-3|CAM25014.1|  743|Homo sapiens HLA-B associated transc...    36   0.15 
AL670886-2|CAI17785.1| 1132|Homo sapiens HLA-B associated transc...    36   0.15 
AL670886-1|CAI17784.1| 1126|Homo sapiens HLA-B associated transc...    36   0.15 
AL662847-15|CAO72082.1|  158|Homo sapiens HLA-B associated trans...    36   0.15 
AL662847-14|CAO72081.1|  233|Homo sapiens HLA-B associated trans...    36   0.15 
AL662847-13|CAO72079.1|  258|Homo sapiens HLA-B associated trans...    36   0.15 
AL662847-12|CAO72077.1|  197|Homo sapiens HLA-B associated trans...    36   0.15 
AL662847-11|CAO72076.1|  206|Homo sapiens HLA-B associated trans...    36   0.15 
AL662847-10|CAO72075.1|  215|Homo sapiens HLA-B associated trans...    36   0.15 
AL662847-9|CAO72080.1|  262|Homo sapiens HLA-B associated transc...    36   0.15 
AL662847-8|CAO72078.1|  244|Homo sapiens HLA-B associated transc...    36   0.15 
AL662847-7|CAO72073.1|  244|Homo sapiens HLA-B associated transc...    36   0.15 
AL662847-6|CAI17660.1|  262|Homo sapiens HLA-B associated transc...    36   0.15 
AL662847-5|CAO72074.1|  259|Homo sapiens HLA-B associated transc...    36   0.15 
AL662847-4|CAI17661.2|  515|Homo sapiens HLA-B associated transc...    36   0.15 
AL662847-3|CAO72072.1|  743|Homo sapiens HLA-B associated transc...    36   0.15 
AL662847-2|CAI17659.1| 1132|Homo sapiens HLA-B associated transc...    36   0.15 
AL662847-1|CAI17658.1| 1126|Homo sapiens HLA-B associated transc...    36   0.15 
AL662801-67|CAM25604.1|  158|Homo sapiens HLA-B associated trans...    36   0.15 
AL662801-66|CAM25603.1|  233|Homo sapiens HLA-B associated trans...    36   0.15 
AL662801-65|CAM25602.1|  244|Homo sapiens HLA-B associated trans...    36   0.15 
AL662801-64|CAM25601.1|  206|Homo sapiens HLA-B associated trans...    36   0.15 
AL662801-63|CAM25600.1|  215|Homo sapiens HLA-B associated trans...    36   0.15 
AL662801-62|CAM25599.1|  262|Homo sapiens HLA-B associated trans...    36   0.15 
AL662801-61|CAM25598.1|  262|Homo sapiens HLA-B associated trans...    36   0.15 
AL662801-60|CAM25597.1|  244|Homo sapiens HLA-B associated trans...    36   0.15 
AL662801-59|CAM25596.1|  197|Homo sapiens HLA-B associated trans...    36   0.15 
AL662801-58|CAM25595.1|  259|Homo sapiens HLA-B associated trans...    36   0.15 
AL662801-57|CAM25594.1|  258|Homo sapiens HLA-B associated trans...    36   0.15 
AL662801-56|CAI18318.2|  515|Homo sapiens HLA-B associated trans...    36   0.15 
AL662801-55|CAI18316.2|  743|Homo sapiens HLA-B associated trans...    36   0.15 
AL662801-54|CAI18314.1| 1132|Homo sapiens HLA-B associated trans...    36   0.15 
AL662801-53|CAI18315.1| 1126|Homo sapiens HLA-B associated trans...    36   0.15 
AF129756-16|AAD18085.1| 1229|Homo sapiens BAT3 protein.                36   0.15 
BC039294-1|AAH39294.1|  589|Homo sapiens ubiquilin 1 protein.          36   0.26 
BC010066-1|AAH10066.1|  561|Homo sapiens ubiquilin 1 protein.          36   0.26 
AL445215-3|CAH73683.1|  316|Homo sapiens Parkinson disease (auto...    36   0.26 
AL354920-5|CAI15101.1|  589|Homo sapiens ubiquilin 1 protein.          36   0.26 
AL354920-4|CAI15100.1|  561|Homo sapiens ubiquilin 1 protein.          36   0.26 
AL132982-3|CAI23603.1|  316|Homo sapiens Parkinson disease (auto...    36   0.26 
AL035697-4|CAI21387.1|  316|Homo sapiens Parkinson disease (auto...    36   0.26 
AK074535-1|BAC11045.1|  316|Homo sapiens protein ( Homo sapiens ...    36   0.26 
AF293384-1|AAG02473.1|  589|Homo sapiens PLIC-1 protein.               36   0.26 
AF176069-1|AAD49751.3|  589|Homo sapiens ubiquilin protein.            36   0.26 
M21786-1|AAA36128.1|  165|Homo sapiens protein ( Human interfero...    33   1.4  
M13755-1|AAA36038.1|  165|Homo sapiens protein ( Human interfero...    33   1.4  
BT007297-1|AAP35961.1|  165|Homo sapiens interferon, alpha-induc...    33   1.4  
BC009507-1|AAH09507.1|  165|Homo sapiens ISG15 ubiquitin-like mo...    33   1.4  
AY168648-1|AAN86983.1|  165|Homo sapiens ubiquitin-like protein ...    33   1.4  
AL645608-12|CAI15574.1|  165|Homo sapiens ISG15 ubiquitin-like m...    33   1.4  
BC069237-1|AAH69237.1|  624|Homo sapiens UBQLN2 protein protein.       33   1.8  
AL442081-1|CAC09446.1|  588|Homo sapiens hypothetical protein pr...    33   1.8  
AL354793-1|CAD13519.1|  624|Homo sapiens ubiquilin 2 protein.          33   1.8  
AF293385-1|AAG02474.1|  624|Homo sapiens PLIC-2 protein.               33   1.8  
AF189009-1|AAF17237.1|  624|Homo sapiens ubiquitin-like product ...    33   1.8  
AB035275-1|BAB20436.1|  589|Homo sapiens DA41 protein.                 33   1.8  
X14329-1|CAA32507.1|  458|Homo sapiens protein ( Human mRNA for ...    30   9.8  
BC027897-1|AAH27897.1|  458|Homo sapiens carboxypeptidase N, pol...    30   9.8  
AL441886-3|CAI13078.1|  458|Homo sapiens carboxypeptidase N, pol...    30   9.8  

>X63237-1|CAA44911.1|  156|Homo sapiens ubiquitin protein.
          Length = 156

 Score =  194 bits (472), Expect = 5e-49
 Identities = 98/140 (70%), Positives = 106/140 (75%), Gaps = 1/140 (0%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXX 712
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV      
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG 76

Query: 711 XXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVME 532
                 K+Y+TP          KLAVL++YKVDENGKI RLRREC  ++CGAGVFMA   
Sbjct: 77  AKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHF 136

Query: 531 DRHYCGKCHSTMVF-KDDDK 475
           DRHYCGKC  T  F K +DK
Sbjct: 137 DRHYCGKCCLTYCFNKPEDK 156


>S79522-1|AAB21188.1|  156|Homo sapiens ubiquitin carboxyl extension
           protein protein.
          Length = 156

 Score =  194 bits (472), Expect = 5e-49
 Identities = 98/140 (70%), Positives = 106/140 (75%), Gaps = 1/140 (0%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXX 712
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV      
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG 76

Query: 711 XXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVME 532
                 K+Y+TP          KLAVL++YKVDENGKI RLRREC  ++CGAGVFMA   
Sbjct: 77  AKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHF 136

Query: 531 DRHYCGKCHSTMVF-KDDDK 475
           DRHYCGKC  T  F K +DK
Sbjct: 137 DRHYCGKCCLTYCFNKPEDK 156


>M10939-1|AAA36788.1|  152|Homo sapiens protein ( Human ubiquitin
           mRNA, 3' end. ).
          Length = 152

 Score =  194 bits (472), Expect = 5e-49
 Identities = 98/140 (70%), Positives = 106/140 (75%), Gaps = 1/140 (0%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXX 712
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV      
Sbjct: 13  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG 72

Query: 711 XXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVME 532
                 K+Y+TP          KLAVL++YKVDENGKI RLRREC  ++CGAGVFMA   
Sbjct: 73  AKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHF 132

Query: 531 DRHYCGKCHSTMVF-KDDDK 475
           DRHYCGKC  T  F K +DK
Sbjct: 133 DRHYCGKCCLTYCFNKPEDK 152


>BC066293-1|AAH66293.1|  156|Homo sapiens ribosomal protein S27a
           protein.
          Length = 156

 Score =  194 bits (472), Expect = 5e-49
 Identities = 98/140 (70%), Positives = 106/140 (75%), Gaps = 1/140 (0%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXX 712
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV      
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG 76

Query: 711 XXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVME 532
                 K+Y+TP          KLAVL++YKVDENGKI RLRREC  ++CGAGVFMA   
Sbjct: 77  AKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHF 136

Query: 531 DRHYCGKCHSTMVF-KDDDK 475
           DRHYCGKC  T  F K +DK
Sbjct: 137 DRHYCGKCCLTYCFNKPEDK 156


>BC001392-1|AAH01392.1|  156|Homo sapiens ribosomal protein S27a
           protein.
          Length = 156

 Score =  194 bits (472), Expect = 5e-49
 Identities = 98/140 (70%), Positives = 106/140 (75%), Gaps = 1/140 (0%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXX 712
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV      
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG 76

Query: 711 XXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVME 532
                 K+Y+TP          KLAVL++YKVDENGKI RLRREC  ++CGAGVFMA   
Sbjct: 77  AKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHF 136

Query: 531 DRHYCGKCHSTMVF-KDDDK 475
           DRHYCGKC  T  F K +DK
Sbjct: 137 DRHYCGKCCLTYCFNKPEDK 156


>BC053371-1|AAH53371.1|  156|Homo sapiens ribosomal protein S27a
           protein.
          Length = 156

 Score =  190 bits (463), Expect = 6e-48
 Identities = 97/140 (69%), Positives = 105/140 (75%), Gaps = 1/140 (0%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXX 712
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV      
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG 76

Query: 711 XXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVME 532
                 K+ +TP          KLAVL++YKVDENGKI RLRREC  ++CGAGVFMA   
Sbjct: 77  AKKRKKKSCTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHF 136

Query: 531 DRHYCGKCHSTMVF-KDDDK 475
           DRHYCGKC  T  F K +DK
Sbjct: 137 DRHYCGKCCLTYCFNKPEDK 156


>AB061854-1|BAB79488.1|  121|Homo sapiens ribosomal protein S27A
           protein.
          Length = 121

 Score =  155 bits (377), Expect = 2e-37
 Identities = 79/121 (65%), Positives = 87/121 (71%), Gaps = 1/121 (0%)
 Frame = -2

Query: 834 IPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXX 655
           IPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV            K+Y+TP       
Sbjct: 1   IPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKR 60

Query: 654 XXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHYCGKCHSTMVF-KDDD 478
              KLAVL++YKVDENGKI RLRREC  ++CGAGVFMA   DRHYCGKC  T  F K +D
Sbjct: 61  KKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPED 120

Query: 477 K 475
           K
Sbjct: 121 K 121


>X56999-1|CAA40314.1|  128|Homo sapiens ubiquitin-52 amino acid
           fusion protein protein.
          Length = 128

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70


>X56998-1|CAA40313.1|  128|Homo sapiens ubiquitin-52 amino acid
           fusion protein  protein.
          Length = 128

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70


>X56997-1|CAA40312.1|  128|Homo sapiens ubiquitin-52 amino acid
           fusion protein protein.
          Length = 128

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70


>X04803-1|CAA28495.1|  229|Homo sapiens ubiquitin protein.
          Length = 229

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222


>M26880-1|AAA36789.1|  685|Homo sapiens protein ( Human ubiquitin
           mRNA, complete cds. ).
          Length = 685

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 245 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 321 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 397 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 473 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 549 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 602



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 625 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 678


>M17597-1|AAA36787.1|  269|Homo sapiens protein ( Human
           poly-ubiquitin mRNA, complete cds. ).
          Length = 269

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 57  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 110



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 133 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 186



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 209 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 262



 Score = 72.5 bits (170), Expect = 2e-12
 Identities = 33/34 (97%), Positives = 34/34 (100%)
 Frame = -2

Query: 831 PPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           PP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 1   PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 34


>D63791-1|BAA09860.1|  611|Homo sapiens polyubiquitin protein.
          Length = 611

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 245 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 321 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 473 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 549 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 602



 Score =  110 bits (265), Expect = 6e-24
 Identities = 52/53 (98%), Positives = 53/53 (100%)
 Frame = -2

Query: 888 EPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           EPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 398 EPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450


>DQ479851-1|ABE96835.1|  128|Homo sapiens ubiquitin A-52 residue
           ribosomal protein fusion product 1 protein.
          Length = 128

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70


>BT020104-1|AAV38907.1|  229|Homo sapiens ubiquitin B protein.
          Length = 229

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222


>BC101832-1|AAI01833.1|  128|Homo sapiens ubiquitin A-52 residue
           ribosomal protein fusion product 1 protein.
          Length = 128

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70


>BC101830-1|AAI01831.1|  128|Homo sapiens ubiquitin A-52 residue
           ribosomal protein fusion product 1 protein.
          Length = 128

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70


>BC080583-1|AAH80583.1|  698|Homo sapiens Unknown (protein for
           IMAGE:2822684) protein.
          Length = 698

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 30  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 83



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 106 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 159



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 182 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 235



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 258 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 311



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 334 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 387



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 410 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 463



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 486 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 539



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 562 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 615



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 638 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 691


>BC046123-1|AAH46123.1|  229|Homo sapiens ubiquitin B protein.
          Length = 229

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222


>BC039193-1|AAH39193.1|  685|Homo sapiens ubiquitin C protein.
          Length = 685

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 245 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 321 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 397 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 473 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 549 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 602



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 625 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 678


>BC038999-1|AAH38999.1|  229|Homo sapiens ubiquitin B protein.
          Length = 229

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222


>BC031027-1|AAH31027.1|  229|Homo sapiens ubiquitin B protein.
          Length = 229

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222


>BC026301-1|AAH26301.1|  229|Homo sapiens ubiquitin B protein.
          Length = 229

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222


>BC015127-1|AAH15127.1|  229|Homo sapiens ubiquitin B protein.
          Length = 229

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222


>BC014880-1|AAH14880.1|  305|Homo sapiens UBC protein protein.
          Length = 305

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 245 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298


>BC009301-1|AAH09301.1|  229|Homo sapiens ubiquitin B protein.
          Length = 229

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222


>BC008955-1|AAH08955.2|  546|Homo sapiens UBC protein protein.
          Length = 546

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 30  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 83



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 106 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 159



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 182 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 235



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 258 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 311



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 334 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 387



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 410 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 463



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 486 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 539


>BC000379-1|AAH00379.1|  229|Homo sapiens ubiquitin B protein.
          Length = 229

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222


>AY819759-1|AAV68344.1|  229|Homo sapiens ubiquitin C splice variant
           protein.
          Length = 229

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222


>AY732488-1|AAV33127.1|  153|Homo sapiens ubiquitin C splice variant
           protein.
          Length = 153

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  109 bits (262), Expect = 1e-23
 Identities = 52/54 (96%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLS YNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSGYNIQKESTLHLV 146


>AL117514-1|CAB55973.1|  239|Homo sapiens hypothetical protein
           protein.
          Length = 239

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 27  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 80



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 103 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 156



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 179 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 232


>AK056939-1|BAB71316.1|  388|Homo sapiens protein ( Homo sapiens
           cDNA FLJ32377 fis, clone SKMUS1000014, highly similar to
           Polyubiquitin 9. ).
          Length = 388

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 139 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 192



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 215 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 268



 Score =  110 bits (265), Expect = 6e-24
 Identities = 52/53 (98%), Positives = 53/53 (100%)
 Frame = -2

Query: 888 EPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           EPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 64  EPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 116



 Score =  105 bits (253), Expect = 2e-22
 Identities = 50/51 (98%), Positives = 51/51 (100%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           SDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 331 SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 381



 Score =  100 bits (240), Expect = 6e-21
 Identities = 47/48 (97%), Positives = 48/48 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKE 748
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKE
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 64



 Score = 87.8 bits (208), Expect = 5e-17
 Identities = 41/42 (97%), Positives = 42/42 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSD 766
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSD
Sbjct: 291 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD 332


>AF348700-1|AAK31162.1|  141|Homo sapiens ubiquitin A-52 residue
           ribosomal protein fusion product 1 protein.
          Length = 141

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 30  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 83


>AC005253-2|AAC25582.1|  128|Homo sapiens ubiquitin-52 amino acid
           fusion protein protein.
          Length = 128

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70


>AB209782-1|BAD93019.1| 1309|Homo sapiens ubiquitin C variant
           protein.
          Length = 1309

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 33  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 86



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 109 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 162



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 185 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 238



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 261 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 314



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 337 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 390



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 413 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 466



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 489 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 542



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 565 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 618



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 641 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 694



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 717 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 770



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 793 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 846



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891  VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
            VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 869  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 922



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891  VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
            VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 945  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 998



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891  VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
            VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 1021 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 1074



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891  VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
            VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 1097 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 1150



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891  VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
            VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 1173 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 1226



 Score =  110 bits (264), Expect = 8e-24
 Identities = 52/54 (96%), Positives = 54/54 (100%)
 Frame = -2

Query: 891  VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
            VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLE+GRTLSDYNIQKESTLHLV
Sbjct: 1249 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLENGRTLSDYNIQKESTLHLV 1302


>AB089617-1|BAC56955.1|  229|Homo sapiens polyubiquitin B protein.
          Length = 229

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222


>AB089613-1|BAC56951.1|  685|Homo sapiens polyubiquitin C protein.
          Length = 685

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 245 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 321 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 397 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 473 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 549 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 602



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 625 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 678


>AB009010-1|BAA23632.1|  685|Homo sapiens polyubiquitin UbC protein.
          Length = 685

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 245 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 321 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 397 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 473 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 549 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 602



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 625 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 678


>AB003730-1|BAA23486.1|  609|Homo sapiens polyubiquitin protein.
          Length = 609

 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 245 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 321 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 397 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 473 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526



 Score =  112 bits (269), Expect = 2e-24
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 549 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 602


>AK127995-1|BAC87221.1|  186|Homo sapiens protein ( Homo sapiens
           cDNA FLJ46113 fis, clone TESTI2036285, highly  similar
           to Rattus norvegicus ubiquitin C (Ubc). ).
          Length = 186

 Score =  110 bits (265), Expect = 6e-24
 Identities = 52/54 (96%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGR+LSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRSLSDYNIQKESTLHLV 146



 Score = 98.3 bits (234), Expect = 3e-20
 Identities = 48/54 (88%), Positives = 50/54 (92%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPS TIENVKAKIQDKEG P +QQRLIFAGKQ EDGR+LSDYNIQKESTLHLV
Sbjct: 17  VEPSATIENVKAKIQDKEGNPCDQQRLIFAGKQREDGRSLSDYNIQKESTLHLV 70


>BC042362-1|AAH42362.1|   95|Homo sapiens RPS27A protein protein.
          Length = 95

 Score = 98.7 bits (235), Expect = 2e-20
 Identities = 46/47 (97%), Positives = 47/47 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQK 751
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQK
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 63


>AB007163-1|BAA25826.1|   51|Homo sapiens ribosomal protein S27a
           protein.
          Length = 51

 Score = 83.0 bits (196), Expect = 1e-15
 Identities = 35/45 (77%), Positives = 39/45 (86%)
 Frame = -2

Query: 642 LAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHYCGKC 508
           LAVL++YKVDENGKI RLRREC  ++CGAGVFMA   DRHYCGKC
Sbjct: 3   LAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKC 47


>D23662-1|BAA04889.1|   81|Homo sapiens ubiquitin-like protein
           protein.
          Length = 81

 Score = 72.5 bits (170), Expect = 2e-12
 Identities = 29/54 (53%), Positives = 42/54 (77%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +EP+D +E +K ++++KEGIPP QQRLI++GKQ+ D +T +DY I   S LHLV
Sbjct: 17  IEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLV 70


>CR407662-1|CAG28590.1|   81|Homo sapiens NEDD8 protein.
          Length = 81

 Score = 72.5 bits (170), Expect = 2e-12
 Identities = 29/54 (53%), Positives = 42/54 (77%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +EP+D +E +K ++++KEGIPP QQRLI++GKQ+ D +T +DY I   S LHLV
Sbjct: 17  IEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLV 70


>BC104664-1|AAI04665.1|   81|Homo sapiens neural precursor cell
           expressed, developmentally down-regulated 8 protein.
          Length = 81

 Score = 72.5 bits (170), Expect = 2e-12
 Identities = 29/54 (53%), Positives = 42/54 (77%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +EP+D +E +K ++++KEGIPP QQRLI++GKQ+ D +T +DY I   S LHLV
Sbjct: 17  IEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLV 70


>BC104201-1|AAI04202.1|   81|Homo sapiens neural precursor cell
           expressed, developmentally down-regulated 8 protein.
          Length = 81

 Score = 72.5 bits (170), Expect = 2e-12
 Identities = 29/54 (53%), Positives = 42/54 (77%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +EP+D +E +K ++++KEGIPP QQRLI++GKQ+ D +T +DY I   S LHLV
Sbjct: 17  IEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLV 70


>BC104200-1|AAI04201.1|   81|Homo sapiens neural precursor cell
           expressed, developmentally down-regulated 8 protein.
          Length = 81

 Score = 72.5 bits (170), Expect = 2e-12
 Identities = 29/54 (53%), Positives = 42/54 (77%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +EP+D +E +K ++++KEGIPP QQRLI++GKQ+ D +T +DY I   S LHLV
Sbjct: 17  IEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLV 70


>Y00361-1|CAA68439.1|   89|Homo sapiens ubiquitin precursor protein.
          Length = 89

 Score = 66.5 bits (155), Expect = 1e-10
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = -2

Query: 822 QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 1   QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 31


>L44140-7|AAA92650.1|  157|Homo sapiens protein ( , complete cds's.
           ).).
          Length = 157

 Score = 50.4 bits (115), Expect = 9e-06
 Identities = 23/54 (42%), Positives = 33/54 (61%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V   + +  +K  + +K  +P  QQRL+F GK L DG+ LSDY+I   S L+LV
Sbjct: 17  VPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLV 70


>J03589-1|AAA36790.1|  157|Homo sapiens protein ( Human
           ubiquitin-like protein (GdX) gene, complete cds. ).
          Length = 157

 Score = 50.4 bits (115), Expect = 9e-06
 Identities = 23/54 (42%), Positives = 33/54 (61%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V   + +  +K  + +K  +P  QQRL+F GK L DG+ LSDY+I   S L+LV
Sbjct: 17  VPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLV 70


>BX664739-2|CAI43235.1|  157|Homo sapiens ubiquitin-like 4 protein.
          Length = 157

 Score = 50.4 bits (115), Expect = 9e-06
 Identities = 23/54 (42%), Positives = 33/54 (61%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V   + +  +K  + +K  +P  QQRL+F GK L DG+ LSDY+I   S L+LV
Sbjct: 17  VPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLV 70


>BX664739-1|CAI43234.1|  180|Homo sapiens ubiquitin-like 4 protein.
          Length = 180

 Score = 50.4 bits (115), Expect = 9e-06
 Identities = 23/54 (42%), Positives = 33/54 (61%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V   + +  +K  + +K  +P  QQRL+F GK L DG+ LSDY+I   S L+LV
Sbjct: 17  VPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLV 70


>BC053589-1|AAH53589.1|  157|Homo sapiens ubiquitin-like 4A protein.
          Length = 157

 Score = 50.4 bits (115), Expect = 9e-06
 Identities = 23/54 (42%), Positives = 33/54 (61%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V   + +  +K  + +K  +P  QQRL+F GK L DG+ LSDY+I   S L+LV
Sbjct: 17  VPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLV 70


>BC043346-1|AAH43346.1|  157|Homo sapiens ubiquitin-like 4A protein.
          Length = 157

 Score = 50.4 bits (115), Expect = 9e-06
 Identities = 23/54 (42%), Positives = 33/54 (61%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V   + +  +K  + +K  +P  QQRL+F GK L DG+ LSDY+I   S L+LV
Sbjct: 17  VPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLV 70


>BC045587-1|AAH45587.2|  727|Homo sapiens ANUBL1 protein protein.
          Length = 727

 Score = 50.0 bits (114), Expect = 1e-05
 Identities = 26/54 (48%), Positives = 36/54 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V P +T+ +VKAKI+  EGIP  +Q LI+   +LE+   L+DYNI +  TL LV
Sbjct: 44  VSPFETVISVKAKIRRLEGIPICRQHLIWNNMELENDYCLNDYNISEGCTLKLV 97


>AL445201-5|CAH72970.1|  115|Homo sapiens AN1, ubiquitin-like,
           homolog (Xenopus laevis) protein.
          Length = 115

 Score = 50.0 bits (114), Expect = 1e-05
 Identities = 26/54 (48%), Positives = 36/54 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V P +T+ +VKAKI+  EGIP  +Q LI+   +LE+   L+DYNI +  TL LV
Sbjct: 44  VSPFETVISVKAKIRRLEGIPICRQHLIWNNMELENDYCLNDYNISEGCTLKLV 97


>AL445201-4|CAH72968.1|  224|Homo sapiens AN1, ubiquitin-like,
           homolog (Xenopus laevis) protein.
          Length = 224

 Score = 50.0 bits (114), Expect = 1e-05
 Identities = 26/54 (48%), Positives = 36/54 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V P +T+ +VKAKI+  EGIP  +Q LI+   +LE+   L+DYNI +  TL LV
Sbjct: 44  VSPFETVISVKAKIRRLEGIPICRQHLIWNNMELENDYCLNDYNISEGCTLKLV 97


>AL445201-3|CAH72967.1|  727|Homo sapiens AN1, ubiquitin-like,
           homolog (Xenopus laevis) protein.
          Length = 727

 Score = 50.0 bits (114), Expect = 1e-05
 Identities = 26/54 (48%), Positives = 36/54 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V P +T+ +VKAKI+  EGIP  +Q LI+   +LE+   L+DYNI +  TL LV
Sbjct: 44  VSPFETVISVKAKIRRLEGIPICRQHLIWNNMELENDYCLNDYNISEGCTLKLV 97


>AF311324-1|AAG33850.1|  727|Homo sapiens ubiquitin-like fusion
           protein protein.
          Length = 727

 Score = 50.0 bits (114), Expect = 1e-05
 Identities = 26/54 (48%), Positives = 36/54 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V P +T+ +VKAKI+  EGIP  +Q LI+   +LE+   L+DYNI +  TL LV
Sbjct: 44  VSPFETVISVKAKIRRLEGIPICRQHLIWNNMELENDYCLNDYNISEGCTLKLV 97


>EF560733-1|ABQ59043.1|  793|Homo sapiens UHRF1 protein protein.
          Length = 793

 Score = 48.8 bits (111), Expect = 3e-05
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +E ++ KIQ+   + P  QRL + GKQ+EDG TL DY ++   T+ L+
Sbjct: 25  VEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFDYEVRLNDTIQLL 72


>BC113875-1|AAI13876.2|  806|Homo sapiens ubiquitin-like, containing
           PHD and RING finger domains, 1 protein.
          Length = 806

 Score = 48.8 bits (111), Expect = 3e-05
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +E ++ KIQ+   + P  QRL + GKQ+EDG TL DY ++   T+ L+
Sbjct: 38  VEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFDYEVRLNDTIQLL 85


>AY787925-1|AAV40831.1|  793|Homo sapiens ubiquitin-like, containing
           PHD and RING finger domains, 1 protein.
          Length = 793

 Score = 48.8 bits (111), Expect = 3e-05
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +E ++ KIQ+   + P  QRL + GKQ+EDG TL DY ++   T+ L+
Sbjct: 25  VEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFDYEVRLNDTIQLL 72


>AF274048-1|AAK55744.1|  793|Homo sapiens nuclear zinc finger
           protein Np95 protein.
          Length = 793

 Score = 48.8 bits (111), Expect = 3e-05
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +E ++ KIQ+   + P  QRL + GKQ+EDG TL DY ++   T+ L+
Sbjct: 25  VEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFDYEVRLNDTIQLL 72


>AF129507-1|AAF28469.1|  793|Homo sapiens transcription factor
           ICBP90 protein.
          Length = 793

 Score = 48.8 bits (111), Expect = 3e-05
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +E ++ KIQ+   + P  QRL + GKQ+EDG TL DY ++   T+ L+
Sbjct: 25  VEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFDYEVRLNDTIQLL 72


>AB177624-1|BAF36720.1|  793|Homo sapiens hNP95 protein.
          Length = 793

 Score = 48.8 bits (111), Expect = 3e-05
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +E ++ KIQ+   + P  QRL + GKQ+EDG TL DY ++   T+ L+
Sbjct: 25  VEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFDYEVRLNDTIQLL 72


>AB177623-1|BAF36719.1|  793|Homo sapiens hNP95 protein.
          Length = 793

 Score = 48.8 bits (111), Expect = 3e-05
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +E ++ KIQ+   + P  QRL + GKQ+EDG TL DY ++   T+ L+
Sbjct: 25  VEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFDYEVRLNDTIQLL 72


>Y12653-1|CAA73200.1|  165|Homo sapiens diubiquitin protein.
          Length = 165

 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 23/53 (43%), Positives = 33/53 (62%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V  S ++  VKA I+ K GI P  Q +   GK+LEDG+ ++DY I+K + L L
Sbjct: 106 VRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFL 158


>BX000688-3|CAI18599.1|  165|Homo sapiens ubiquitin D protein.
          Length = 165

 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 23/53 (43%), Positives = 33/53 (62%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V  S ++  VKA I+ K GI P  Q +   GK+LEDG+ ++DY I+K + L L
Sbjct: 106 VRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFL 158


>BC012472-1|AAH12472.1|  165|Homo sapiens ubiquitin D protein.
          Length = 165

 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 23/53 (43%), Positives = 33/53 (62%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V  S ++  VKA I+ K GI P  Q +   GK+LEDG+ ++DY I+K + L L
Sbjct: 106 VRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFL 158


>AL662826-3|CAI17384.1|  165|Homo sapiens ubiquitin D protein.
          Length = 165

 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 23/53 (43%), Positives = 33/53 (62%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V  S ++  VKA I+ K GI P  Q +   GK+LEDG+ ++DY I+K + L L
Sbjct: 106 VRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFL 158


>AL645936-2|CAI18010.1|  165|Homo sapiens ubiquitin D protein.
          Length = 165

 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 23/53 (43%), Positives = 33/53 (62%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V  S ++  VKA I+ K GI P  Q +   GK+LEDG+ ++DY I+K + L L
Sbjct: 106 VRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFL 158


>AL031983-3|CAA21458.1|  165|Homo sapiens ubiquitin D protein.
          Length = 165

 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 23/53 (43%), Positives = 33/53 (62%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V  S ++  VKA I+ K GI P  Q +   GK+LEDG+ ++DY I+K + L L
Sbjct: 106 VRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFL 158


>AF123050-1|AAD52982.1|  165|Homo sapiens ubiquitin-like protein
           FAT10 protein.
          Length = 165

 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 23/53 (43%), Positives = 33/53 (62%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V  S ++  VKA I+ K GI P  Q +   GK+LEDG+ ++DY I+K + L L
Sbjct: 106 VRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFL 158


>BC117410-1|AAI17411.1|  514|Homo sapiens 2'-5'-oligoadenylate
           synthetase-like protein.
          Length = 514

 Score = 44.0 bits (99), Expect = 7e-04
 Identities = 21/53 (39%), Positives = 32/53 (60%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           + P+  I  +K +I+D++G+P  QQ+L F G+ L+D   L  Y IQ   TL L
Sbjct: 450 INPNSFILGLKQQIEDQQGLPKKQQQLEFQGQVLQDWLGLGIYGIQDSDTLIL 502


>BC117408-1|AAI17409.1|  514|Homo sapiens 2'-5'-oligoadenylate
           synthetase-like protein.
          Length = 514

 Score = 44.0 bits (99), Expect = 7e-04
 Identities = 21/53 (39%), Positives = 32/53 (60%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           + P+  I  +K +I+D++G+P  QQ+L F G+ L+D   L  Y IQ   TL L
Sbjct: 450 INPNSFILGLKQQIEDQQGLPKKQQQLEFQGQVLQDWLGLGIYGIQDSDTLIL 502


>AJ225089-1|CAA12396.1|  514|Homo sapiens 2'-5' oligoadenylate
           synthetase (p59OAS) protein.
          Length = 514

 Score = 44.0 bits (99), Expect = 7e-04
 Identities = 21/53 (39%), Positives = 32/53 (60%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           + P+  I  +K +I+D++G+P  QQ+L F G+ L+D   L  Y IQ   TL L
Sbjct: 450 INPNSFILGLKQQIEDQQGLPKKQQQLEFQGQVLQDWLGLGIYGIQDSDTLIL 502


>AF063611-1|AAD28541.1|  513|Homo sapiens 2'-5'oligoadenylate
           synthetase-related protein p56 protein.
          Length = 513

 Score = 44.0 bits (99), Expect = 7e-04
 Identities = 21/53 (39%), Positives = 32/53 (60%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           + P+  I  +K +I+D++G+P  QQ+L F G+ L+D   L  Y IQ   TL L
Sbjct: 449 INPNSFILGLKQQIEDQQGLPKKQQQLEFQGQVLQDWLGLGIYGIQDSDTLIL 501


>EF375726-1|ABN46990.1|  465|Homo sapiens parkin 2 protein.
          Length = 465

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 17/54 (31%), Positives = 36/54 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+   +I  +K  +  ++G+P +Q R+IFAGK+L +  T+ + ++ ++S +H+V
Sbjct: 17  VDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIV 70


>BC022014-1|AAH22014.1|  387|Homo sapiens PARK2 protein protein.
          Length = 387

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 17/54 (31%), Positives = 36/54 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+   +I  +K  +  ++G+P +Q R+IFAGK+L +  T+ + ++ ++S +H+V
Sbjct: 17  VDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIV 70


>AL445215-2|CAH73682.1|  437|Homo sapiens Parkinson disease
           (autosomal recessive, juvenile)eta protein.
          Length = 437

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 17/54 (31%), Positives = 36/54 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+   +I  +K  +  ++G+P +Q R+IFAGK+L +  T+ + ++ ++S +H+V
Sbjct: 17  VDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIV 70


>AL445215-1|CAH73681.1|  465|Homo sapiens Parkinson disease
           (autosomal recessive, juvenile)ier family 9
           (sodium\/hydrogen protein.
          Length = 465

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 17/54 (31%), Positives = 36/54 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+   +I  +K  +  ++G+P +Q R+IFAGK+L +  T+ + ++ ++S +H+V
Sbjct: 17  VDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIV 70


>AL132982-2|CAI23602.1|  437|Homo sapiens Parkinson disease
           (autosomal recessive, juvenile)rate protein.
          Length = 437

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 17/54 (31%), Positives = 36/54 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+   +I  +K  +  ++G+P +Q R+IFAGK+L +  T+ + ++ ++S +H+V
Sbjct: 17  VDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIV 70


>AL132982-1|CAI23601.1|  465|Homo sapiens Parkinson disease
           (autosomal recessive, juvenile)lo2, SUR4/Elo3,
           yeast)-like 4 protein.
          Length = 465

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 17/54 (31%), Positives = 36/54 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+   +I  +K  +  ++G+P +Q R+IFAGK+L +  T+ + ++ ++S +H+V
Sbjct: 17  VDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIV 70


>AL035697-3|CAI21386.1|  437|Homo sapiens Parkinson disease
           (autosomal recessive, juvenile)r 1 protein.
          Length = 437

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 17/54 (31%), Positives = 36/54 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+   +I  +K  +  ++G+P +Q R+IFAGK+L +  T+ + ++ ++S +H+V
Sbjct: 17  VDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIV 70


>AL035697-2|CAI21385.1|  465|Homo sapiens Parkinson disease
           (autosomal recessive, juvenile)adenine nucleotide
           translocato protein.
          Length = 465

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 17/54 (31%), Positives = 36/54 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+   +I  +K  +  ++G+P +Q R+IFAGK+L +  T+ + ++ ++S +H+V
Sbjct: 17  VDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIV 70


>AL035697-1|CAI21384.1|  368|Homo sapiens Parkinson disease
           (autosomal recessive, juvenile)family, member 1 protein.
          Length = 368

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 17/54 (31%), Positives = 36/54 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+   +I  +K  +  ++G+P +Q R+IFAGK+L +  T+ + ++ ++S +H+V
Sbjct: 17  VDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIV 70


>AB245403-1|BAF43729.1|  465|Homo sapiens parkin 2 protein.
          Length = 465

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 17/54 (31%), Positives = 36/54 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+   +I  +K  +  ++G+P +Q R+IFAGK+L +  T+ + ++ ++S +H+V
Sbjct: 17  VDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIV 70


>AB009973-1|BAA25751.1|  465|Homo sapiens Parkin protein.
          Length = 465

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 17/54 (31%), Positives = 36/54 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+   +I  +K  +  ++G+P +Q R+IFAGK+L +  T+ + ++ ++S +H+V
Sbjct: 17  VDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIV 70


>BC007331-1|AAH07331.1|  227|Homo sapiens ubiquitin domain
           containing 1 protein.
          Length = 227

 Score = 41.1 bits (92), Expect = 0.005
 Identities = 18/50 (36%), Positives = 30/50 (60%)
 Frame = -2

Query: 879 DTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           DT+  +K ++  +EGI P+ QR  F+GK L D   L +  IQK+  + ++
Sbjct: 169 DTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVI 218


>AL359388-3|CAI14191.1|  227|Homo sapiens ubiquitin domain
           containing 1 protein.
          Length = 227

 Score = 41.1 bits (92), Expect = 0.005
 Identities = 18/50 (36%), Positives = 30/50 (60%)
 Frame = -2

Query: 879 DTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           DT+  +K ++  +EGI P+ QR  F+GK L D   L +  IQK+  + ++
Sbjct: 169 DTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVI 218


>AK021869-1|BAB13921.1|  227|Homo sapiens protein ( Homo sapiens
           cDNA FLJ11807 fis, clone HEMBA1006284. ).
          Length = 227

 Score = 41.1 bits (92), Expect = 0.005
 Identities = 18/50 (36%), Positives = 30/50 (60%)
 Frame = -2

Query: 879 DTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           DT+  +K ++  +EGI P+ QR  F+GK L D   L +  IQK+  + ++
Sbjct: 169 DTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVI 218


>AK222597-1|BAD96317.1|  227|Homo sapiens ubiquitin domain
           containing 1 variant protein.
          Length = 227

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 18/50 (36%), Positives = 30/50 (60%)
 Frame = -2

Query: 879 DTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           DT+  +K ++  +EGI P+ QR  F+GK L D   L +  IQK+  + ++
Sbjct: 169 DTVGLLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVI 218


>AB062071-1|BAB79490.1|   34|Homo sapiens ribosomal protein S27a
           protein.
          Length = 34

 Score = 39.9 bits (89), Expect = 0.012
 Identities = 18/18 (100%), Positives = 18/18 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKE 838
           VEPSDTIENVKAKIQDKE
Sbjct: 17  VEPSDTIENVKAKIQDKE 34


>BC028397-1|AAH28397.1|  503|Homo sapiens UHRF2 protein protein.
          Length = 503

 Score = 39.5 bits (88), Expect = 0.016
 Identities = 18/49 (36%), Positives = 29/49 (59%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           TIE ++ ++     + P  QRL + GKQLE+G TL DY++     + L+
Sbjct: 24  TIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFDYDVGLNDIIQLL 72


>AL353718-4|CAH74119.1|  802|Homo sapiens ubiquitin-like, containing
           PHD and RING finger domains, 2 protein.
          Length = 802

 Score = 39.5 bits (88), Expect = 0.016
 Identities = 18/49 (36%), Positives = 29/49 (59%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           TIE ++ ++     + P  QRL + GKQLE+G TL DY++     + L+
Sbjct: 24  TIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFDYDVGLNDIIQLL 72


>AL133480-6|CAI13294.1|  136|Homo sapiens ubiquitin-like, containing
           PHD and RING finger domains, 2 protein.
          Length = 136

 Score = 39.5 bits (88), Expect = 0.016
 Identities = 18/49 (36%), Positives = 29/49 (59%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           TIE ++ ++     + P  QRL + GKQLE+G TL DY++     + L+
Sbjct: 24  TIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFDYDVGLNDIIQLL 72


>AL133480-5|CAI13293.1|  802|Homo sapiens ubiquitin-like, containing
           PHD and RING finger domains, 2 protein.
          Length = 802

 Score = 39.5 bits (88), Expect = 0.016
 Identities = 18/49 (36%), Positives = 29/49 (59%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           TIE ++ ++     + P  QRL + GKQLE+G TL DY++     + L+
Sbjct: 24  TIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFDYDVGLNDIIQLL 72


>AL118499-2|CAC00663.1|   18|Homo sapiens chromosome 20 open reading
           frame 109 protein.
          Length = 18

 Score = 39.5 bits (88), Expect = 0.016
 Identities = 17/18 (94%), Positives = 18/18 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKE 838
           +EPSDTIENVKAKIQDKE
Sbjct: 1   IEPSDTIENVKAKIQDKE 18


>AF274049-1|AAM33799.1|  802|Homo sapiens nuclear zinc finger
           protein Np97 protein.
          Length = 802

 Score = 39.5 bits (88), Expect = 0.016
 Identities = 18/49 (36%), Positives = 29/49 (59%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           TIE ++ ++     + P  QRL + GKQLE+G TL DY++     + L+
Sbjct: 24  TIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFDYDVGLNDIIQLL 72


>AB071698-1|BAB68317.1|  802|Homo sapiens Np95-like ring finger
           protein protein.
          Length = 802

 Score = 39.5 bits (88), Expect = 0.016
 Identities = 18/49 (36%), Positives = 29/49 (59%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           TIE ++ ++     + P  QRL + GKQLE+G TL DY++     + L+
Sbjct: 24  TIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFDYDVGLNDIIQLL 72


>X65923-1|CAA46716.1|  133|Homo sapiens fau protein.
          Length = 133

 Score = 38.7 bits (86), Expect = 0.028
 Identities = 18/53 (33%), Positives = 28/53 (52%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V   +T+  +KA +   EGI P  Q ++ AG  LED  TL    ++  +TL +
Sbjct: 15  VTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEV 67


>X65921-1|CAA46714.1|  133|Homo sapiens fau 1 protein.
          Length = 133

 Score = 38.7 bits (86), Expect = 0.028
 Identities = 18/53 (33%), Positives = 28/53 (52%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V   +T+  +KA +   EGI P  Q ++ AG  LED  TL    ++  +TL +
Sbjct: 15  VTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEV 67


>CR541974-1|CAG46772.1|  133|Homo sapiens FAU protein.
          Length = 133

 Score = 38.7 bits (86), Expect = 0.028
 Identities = 18/53 (33%), Positives = 28/53 (52%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V   +T+  +KA +   EGI P  Q ++ AG  LED  TL    ++  +TL +
Sbjct: 15  VTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEV 67


>BC033877-1|AAH33877.1|  133|Homo sapiens Finkel-Biskis-Reilly
           murine sarcoma virus (FBR-MuSV) ubiquitously expressed
           protein.
          Length = 133

 Score = 38.7 bits (86), Expect = 0.028
 Identities = 18/53 (33%), Positives = 28/53 (52%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V   +T+  +KA +   EGI P  Q ++ AG  LED  TL    ++  +TL +
Sbjct: 15  VTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEV 67


>AY398663-1|AAQ87877.1|  133|Homo sapiens Finkel-Biskis-Reilly
           murine sarcoma virus (FBR-MuSV) ubiquitously expressed
           (fo protein.
          Length = 133

 Score = 38.7 bits (86), Expect = 0.028
 Identities = 18/53 (33%), Positives = 28/53 (52%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V   +T+  +KA +   EGI P  Q ++ AG  LED  TL    ++  +TL +
Sbjct: 15  VTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEV 67


>AK026639-1|BAB15515.1|  133|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ22986 fis, clone KAT11742. ).
          Length = 133

 Score = 38.7 bits (86), Expect = 0.028
 Identities = 18/53 (33%), Positives = 28/53 (52%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V   +T+  +KA +   EGI P  Q ++ AG  LED  TL    ++  +TL +
Sbjct: 15  VTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEV 67


>X85237-1|CAA59494.1|  793|Homo sapiens human splicing factor
           protein.
          Length = 793

 Score = 38.3 bits (85), Expect = 0.037
 Identities = 15/50 (30%), Positives = 30/50 (60%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           +D +  +K KI +  G+P  +Q+L + G  ++D  +L+ YN+   + +HL
Sbjct: 734 TDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHL 783


>D21235-1|BAA04767.1|  363|Homo sapiens HHR23A protein protein.
          Length = 363

 Score = 38.3 bits (85), Expect = 0.037
 Identities = 19/52 (36%), Positives = 33/52 (63%), Gaps = 3/52 (5%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEG---IPPNQQRLIFAGKQLEDGRTLSDYNIQKES 745
           +EP +T++ +K KI+ ++G    P   Q+LI+AGK L D   + DY I +++
Sbjct: 19  MEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKN 70


>CR456575-1|CAG30461.1|  793|Homo sapiens SF3A1 protein.
          Length = 793

 Score = 38.3 bits (85), Expect = 0.037
 Identities = 15/50 (30%), Positives = 30/50 (60%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           +D +  +K KI +  G+P  +Q+L + G  ++D  +L+ YN+   + +HL
Sbjct: 734 TDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHL 783


>BC088364-1|AAH88364.1|  362|Homo sapiens RAD23 homolog A (S.
           cerevisiae) protein.
          Length = 362

 Score = 38.3 bits (85), Expect = 0.037
 Identities = 19/52 (36%), Positives = 33/52 (63%), Gaps = 3/52 (5%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEG---IPPNQQRLIFAGKQLEDGRTLSDYNIQKES 745
           +EP +T++ +K KI+ ++G    P   Q+LI+AGK L D   + DY I +++
Sbjct: 19  MEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKN 70


>BC058929-1|AAH58929.1|  174|Homo sapiens ubiquitin-like 4B protein.
          Length = 174

 Score = 38.3 bits (85), Expect = 0.037
 Identities = 16/54 (29%), Positives = 32/54 (59%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V   +++  +K  +  +  +P  QQ L+F G+ LED + LSDY I   ++++++
Sbjct: 17  VSGQESVATLKRLVSRRLKVPEEQQHLLFRGQLLEDDKHLSDYCIGPNASINVI 70


>BC014026-1|AAH14026.1|  363|Homo sapiens RAD23 homolog A (S.
           cerevisiae) protein.
          Length = 363

 Score = 38.3 bits (85), Expect = 0.037
 Identities = 19/52 (36%), Positives = 33/52 (63%), Gaps = 3/52 (5%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEG---IPPNQQRLIFAGKQLEDGRTLSDYNIQKES 745
           +EP +T++ +K KI+ ++G    P   Q+LI+AGK L D   + DY I +++
Sbjct: 19  MEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKN 70


>BC007684-1|AAH07684.1|  793|Homo sapiens splicing factor 3a,
           subunit 1, 120kDa protein.
          Length = 793

 Score = 38.3 bits (85), Expect = 0.037
 Identities = 15/50 (30%), Positives = 30/50 (60%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           +D +  +K KI +  G+P  +Q+L + G  ++D  +L+ YN+   + +HL
Sbjct: 734 TDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHL 783


>BC001976-1|AAH01976.1|  793|Homo sapiens splicing factor 3a,
           subunit 1, 120kDa protein.
          Length = 793

 Score = 38.3 bits (85), Expect = 0.037
 Identities = 15/50 (30%), Positives = 30/50 (60%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           +D +  +K KI +  G+P  +Q+L + G  ++D  +L+ YN+   + +HL
Sbjct: 734 TDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHL 783


>AK098556-1|BAC05331.1|  174|Homo sapiens protein ( Homo sapiens
           cDNA FLJ25690 fis, clone TST04424. ).
          Length = 174

 Score = 38.3 bits (85), Expect = 0.037
 Identities = 16/54 (29%), Positives = 32/54 (59%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V   +++  +K  +  +  +P  QQ L+F G+ LED + LSDY I   ++++++
Sbjct: 17  VSGQESVATLKRLVSRRLKVPEEQQHLLFRGQLLEDDKHLSDYCIGPNASINVI 70


>AF549209-1|AAN39383.1|  363|Homo sapiens RAD23 homolog A (S.
           cerevisiae) protein.
          Length = 363

 Score = 38.3 bits (85), Expect = 0.037
 Identities = 19/52 (36%), Positives = 33/52 (63%), Gaps = 3/52 (5%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEG---IPPNQQRLIFAGKQLEDGRTLSDYNIQKES 745
           +EP +T++ +K KI+ ++G    P   Q+LI+AGK L D   + DY I +++
Sbjct: 19  MEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKN 70


>AD000092-7|AAB51177.1|  363|Homo sapiens human RAD23A homolog
           protein.
          Length = 363

 Score = 38.3 bits (85), Expect = 0.037
 Identities = 19/52 (36%), Positives = 33/52 (63%), Gaps = 3/52 (5%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEG---IPPNQQRLIFAGKQLEDGRTLSDYNIQKES 745
           +EP +T++ +K KI+ ++G    P   Q+LI+AGK L D   + DY I +++
Sbjct: 19  MEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKN 70


>AC004997-4|AAC23435.1|  793|Homo sapiens spliceosome associated
           protein 114 (SF3a) protein.
          Length = 793

 Score = 38.3 bits (85), Expect = 0.037
 Identities = 15/50 (30%), Positives = 30/50 (60%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           +D +  +K KI +  G+P  +Q+L + G  ++D  +L+ YN+   + +HL
Sbjct: 734 TDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHL 783


>AB209713-1|BAD92950.1|  379|Homo sapiens UV excision repair protein
           RAD23 homolog A variant protein.
          Length = 379

 Score = 38.3 bits (85), Expect = 0.037
 Identities = 19/52 (36%), Positives = 33/52 (63%), Gaps = 3/52 (5%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEG---IPPNQQRLIFAGKQLEDGRTLSDYNIQKES 745
           +EP +T++ +K KI+ ++G    P   Q+LI+AGK L D   + DY I +++
Sbjct: 36  MEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKN 87


>BC019910-1|AAH19910.1|  190|Homo sapiens UBTD2 protein protein.
          Length = 190

 Score = 37.5 bits (83), Expect = 0.065
 Identities = 15/54 (27%), Positives = 29/54 (53%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V  +DT+ ++K ++   EG+ P  QR  F+G+ L D     +  I K+  + ++
Sbjct: 124 VRSTDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKIPKDYVVQVI 177


>AF251700-1|AAL99389.1|  106|Homo sapiens ubiquitin-like protein
           SB72 protein.
          Length = 106

 Score = 37.5 bits (83), Expect = 0.065
 Identities = 15/54 (27%), Positives = 29/54 (53%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V  +DT+ ++K ++   EG+ P  QR  F+G+ L D     +  I K+  + ++
Sbjct: 40  VRSTDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKIPKDYVVQVI 93


>M33521-1|AAA35588.1| 1132|Homo sapiens protein ( Human
           HLA-B-associated transcript 3 (BAT3) gene, 3' end. ).
          Length = 1132

 Score = 37.1 bits (82), Expect = 0.085
 Identities = 17/48 (35%), Positives = 29/48 (60%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I+    IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIRASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>M33519-1|AAA35587.1| 1132|Homo sapiens protein ( Human
           HLA-B-associated transcript 3 (BAT3) mRNA, complete cds.
           ).
          Length = 1132

 Score = 37.1 bits (82), Expect = 0.085
 Identities = 17/48 (35%), Positives = 29/48 (60%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I+    IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIRASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>BC063841-1|AAH63841.1|  601|Homo sapiens ubiquilin 4 protein.
          Length = 601

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 19/49 (38%), Positives = 30/49 (61%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +++  K +I  +     +Q  LIFAGK L+DG TL+ + I+   T+HLV
Sbjct: 33  SVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLNQHGIKDGLTVHLV 81


>BC036743-1|AAH36743.1|  655|Homo sapiens ubiquilin 3 protein.
          Length = 655

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 19/49 (38%), Positives = 30/49 (61%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           TI+ +K +I  +    P+Q  LIFAGK L+D  +L+   ++   T+HLV
Sbjct: 42  TIQQLKEEISQRFKAHPDQLVLIFAGKILKDPDSLAQCGVRDGLTVHLV 90


>BC018403-1|AAH18403.1|  601|Homo sapiens ubiquilin 4 protein.
          Length = 601

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 19/49 (38%), Positives = 30/49 (61%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +++  K +I  +     +Q  LIFAGK L+DG TL+ + I+   T+HLV
Sbjct: 33  SVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLNQHGIKDGLTVHLV 81


>AL355388-14|CAH72633.1|  601|Homo sapiens ubiquilin 4 protein.
          Length = 601

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 19/49 (38%), Positives = 30/49 (61%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +++  K +I  +     +Q  LIFAGK L+DG TL+ + I+   T+HLV
Sbjct: 33  SVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLNQHGIKDGLTVHLV 81


>AL355388-13|CAH72634.1|  226|Homo sapiens ubiquilin 4 protein.
          Length = 226

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 19/49 (38%), Positives = 30/49 (61%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +++  K +I  +     +Q  LIFAGK L+DG TL+ + I+   T+HLV
Sbjct: 33  SVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLNQHGIKDGLTVHLV 81


>AK023354-1|BAB14539.1|  314|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13292 fis, clone OVARC1001180, weakly similar to
           UBIQUITIN-LIKE PROTEIN DSK2. ).
          Length = 314

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 19/49 (38%), Positives = 30/49 (61%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +++  K +I  +     +Q  LIFAGK L+DG TL+ + I+   T+HLV
Sbjct: 33  SVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLNQHGIKDGLTVHLV 81


>AF230481-1|AAF67143.1|  655|Homo sapiens ubiquilin 3 protein.
          Length = 655

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 19/49 (38%), Positives = 30/49 (61%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           TI+ +K +I  +    P+Q  LIFAGK L+D  +L+   ++   T+HLV
Sbjct: 42  TIQQLKEEISQRFKAHPDQLVLIFAGKILKDPDSLAQCGVRDGLTVHLV 90


>AF188240-1|AAF80171.1|  601|Homo sapiens A1U protein.
          Length = 601

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 19/49 (38%), Positives = 30/49 (61%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +++  K +I  +     +Q  LIFAGK L+DG TL+ + I+   T+HLV
Sbjct: 33  SVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLNQHGIKDGLTVHLV 81


>AF137396-1|AAG41675.1|  670|Homo sapiens ubiquilin 3 protein.
          Length = 670

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 19/49 (38%), Positives = 30/49 (61%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           TI+ +K +I  +    P+Q  LIFAGK L+D  +L+   ++   T+HLV
Sbjct: 57  TIQQLKEEISQRFKAHPDQLVLIFAGKILKDPDSLAQCGVRDGLTVHLV 105


>AB209566-1|BAD92803.1|  600|Homo sapiens ataxin-1 ubiquitin-like
           interacting protein variant protein.
          Length = 600

 Score = 36.7 bits (81), Expect = 0.11
 Identities = 19/49 (38%), Positives = 30/49 (61%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +++  K +I  +     +Q  LIFAGK L+DG TL+ + I+   T+HLV
Sbjct: 32  SVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLNQHGIKDGLTVHLV 80


>BX511262-22|CAM45813.1|  158|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 158

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>BX511262-21|CAM45812.1|  233|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 233

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>BX511262-20|CAM45807.1|  262|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 262

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>BX511262-19|CAM45805.1|  262|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 262

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>BX511262-18|CAM45803.1|  259|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 259

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>BX511262-17|CAM45811.1|  215|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 215

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>BX511262-16|CAM45810.1|  206|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 206

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>BX511262-15|CAM45809.1|  244|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 244

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>BX511262-14|CAM45808.1|  244|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 244

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>BX511262-13|CAM45806.1|  197|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 197

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>BX511262-12|CAM45804.1|  258|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 258

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>BX511262-11|CAM45802.1|  515|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 515

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>BX511262-10|CAM45801.1|  743|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 743

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>BX511262-9|CAM45800.1| 1132|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1132

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>BX511262-8|CAM45799.1| 1126|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1126

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>BC003133-1|AAH03133.1| 1126|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1126

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>BA000025-30|BAB63390.1| 1126|Homo sapiens BAT3 protein.
          Length = 1126

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL805934-24|CAO03665.1|  158|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 158

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL805934-23|CAO03664.1|  233|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 233

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL805934-22|CAO03663.1|  259|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 259

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL805934-21|CAI18503.2|  206|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 206

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL805934-20|CAI18505.2|  262|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 262

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL805934-19|CAI18509.1|  262|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 262

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL805934-18|CAO03662.1|  244|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 244

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL805934-17|CAO03661.1|  215|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 215

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL805934-16|CAO03660.1|  258|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 258

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL805934-15|CAO03659.1|  244|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 244

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL805934-14|CAO03658.1|  197|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 197

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL805934-13|CAI18506.2|  515|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 515

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL805934-12|CAI18508.2|  743|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 743

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL805934-11|CAI18504.1| 1132|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1132

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL805934-10|CAI18501.1| 1126|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1126

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL670886-15|CAM25024.1|  158|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 158

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL670886-14|CAM25023.1|  233|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 233

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL670886-13|CAM25018.1|  258|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 258

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL670886-12|CAM25021.1|  197|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 197

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL670886-11|CAM25017.1|  206|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 206

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL670886-10|CAM25015.1|  215|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 215

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL670886-9|CAM25022.1|  262|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 262

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL670886-8|CAM25019.1|  244|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 244

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL670886-7|CAM25016.1|  244|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 244

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL670886-6|CAI17786.1|  262|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 262

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL670886-5|CAM25020.1|  259|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 259

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL670886-4|CAI17787.2|  515|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 515

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL670886-3|CAM25014.1|  743|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 743

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL670886-2|CAI17785.1| 1132|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1132

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL670886-1|CAI17784.1| 1126|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1126

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662847-15|CAO72082.1|  158|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 158

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662847-14|CAO72081.1|  233|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 233

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662847-13|CAO72079.1|  258|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 258

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662847-12|CAO72077.1|  197|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 197

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662847-11|CAO72076.1|  206|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 206

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662847-10|CAO72075.1|  215|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 215

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662847-9|CAO72080.1|  262|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 262

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662847-8|CAO72078.1|  244|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 244

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662847-7|CAO72073.1|  244|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 244

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662847-6|CAI17660.1|  262|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 262

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662847-5|CAO72074.1|  259|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 259

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662847-4|CAI17661.2|  515|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 515

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662847-3|CAO72072.1|  743|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 743

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662847-2|CAI17659.1| 1132|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1132

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662847-1|CAI17658.1| 1126|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1126

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662801-67|CAM25604.1|  158|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 158

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662801-66|CAM25603.1|  233|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 233

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662801-65|CAM25602.1|  244|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 244

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662801-64|CAM25601.1|  206|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 206

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662801-63|CAM25600.1|  215|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 215

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662801-62|CAM25599.1|  262|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 262

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662801-61|CAM25598.1|  262|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 262

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662801-60|CAM25597.1|  244|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 244

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662801-59|CAM25596.1|  197|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 197

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662801-58|CAM25595.1|  259|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 259

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662801-57|CAM25594.1|  258|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 258

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662801-56|CAI18318.2|  515|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 515

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662801-55|CAI18316.2|  743|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 743

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662801-54|CAI18314.1| 1132|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1132

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AL662801-53|CAI18315.1| 1126|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1126

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 39  VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 85


>AF129756-16|AAD18085.1| 1229|Homo sapiens BAT3 protein.
          Length = 1229

 Score = 36.3 bits (80), Expect = 0.15
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  I     IP  +QRLI+ G+ L+D + L +YN+  +  +HLV
Sbjct: 142 VKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGK-VIHLV 188


>BC039294-1|AAH39294.1|  589|Homo sapiens ubiquilin 1 protein.
          Length = 589

 Score = 35.5 bits (78), Expect = 0.26
 Identities = 20/54 (37%), Positives = 30/54 (55%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V  + +++  K +I  +     +Q  LIFAGK L+D  TLS + I    T+HLV
Sbjct: 52  VPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLV 105


>BC010066-1|AAH10066.1|  561|Homo sapiens ubiquilin 1 protein.
          Length = 561

 Score = 35.5 bits (78), Expect = 0.26
 Identities = 20/54 (37%), Positives = 30/54 (55%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V  + +++  K +I  +     +Q  LIFAGK L+D  TLS + I    T+HLV
Sbjct: 52  VPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLV 105


>AL445215-3|CAH73683.1|  316|Homo sapiens Parkinson disease
           (autosomal recessive, juvenile)core domain 3 (WFDC3)
           protein.
          Length = 316

 Score = 35.5 bits (78), Expect = 0.26
 Identities = 14/43 (32%), Positives = 28/43 (65%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDY 763
           V+   +I  +K  +  ++G+P +Q R+IFAGK+L +  T+ ++
Sbjct: 17  VDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQEF 59


>AL354920-5|CAI15101.1|  589|Homo sapiens ubiquilin 1 protein.
          Length = 589

 Score = 35.5 bits (78), Expect = 0.26
 Identities = 20/54 (37%), Positives = 30/54 (55%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V  + +++  K +I  +     +Q  LIFAGK L+D  TLS + I    T+HLV
Sbjct: 52  VPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLV 105


>AL354920-4|CAI15100.1|  561|Homo sapiens ubiquilin 1 protein.
          Length = 561

 Score = 35.5 bits (78), Expect = 0.26
 Identities = 20/54 (37%), Positives = 30/54 (55%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V  + +++  K +I  +     +Q  LIFAGK L+D  TLS + I    T+HLV
Sbjct: 52  VPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLV 105


>AL132982-3|CAI23603.1|  316|Homo sapiens Parkinson disease
           (autosomal recessive, juvenile)visiae) protein.
          Length = 316

 Score = 35.5 bits (78), Expect = 0.26
 Identities = 14/43 (32%), Positives = 28/43 (65%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDY 763
           V+   +I  +K  +  ++G+P +Q R+IFAGK+L +  T+ ++
Sbjct: 17  VDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQEF 59


>AL035697-4|CAI21387.1|  316|Homo sapiens Parkinson disease
           (autosomal recessive, juvenile)r 1 protein.
          Length = 316

 Score = 35.5 bits (78), Expect = 0.26
 Identities = 14/43 (32%), Positives = 28/43 (65%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDY 763
           V+   +I  +K  +  ++G+P +Q R+IFAGK+L +  T+ ++
Sbjct: 17  VDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQEF 59


>AK074535-1|BAC11045.1|  316|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90054 fis, clone HEMBA1002992, weakly similar to
           UBIQUITIN-LIKE PROTEIN DSK2. ).
          Length = 316

 Score = 35.5 bits (78), Expect = 0.26
 Identities = 20/54 (37%), Positives = 30/54 (55%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V  + +++  K +I  +     +Q  LIFAGK L+D  TLS + I    T+HLV
Sbjct: 52  VPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLV 105


>AF293384-1|AAG02473.1|  589|Homo sapiens PLIC-1 protein.
          Length = 589

 Score = 35.5 bits (78), Expect = 0.26
 Identities = 20/54 (37%), Positives = 30/54 (55%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V  + +++  K +I  +     +Q  LIFAGK L+D  TLS + I    T+HLV
Sbjct: 52  VPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLV 105


>AF176069-1|AAD49751.3|  589|Homo sapiens ubiquilin protein.
          Length = 589

 Score = 35.5 bits (78), Expect = 0.26
 Identities = 20/54 (37%), Positives = 30/54 (55%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V  + +++  K +I  +     +Q  LIFAGK L+D  TLS + I    T+HLV
Sbjct: 52  VPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLV 105


>M21786-1|AAA36128.1|  165|Homo sapiens protein ( Human
           interferon-induced 15-Kd protein (ISG) gene, exon 2. ).
          Length = 165

 Score = 33.1 bits (72), Expect = 1.4
 Identities = 16/53 (30%), Positives = 29/53 (54%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V  + T+ ++K ++   EG+  +   L F GK LED   L +Y ++  ST+ +
Sbjct: 98  VRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFM 150


>M13755-1|AAA36038.1|  165|Homo sapiens protein ( Human
           interferon-induced 17-kDa/15-kDa protein mRNA, complete
           cds. ).
          Length = 165

 Score = 33.1 bits (72), Expect = 1.4
 Identities = 16/53 (30%), Positives = 29/53 (54%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V  + T+ ++K ++   EG+  +   L F GK LED   L +Y ++  ST+ +
Sbjct: 98  VRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFM 150


>BT007297-1|AAP35961.1|  165|Homo sapiens interferon,
           alpha-inducible protein (clone IFI-15K) protein.
          Length = 165

 Score = 33.1 bits (72), Expect = 1.4
 Identities = 16/53 (30%), Positives = 29/53 (54%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V  + T+ ++K ++   EG+  +   L F GK LED   L +Y ++  ST+ +
Sbjct: 98  VRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFM 150


>BC009507-1|AAH09507.1|  165|Homo sapiens ISG15 ubiquitin-like
           modifier protein.
          Length = 165

 Score = 33.1 bits (72), Expect = 1.4
 Identities = 16/53 (30%), Positives = 29/53 (54%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V  + T+ ++K ++   EG+  +   L F GK LED   L +Y ++  ST+ +
Sbjct: 98  VRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFM 150


>AY168648-1|AAN86983.1|  165|Homo sapiens ubiquitin-like protein
           ISG15 protein.
          Length = 165

 Score = 33.1 bits (72), Expect = 1.4
 Identities = 16/53 (30%), Positives = 29/53 (54%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V  + T+ ++K ++   EG+  +   L F GK LED   L +Y ++  ST+ +
Sbjct: 98  VRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFM 150


>AL645608-12|CAI15574.1|  165|Homo sapiens ISG15 ubiquitin-like
           modifier protein.
          Length = 165

 Score = 33.1 bits (72), Expect = 1.4
 Identities = 16/53 (30%), Positives = 29/53 (54%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V  + T+ ++K ++   EG+  +   L F GK LED   L +Y ++  ST+ +
Sbjct: 98  VRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFM 150


>BC069237-1|AAH69237.1|  624|Homo sapiens UBQLN2 protein protein.
          Length = 624

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 19/54 (35%), Positives = 28/54 (51%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V  + +++  K  I  +     +Q  LIFAGK L+D  TL  + I    T+HLV
Sbjct: 48  VPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLV 101


>AL442081-1|CAC09446.1|  588|Homo sapiens hypothetical protein
           protein.
          Length = 588

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 19/54 (35%), Positives = 28/54 (51%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V  + +++  K  I  +     +Q  LIFAGK L+D  TL  + I    T+HLV
Sbjct: 12  VPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLV 65


>AL354793-1|CAD13519.1|  624|Homo sapiens ubiquilin 2 protein.
          Length = 624

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 19/54 (35%), Positives = 28/54 (51%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V  + +++  K  I  +     +Q  LIFAGK L+D  TL  + I    T+HLV
Sbjct: 48  VPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLV 101


>AF293385-1|AAG02474.1|  624|Homo sapiens PLIC-2 protein.
          Length = 624

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 19/54 (35%), Positives = 28/54 (51%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V  + +++  K  I  +     +Q  LIFAGK L+D  TL  + I    T+HLV
Sbjct: 48  VPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLV 101


>AF189009-1|AAF17237.1|  624|Homo sapiens ubiquitin-like product
           Chap1/Dsk2 protein.
          Length = 624

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 19/54 (35%), Positives = 28/54 (51%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V  + +++  K  I  +     +Q  LIFAGK L+D  TL  + I    T+HLV
Sbjct: 48  VPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLV 101


>AB035275-1|BAB20436.1|  589|Homo sapiens DA41 protein.
          Length = 589

 Score = 32.7 bits (71), Expect = 1.8
 Identities = 19/54 (35%), Positives = 29/54 (53%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V  + +++  K +I  +     +Q  LIFAGK L+D  T S + I    T+HLV
Sbjct: 52  VPENSSVQQSKEEISKRFKSHTDQLVLIFAGKILKDQDTSSQHGIHDGLTVHLV 105


>X14329-1|CAA32507.1|  458|Homo sapiens protein ( Human mRNA for
           carboxypeptidase N small subunit (EC 3.4.17.3). ).
          Length = 458

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 16/49 (32%), Positives = 24/49 (48%)
 Frame = +1

Query: 421 PSYTAVASVPYRLEGTYLFVVVFEDHRAMTLPAVVTVLHHRHEHSGAAL 567
           P  T V S+   +EG +L+V+ F DH  +  P    V +  + H   AL
Sbjct: 43  PGITRVYSIGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEAL 91


>BC027897-1|AAH27897.1|  458|Homo sapiens carboxypeptidase N,
           polypeptide 1 protein.
          Length = 458

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 16/49 (32%), Positives = 24/49 (48%)
 Frame = +1

Query: 421 PSYTAVASVPYRLEGTYLFVVVFEDHRAMTLPAVVTVLHHRHEHSGAAL 567
           P  T V S+   +EG +L+V+ F DH  +  P    V +  + H   AL
Sbjct: 43  PGITRVYSIGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEAL 91


>AL441886-3|CAI13078.1|  458|Homo sapiens carboxypeptidase N,
           polypeptide 1 protein.
          Length = 458

 Score = 30.3 bits (65), Expect = 9.8
 Identities = 16/49 (32%), Positives = 24/49 (48%)
 Frame = +1

Query: 421 PSYTAVASVPYRLEGTYLFVVVFEDHRAMTLPAVVTVLHHRHEHSGAAL 567
           P  T V S+   +EG +L+V+ F DH  +  P    V +  + H   AL
Sbjct: 43  PGITRVYSIGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEAL 91


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 119,774,768
Number of Sequences: 237096
Number of extensions: 2533121
Number of successful extensions: 5208
Number of sequences better than 10.0: 237
Number of HSP's better than 10.0 without gapping: 4884
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5208
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 11437206932
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).