SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0020
         (788 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X04098-1|CAA27723.1|  375|Homo sapiens gamma-actin protein.           489   e-138
M19283-1|AAA51579.1|  375|Homo sapiens ACTG1 protein.                 489   e-138
BT019856-1|AAV38659.1|  375|Homo sapiens actin, gamma 1 protein.      489   e-138
BC053572-1|AAH53572.1|  375|Homo sapiens actin, gamma 1 protein.      489   e-138
BC018774-1|AAH18774.1|  375|Homo sapiens ACTG1 protein protein.       489   e-138
BC015779-1|AAH15779.1|  375|Homo sapiens ACTG1 protein protein.       489   e-138
BC015695-1|AAH15695.1|  375|Homo sapiens actin, gamma 1 protein.      489   e-138
BC015005-1|AAH15005.1|  375|Homo sapiens ACTG1 protein protein.       489   e-138
BC012050-1|AAH12050.1|  375|Homo sapiens actin, gamma 1 protein.      489   e-138
BC010999-1|AAH10999.1|  375|Homo sapiens actin, gamma 1 protein.      489   e-138
BC009848-1|AAH09848.1|  375|Homo sapiens actin, gamma 1 protein.      489   e-138
BC007442-1|AAH07442.1|  375|Homo sapiens actin, gamma 1 protein.      489   e-138
BC001920-1|AAH01920.1|  375|Homo sapiens ACTG1 protein protein.       489   e-138
BC000292-1|AAH00292.1|  375|Homo sapiens actin, gamma 1 protein.      489   e-138
X00351-1|CAA25099.1|  375|Homo sapiens protein ( Human mRNA for ...   489   e-138
M10277-1|AAA51567.1|  375|Homo sapiens protein ( Human cytoplasm...   489   e-138
DQ471327-1|ABF01018.1|  375|Homo sapiens PS1TP5-binding protein ...   489   e-138
BC014861-1|AAH14861.1|  375|Homo sapiens actin, beta protein.         489   e-138
BC013380-1|AAH13380.1|  375|Homo sapiens actin, beta protein.         489   e-138
BC004251-1|AAH04251.1|  375|Homo sapiens actin, beta protein.         489   e-138
BC002409-1|AAH02409.1|  375|Homo sapiens actin, beta protein.         489   e-138
BC001301-1|AAH01301.1|  375|Homo sapiens actin, beta protein.         489   e-138
AY582799-1|AAS79319.1|  375|Homo sapiens actin, beta protein.         489   e-138
AK223055-1|BAD96775.1|  375|Homo sapiens beta actin variant prot...   489   e-138
AK223032-1|BAD96752.1|  375|Homo sapiens beta actin variant prot...   489   e-138
AK222925-1|BAD96645.1|  375|Homo sapiens beta actin variant prot...   489   e-138
AC006483-1|AAP22343.1|  375|Homo sapiens unknown protein.             489   e-138
X63432-1|CAA45026.1|  375|Homo sapiens mutant beta-actin  (beta'...   488   e-137
BC016045-1|AAH16045.1|  375|Homo sapiens actin, beta protein.         487   e-137
BC008633-1|AAH08633.1|  368|Homo sapiens actin, beta protein.         481   e-135
X16940-1|CAA34814.1|  376|Homo sapiens protein ( Human mRNA for ...   478   e-134
D00654-1|BAA00546.1|  376|Homo sapiens enteric smooth muscle gam...   478   e-134
CR541794-1|CAG46593.1|  376|Homo sapiens ACTG2 protein.               478   e-134
BC094877-1|AAH94877.1|  376|Homo sapiens ACTG2 protein protein.       478   e-134
BC012617-1|AAH12617.1|  376|Homo sapiens actin, gamma 2, smooth ...   478   e-134
AC073046-2|AAX88909.1|  376|Homo sapiens unknown protein.             478   e-134
CR536515-1|CAG38753.1|  376|Homo sapiens ACTG2 protein.               477   e-134
X13839-1|CAA32064.1|  377|Homo sapiens protein ( Human mRNA for ...   473   e-133
M20543-1|AAA60296.1|  377|Homo sapiens ACTA1 protein.                 473   e-133
J00073-1|AAB59619.1|  377|Homo sapiens alpha-cardiac actin protein.   473   e-133
J00068-1|AAB59376.1|  377|Homo sapiens ACTA1 protein.                 473   e-133
CR541796-1|CAG46595.1|  377|Homo sapiens ACTA1 protein.               473   e-133
CR541795-1|CAG46594.1|  377|Homo sapiens ACTC protein.                473   e-133
CR536518-1|CAG38756.1|  377|Homo sapiens ACTA2 protein.               473   e-133
CR536516-1|CAG38754.1|  377|Homo sapiens ACTA1 protein.               473   e-133
BC093052-1|AAH93052.1|  377|Homo sapiens actin, alpha 2, smooth ...   473   e-133
BC017554-1|AAH17554.1|  377|Homo sapiens actin, alpha 2, smooth ...   473   e-133
BC012597-1|AAH12597.1|  377|Homo sapiens actin, alpha 1, skeleta...   473   e-133
BC009978-1|AAH09978.1|  377|Homo sapiens actin, alpha, cardiac m...   473   e-133
AY692464-1|AAW29811.1|  377|Homo sapiens growth-inhibiting gene ...   473   e-133
AL160004-6|CAI19050.1|  377|Homo sapiens actin, alpha 1, skeleta...   473   e-133
AL157394-6|CAI13864.1|  377|Homo sapiens actin, alpha 2, smooth ...   473   e-133
AF182035-1|AAF02694.1|  377|Homo sapiens skeletal muscle alpha-a...   473   e-133
J05192-1|AAA51577.1|  377|Homo sapiens ACTA3 protein.                 470   e-132
K01747-1|AAA51586.1|  330|Homo sapiens ACTA2 protein.                 467   e-131
BC012854-1|AAH12854.1|  360|Homo sapiens ACTB protein protein.        462   e-130
BC017450-1|AAH17450.1|  363|Homo sapiens Unknown (protein for IM...   459   e-129
EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin prot...   448   e-126
AY280960-1|AAP37280.1|  254|Homo sapiens actin alpha 1 skeletal ...   325   1e-88
AL157394-7|CAI13865.1|  151|Homo sapiens actin, alpha 2, smooth ...   305   1e-82
X82207-1|CAA57691.1|  376|Homo sapiens beta-centracetin protein.      291   2e-78
BC010090-1|AAH10090.1|  376|Homo sapiens ARP1 actin-related prot...   291   2e-78
BC006372-1|AAH06372.1|  376|Homo sapiens ARP1 actin-related prot...   291   2e-78
BC004374-1|AAH04374.1|  376|Homo sapiens ARP1 actin-related prot...   291   2e-78
AC017099-2|AAY24280.1|  376|Homo sapiens unknown protein.             291   2e-78
Z14978-1|CAA78701.1|  376|Homo sapiens actin-related protein pro...   285   2e-76
X82206-1|CAA57690.1|  376|Homo sapiens alpha-centractin protein.      285   2e-76
BC026016-1|AAH26016.1|  376|Homo sapiens ARP1 actin-related prot...   285   2e-76
BC000693-1|AAH00693.1|  376|Homo sapiens ARP1 actin-related prot...   285   2e-76
AL121928-12|CAC08404.1|  376|Homo sapiens ARP1 actin-related pro...   285   2e-76
EF095209-1|ABL01513.1|  121|Homo sapiens beta-actin protein.          268   2e-71
X82208-1|CAA57692.1|  329|Homo sapiens beta-centractin protein.       262   1e-69
BC023548-1|AAH23548.1|  263|Homo sapiens ACTG1 protein protein.       251   2e-66
AF006082-1|AAB64187.1|  394|Homo sapiens Arp2 protein.                250   6e-66
BC014546-1|AAH14546.1|  394|Homo sapiens ARP2 actin-related prot...   246   5e-65
Z74696-1|CAI42428.1|  376|Homo sapiens actin-related protein T1 ...   245   1e-64
BC014597-1|AAH14597.1|  376|Homo sapiens actin-related protein T...   245   1e-64
AL356984-1|CAH72587.1|  377|Homo sapiens actin-related protein M...   245   1e-64
AK058153-1|BAB71690.1|  328|Homo sapiens protein ( Homo sapiens ...   245   1e-64
AF440740-1|AAM00433.1|  377|Homo sapiens actin-related protein T...   245   1e-64
AF440739-1|AAM00432.1|  376|Homo sapiens actin-related protein T...   245   1e-64
AL160004-5|CAI19052.1|  342|Homo sapiens actin, alpha 1, skeleta...   244   4e-64
AL160004-4|CAI19051.1|  287|Homo sapiens actin, alpha 1, skeleta...   244   4e-64
AB057364-1|BAB85862.1|  377|Homo sapiens actin-related protein h...   243   5e-64
AK055346-1|BAB70906.1|  372|Homo sapiens protein ( Homo sapiens ...   242   9e-64
AB049117-1|BAB39481.1|  372|Homo sapiens actin related protein p...   242   9e-64
BC029499-1|AAH29499.1|  376|Homo sapiens actin-related protein T...   241   2e-63
BC007289-1|AAH07289.1|  372|Homo sapiens actin related protein M...   237   3e-62
BC014610-1|AAH14610.1|  435|Homo sapiens actin-like 7A protein.       222   1e-57
AL359692-4|CAI40571.1|  435|Homo sapiens actin-like 7A protein.       222   1e-57
AF113526-1|AAD44109.1|  435|Homo sapiens actin-like-7-alpha prot...   222   1e-57
AB284520-1|BAF41971.1|  435|Homo sapiens human t-actin 2 protein.     222   1e-57
AY970501-1|AAX82307.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970498-1|AAX82304.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970497-1|AAX82303.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970495-1|AAX82301.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970494-1|AAX82300.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970493-1|AAX82299.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970491-1|AAX82297.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970489-1|AAX82295.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970488-1|AAX82294.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970487-1|AAX82293.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970486-1|AAX82292.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970478-1|AAX82284.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970476-1|AAX82282.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970474-1|AAX82280.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970473-1|AAX82279.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970472-1|AAX82278.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970471-1|AAX82277.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970470-1|AAX82276.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970469-1|AAX82275.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970468-1|AAX82274.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970443-1|AAX82252.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970441-1|AAX82250.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970419-1|AAX82228.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970418-1|AAX82227.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970417-1|AAX82226.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970416-1|AAX82225.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970415-1|AAX82224.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970414-1|AAX82223.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970413-1|AAX82222.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970412-1|AAX82221.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970411-1|AAX82220.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970410-1|AAX82219.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970409-1|AAX82218.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970408-1|AAX82217.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970406-1|AAX82215.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970405-1|AAX82214.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970404-1|AAX82213.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970403-1|AAX82212.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970402-1|AAX82211.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970382-1|AAX82191.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970381-1|AAX82190.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970380-1|AAX82189.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970377-1|AAX82186.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970375-1|AAX82184.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970372-1|AAX82182.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970371-1|AAX82181.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970370-1|AAX82180.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970369-1|AAX82179.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970368-1|AAX82178.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970366-1|AAX82176.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970364-1|AAX82174.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970363-1|AAX82173.1|  103|Homo sapiens actin-like protein prot...   218   2e-56
AY970492-1|AAX82298.1|  103|Homo sapiens actin-like protein prot...   217   4e-56
AY970490-1|AAX82296.1|  103|Homo sapiens actin-like protein prot...   217   5e-56
AY970444-1|AAX82253.1|  103|Homo sapiens actin-like protein prot...   217   5e-56
AY970500-1|AAX82306.1|  103|Homo sapiens actin-like protein prot...   216   7e-56
AY970442-1|AAX82251.1|  103|Homo sapiens actin-like protein prot...   216   7e-56
AY970374-1|AAX82183.1|  103|Homo sapiens actin-like protein prot...   216   9e-56
BC036253-1|AAH36253.1|  339|Homo sapiens ACTR2 protein protein.       215   1e-55
AY970485-1|AAX82291.1|  103|Homo sapiens actin-like protein prot...   215   1e-55
AY970477-1|AAX82283.1|  103|Homo sapiens actin-like protein prot...   215   1e-55
AY970383-1|AAX82192.1|  103|Homo sapiens actin-like protein prot...   215   1e-55
AY970376-1|AAX82185.1|  103|Homo sapiens actin-like protein prot...   215   1e-55
AY970365-1|AAX82175.1|  103|Homo sapiens actin-like protein prot...   215   1e-55
AY970496-1|AAX82302.1|  103|Homo sapiens actin-like protein prot...   215   2e-55
AY970420-1|AAX82229.1|  103|Homo sapiens actin-like protein prot...   215   2e-55
AY970421-1|AAX82230.1|  103|Homo sapiens actin-like protein prot...   215   2e-55
AY970367-1|AAX82177.1|  103|Homo sapiens actin-like protein prot...   213   5e-55
AY970502-1|AAX82308.1|  103|Homo sapiens actin-like protein prot...   213   8e-55
AY970475-1|AAX82281.1|  103|Homo sapiens actin-like protein prot...   213   8e-55
AY970390-1|AAX82199.1|  103|Homo sapiens actin-like protein prot...   213   8e-55
AY970483-1|AAX82289.1|  103|Homo sapiens actin-like protein prot...   212   1e-54
AY970385-1|AAX82194.1|  103|Homo sapiens actin-like protein prot...   211   2e-54
AY970440-1|AAX82249.1|  103|Homo sapiens actin-like protein prot...   211   2e-54
AY970439-1|AAX82248.1|  103|Homo sapiens actin-like protein prot...   211   2e-54
AY970460-1|AAX82267.1|  103|Homo sapiens actin-like protein prot...   210   3e-54
AY970407-1|AAX82216.1|  103|Homo sapiens actin-like protein prot...   210   4e-54
AY970384-1|AAX82193.1|  103|Homo sapiens actin-like protein prot...   210   4e-54
AY970499-1|AAX82305.1|  103|Homo sapiens actin-like protein prot...   210   6e-54
AY970479-1|AAX82285.1|  103|Homo sapiens actin-like protein prot...   209   8e-54
AY970457-1|AAX82264.1|  103|Homo sapiens actin-like protein prot...   209   1e-53
AY970431-1|AAX82240.1|  103|Homo sapiens actin-like protein prot...   209   1e-53
AY970430-1|AAX82239.1|  103|Homo sapiens actin-like protein prot...   209   1e-53
AY970428-1|AAX82237.1|  103|Homo sapiens actin-like protein prot...   209   1e-53
AY970389-1|AAX82198.1|  103|Homo sapiens actin-like protein prot...   209   1e-53
AY970446-1|AAX82255.1|  103|Homo sapiens actin-like protein prot...   208   1e-53
AY970386-1|AAX82195.1|  103|Homo sapiens actin-like protein prot...   208   1e-53
AY970456-1|AAX82263.1|  103|Homo sapiens actin-like protein prot...   207   3e-53
AY970429-1|AAX82238.1|  103|Homo sapiens actin-like protein prot...   207   3e-53
AY970388-1|AAX82197.1|  103|Homo sapiens actin-like protein prot...   207   3e-53
AY970387-1|AAX82196.1|  103|Homo sapiens actin-like protein prot...   207   3e-53
AY970464-1|AAX82271.1|  103|Homo sapiens actin-like protein prot...   207   4e-53
AY970378-1|AAX82187.1|  103|Homo sapiens actin-like protein prot...   207   4e-53
AY970480-1|AAX82286.1|  103|Homo sapiens actin-like protein prot...   206   7e-53
AY970452-1|AAX82260.1|  103|Homo sapiens actin-like protein prot...   206   7e-53
AY970454-1|AAX82261.1|  103|Homo sapiens actin-like protein prot...   206   9e-53
AY970432-1|AAX82241.1|  103|Homo sapiens actin-like protein prot...   206   9e-53
AY970455-1|AAX82262.1|  103|Homo sapiens actin-like protein prot...   205   1e-52
AY970433-1|AAX82242.1|  103|Homo sapiens actin-like protein prot...   205   1e-52
AY970463-1|AAX82270.1|  103|Homo sapiens actin-like protein prot...   205   2e-52
AY970426-1|AAX82235.1|  103|Homo sapiens actin-like protein prot...   205   2e-52
AY970392-1|AAX82201.1|  103|Homo sapiens actin-like protein prot...   205   2e-52
BC033789-1|AAH33789.1|  415|Homo sapiens actin-like 7B protein.       204   2e-52
AL359692-3|CAI40570.1|  415|Homo sapiens actin-like 7B protein.       204   2e-52
AF113527-1|AAD44110.1|  415|Homo sapiens actin-like-7-beta protein.   204   2e-52
AB284521-1|BAF41972.1|  415|Homo sapiens t-actin 1 protein.           204   2e-52
AY970451-1|AAX82259.1|  103|Homo sapiens actin-like protein prot...   203   5e-52
AY970462-1|AAX82269.1|  103|Homo sapiens actin-like protein prot...   202   1e-51
AY970391-1|AAX82200.1|  103|Homo sapiens actin-like protein prot...   202   1e-51
AY970461-1|AAX82268.1|  103|Homo sapiens actin-like protein prot...   200   3e-51
BC045752-1|AAH45752.1|  416|Homo sapiens hypothetical protein MG...   200   5e-51
BC024028-1|AAH24028.1|  416|Homo sapiens hypothetical protein MG...   200   5e-51
AY970458-1|AAX82265.1|  103|Homo sapiens actin-like protein prot...   200   6e-51
AY970447-1|AAX82256.1|  103|Homo sapiens actin-like protein prot...   200   6e-51
AY970427-1|AAX82236.1|  103|Homo sapiens actin-like protein prot...   198   1e-50
AY970459-1|AAX82266.1|  103|Homo sapiens actin-like protein prot...   197   3e-50
BC113036-1|AAI13037.1|  103|Homo sapiens ACTB protein protein.        196   6e-50
AY970424-1|AAX82233.1|  103|Homo sapiens actin-like protein prot...   196   8e-50
AY970425-1|AAX82234.1|  103|Homo sapiens actin-like protein prot...   195   2e-49
AY970422-1|AAX82231.1|  103|Homo sapiens actin-like protein prot...   192   9e-49
AY970467-1|AAX82273.1|  103|Homo sapiens actin-like protein prot...   192   1e-48
AY970448-1|AAX82257.1|  103|Homo sapiens actin-like protein prot...   192   1e-48
AY970401-1|AAX82210.1|  103|Homo sapiens actin-like protein prot...   192   1e-48
AY970396-1|AAX82205.1|  103|Homo sapiens actin-like protein prot...   191   2e-48
AY970398-1|AAX82207.1|  103|Homo sapiens actin-like protein prot...   191   3e-48
AY970423-1|AAX82232.1|  103|Homo sapiens actin-like protein prot...   190   4e-48
AY970481-1|AAX82287.1|  103|Homo sapiens actin-like protein prot...   190   7e-48
M16247-1|AAA51580.1|  232|Homo sapiens ACTG1 protein.                 189   9e-48
AY970400-1|AAX82209.1|  103|Homo sapiens actin-like protein prot...   188   2e-47
AY970445-1|AAX82254.1|  103|Homo sapiens actin-like protein prot...   183   6e-46
AY970395-1|AAX82204.1|  103|Homo sapiens actin-like protein prot...   183   6e-46
AY970379-1|AAX82188.1|  103|Homo sapiens actin-like protein prot...   183   6e-46
BC015207-1|AAH15207.1|  348|Homo sapiens ARP3 actin-related prot...   183   7e-46
BC008682-1|AAH08682.1|  418|Homo sapiens ARP3 actin-related prot...   183   7e-46
AF023453-1|AAC98904.1|  418|Homo sapiens actin-related protein 3...   183   7e-46
AY970438-1|AAX82247.1|  103|Homo sapiens actin-like protein prot...   181   2e-45
AY970484-1|AAX82290.1|  103|Homo sapiens actin-like protein prot...   180   5e-45
AY970397-1|AAX82206.1|  103|Homo sapiens actin-like protein prot...   180   7e-45
BC044590-1|AAH44590.1|  418|Homo sapiens ARP3 actin-related prot...   179   1e-44
AF127773-1|AAD51904.1|  418|Homo sapiens unknown protein.             179   1e-44
AF006083-1|AAB64188.1|  418|Homo sapiens Arp3 protein.                179   1e-44
AC110769-1|AAX93226.1|  418|Homo sapiens unknown protein.             179   1e-44
AY970503-1|AAX82309.1|  103|Homo sapiens actin-like protein prot...   178   2e-44
AY970437-1|AAX82246.1|  103|Homo sapiens actin-like protein prot...   177   4e-44
AY970436-1|AAX82245.1|  103|Homo sapiens actin-like protein prot...   176   6e-44
AY970465-1|AAX82272.1|  103|Homo sapiens actin-like protein prot...   176   9e-44
AY970394-1|AAX82203.1|  103|Homo sapiens actin-like protein prot...   174   3e-43
AY970434-1|AAX82243.1|  103|Homo sapiens actin-like protein prot...   174   3e-43
AY970435-1|AAX82244.1|  103|Homo sapiens actin-like protein prot...   173   8e-43
AY970482-1|AAX82288.1|  103|Homo sapiens actin-like protein prot...   171   2e-42
AY970393-1|AAX82202.1|  103|Homo sapiens actin-like protein prot...   170   4e-42
AF086920-1|AAP97150.1|  402|Homo sapiens actin related protein A...   162   1e-39
AB209353-1|BAD92590.1|  369|Homo sapiens ARP3 actin-related prot...   158   2e-38
AY970399-1|AAX82208.1|   97|Homo sapiens actin-like protein prot...   157   6e-38
AY970450-1|AAX82258.1|  102|Homo sapiens actin-like protein prot...   149   1e-35
BC028909-1|AAH28909.1|  366|Homo sapiens actin-like 8 protein.        138   2e-32
AL136529-1|CAC15940.1|  366|Homo sapiens actin-like 8 protein.        138   2e-32
AK057339-1|BAB71434.1|  366|Homo sapiens protein ( Homo sapiens ...   138   2e-32
BC020944-1|AAH20944.1|  426|Homo sapiens actin-like 6B protein.       137   5e-32
AF053356-5|AAC78795.1|  475|Homo sapiens actin like gene protein.     137   5e-32
AF041475-1|AAD54678.1|  426|Homo sapiens BAF53b protein.              137   5e-32
AC099394-1|AAP21874.1|  426|Homo sapiens unknown protein.             137   5e-32
AB015906-1|BAA74576.1|  426|Homo sapiens actin-related protein h...   137   5e-32
CR533529-1|CAG38560.1|  429|Homo sapiens BAF53A protein.              136   6e-32
BC036371-1|AAH36371.1|  429|Homo sapiens actin-like 6A protein.       136   1e-31
BC001391-1|AAH01391.1|  429|Homo sapiens actin-like 6A protein.       136   1e-31
AF041474-1|AAC94991.1|  429|Homo sapiens BAF53a protein.              136   1e-31
AB015907-1|BAA74577.1|  429|Homo sapiens actin-related protein h...   136   1e-31
AK223212-1|BAD96932.1|  429|Homo sapiens actin-like 6A isoform 1...   131   2e-30
AY129015-1|AAM98758.1|  109|Homo sapiens unknown protein.             120   5e-27
BC000949-1|AAH00949.1|  387|Homo sapiens actin-like 6A protein.       114   3e-25
AB061315-1|BAB87848.1|  387|Homo sapiens hArpNbeta-s protein.         114   3e-25
AB060168-1|BAB87844.1|  387|Homo sapiens hArpNbeta-s protein.         114   3e-25
BC092424-1|AAH92424.1|  219|Homo sapiens Unknown (protein for MG...   105   2e-22
AB039791-1|BAB21501.1|  210|Homo sapiens actin-related protein A...   101   4e-21
BC020234-1|AAH20234.1|  195|Homo sapiens Unknown (protein for MG...    92   2e-18
BC015107-1|AAH15107.1|  396|Homo sapiens ARP6 actin-related prot...    86   1e-16
AK023495-1|BAB14588.1|  396|Homo sapiens protein ( Homo sapiens ...    86   1e-16
AF212251-1|AAK14934.1|  396|Homo sapiens CDA12 protein.                86   1e-16
AB038229-1|BAB20762.1|  396|Homo sapiens hARPX protein.                86   1e-16
AK222959-1|BAD96679.1|  396|Homo sapiens ARP6 actin-related prot...    85   3e-16
BC038402-1|AAH38402.1|  607|Homo sapiens ARP5 actin-related prot...    83   1e-15
AL133519-2|CAD37358.1|  607|Homo sapiens ARP5 actin-related prot...    83   1e-15
AK022847-1|BAB14270.1|  607|Homo sapiens protein ( Homo sapiens ...    83   1e-15
AB209174-1|BAD92411.1|  282|Homo sapiens actin-related protein 3...    78   3e-14
U20582-1|AAA62476.1|  302|Homo sapiens protein ( Human actin-lik...    76   1e-13
BC011997-1|AAH11997.1|  417|Homo sapiens actin-related protein 1...    75   4e-13
BC005208-1|AAH05208.1|  339|Homo sapiens Unknown (protein for IM...    75   4e-13
AK022534-1|BAB14083.1|  417|Homo sapiens protein ( Homo sapiens ...    75   4e-13
AF220190-1|AAF67655.1|  417|Homo sapiens uncharacterized hypotha...    75   4e-13
AK222624-1|BAD96344.1|  417|Homo sapiens uncharacterized hypotha...    74   7e-13
AK222702-1|BAD96422.1|  417|Homo sapiens uncharacterized hypotha...    73   9e-13
AK000544-1|BAA91243.1|  417|Homo sapiens protein ( Homo sapiens ...    73   1e-12
AY211911-1|AAO65164.1|  280|Homo sapiens sarcoma antigen NY-SAR-...    72   2e-12
AL121906-3|CAI22126.1|  245|Homo sapiens chromosome 20 open read...    68   4e-11
EF036500-1|ABO65086.1|  132|Homo sapiens beta-actin protein.           62   2e-09
DQ407611-1|ABD66582.1|  151|Homo sapiens beta-actin protein.           57   8e-08
AK023684-1|BAB14640.1|  288|Homo sapiens protein ( Homo sapiens ...    56   2e-07
BC010417-1|AAH10417.2|  165|Homo sapiens ACTG1 protein protein.        55   3e-07
BC009544-1|AAH09544.1|  159|Homo sapiens Unknown (protein for IM...    43   0.001
M94131-1|AAA59163.1| 1270|Homo sapiens mucin protein.                  43   0.001
M74027-1|AAA59875.1|  573|Homo sapiens mucin protein.                  43   0.001
L21998-1|AAB95295.1| 5179|Homo sapiens mucin protein.                  43   0.001
AB018318-1|BAA34495.2|  639|Homo sapiens KIAA0775 protein protein.     42   0.003
BC004223-1|AAH04223.2|   32|Homo sapiens ACTG1 protein protein.        41   0.004
BC117331-1|AAI17332.1|  346|Homo sapiens selenoprotein V protein.      39   0.018
AY324825-1|AAP85542.1|  346|Homo sapiens selenoprotein V protein.      39   0.018
BC125049-1|AAI25050.1|  401|Homo sapiens keratin associated prot...    38   0.031
BC125048-1|AAI25049.1|  401|Homo sapiens keratin associated prot...    38   0.031
AB076353-1|BAD01540.1|  365|Homo sapiens keratin associated prot...    38   0.041
BC053992-1|AAH53992.1| 1312|Homo sapiens SR-related CTD-associat...    37   0.072
AK024444-1|BAB15734.1| 1343|Homo sapiens FLJ00034 protein protein.     37   0.072
AF254411-1|AAF87552.1| 1312|Homo sapiens ser/arg-rich pre-mRNA s...    37   0.072
BC006350-1|AAH06350.1|  619|Homo sapiens BUD13 homolog (S. cerev...    36   0.17 
AB076351-1|BAD01538.1|  401|Homo sapiens keratin associated prot...    36   0.17 
BC054003-1|AAH54003.1| 1192|Homo sapiens RNASEN protein protein.       35   0.29 
AF189011-1|AAF80558.1| 1374|Homo sapiens ribonuclease III protein.     35   0.29 
X79990-1|CAA56311.1|  574|Homo sapiens ETO protein.                    35   0.38 
S78159-1|AAB34820.2|  231|Homo sapiens AML1-ETO fusion protein p...    35   0.38 
S78158-1|AAB34819.2|  588|Homo sapiens AMLI-ETO fusion protein p...    35   0.38 
D43638-1|BAA07755.1|  577|Homo sapiens MTG8a protein protein.          35   0.38 
D14823-1|BAA03560.1|  251|Homo sapiens chimeric protein protein.       35   0.38 
D14822-1|BAA03559.1|  198|Homo sapiens chimeric protein protein.       35   0.38 
D14821-1|BAA03558.1|  604|Homo sapiens MTG8b protein protein.          35   0.38 
D13979-1|BAA03089.1|  752|Homo sapiens AML1-MTG8 fusion protein ...    35   0.38 
CR456792-1|CAG33073.1|  577|Homo sapiens CBFA2T1 protein.              35   0.38 
AF018282-2|AAC28931.1|  577|Homo sapiens putative transcription ...    35   0.38 
AF018282-1|AAC28932.1|  604|Homo sapiens putative transcription ...    35   0.38 
AF018280-2|AAC28933.1|  400|Homo sapiens putative transcription ...    35   0.38 
AF018280-1|AAC28934.1|  427|Homo sapiens putative transcription ...    35   0.38 
AB076350-1|BAD01537.1|  221|Homo sapiens keratin associated prot...    35   0.38 
M22406-1|AAA36335.1|   76|Homo sapiens protein ( Human intestina...    34   0.51 
K00790-1|AAA51578.1|   17|Homo sapiens ACTB protein.                   34   0.51 
AB076364-1|BAD01551.1|  245|Homo sapiens keratin associated prot...    34   0.51 
BC119643-1|AAI19644.1|  370|Homo sapiens keratin associated prot...    34   0.67 
AB076354-1|BAD01541.1|  370|Homo sapiens keratin associated prot...    34   0.67 
AL445686-3|CAI14683.1|  913|Homo sapiens serine/arginine repetit...    33   0.89 
AL445648-2|CAH73089.1|  913|Homo sapiens serine/arginine repetit...    33   0.89 
AJ298318-1|CAC83675.1| 1349|Homo sapiens mucin 5 protein.              33   0.89 
X87248-1|CAA60698.1|  341|Homo sapiens HP8 peptide protein.            33   1.2  
AK074175-1|BAB85001.1|  501|Homo sapiens FLJ00248 protein protein.     33   1.2  
AF182077-1|AAF62874.1| 1509|Homo sapiens glioma tumor suppressor...    33   1.2  
Z34277-1|CAA84031.1|  477|Homo sapiens mucin protein.                  33   1.6  
BC113562-1|AAI13563.1|  416|Homo sapiens hepatocyte cell adhesio...    33   1.6  
BC104831-1|AAI04832.1|  416|Homo sapiens hepatocyte cell adhesio...    33   1.6  
AY047587-1|AAQ93018.1|  416|Homo sapiens hypothetical protein pr...    33   1.6  
AL834419-1|CAD39081.1|  165|Homo sapiens hypothetical protein pr...    33   1.6  
AK098396-1|BAC05297.1|  416|Homo sapiens protein ( Homo sapiens ...    33   1.6  
BC065199-1|AAH65199.1|  453|Homo sapiens family with sequence si...    32   2.1  
BC037572-1|AAH37572.1|  453|Homo sapiens family with sequence si...    32   2.1  
BC036187-1|AAH36187.1|  904|Homo sapiens serine/arginine repetit...    32   2.1  
AL445686-4|CAI14682.1|  904|Homo sapiens serine/arginine repetit...    32   2.1  
AL445648-3|CAH73090.1|  904|Homo sapiens serine/arginine repetit...    32   2.1  
AF419855-1|AAP97290.1|  820|Homo sapiens Ser/Arg-related nuclear...    32   2.1  
AF123073-1|AAK01477.1|  453|Homo sapiens C/EBP-induced protein p...    32   2.1  
AF048977-1|AAC09321.1|  820|Homo sapiens Ser/Arg-related nuclear...    32   2.1  
X76302-1|CAA53949.1|  163|Homo sapiens nucleic acid binding prot...    32   2.7  
X17544-1|CAA35582.1|  286|Homo sapiens protein ( Human adrenal s...    32   2.7  
M31661-1|AAA60174.1|  622|Homo sapiens prolactin receptor protein.     32   2.7  
BC059392-1|AAH59392.1|  622|Homo sapiens prolactin receptor prot...    32   2.7  
BC017890-1|AAH17890.1|  155|Homo sapiens putative nucleic acid b...    32   2.7  
AJ406937-1|CAC27576.1|  186|Homo sapiens keratin associated prot...    32   2.7  
AJ242976-1|CAB45133.1|  380|Homo sapiens p241 protein protein.         32   2.7  
AF349939-1|AAK32703.1|  521|Homo sapiens prolactin receptor isof...    32   2.7  
AF091870-1|AAD32032.1|  622|Homo sapiens prolactin receptor prot...    32   2.7  
AC019206-3|AAY14866.1|  155|Homo sapiens unknown protein.              32   2.7  
M94132-1|AAA59164.1|  984|Homo sapiens MUC2 protein.                   31   3.6  
M22405-1|AAA36334.1|  278|Homo sapiens protein ( Human intestina...    31   3.6  
BC146794-1|AAI46795.1| 1919|Homo sapiens discs, large homolog 5 ...    31   3.6  
BC098394-1|AAH98394.1| 1327|Homo sapiens tankyrase, TRF1-interac...    31   3.6  
BC073996-1|AAH73996.1|  845|Homo sapiens DLG5 protein protein.         31   3.6  
AL450306-3|CAI17324.2| 1919|Homo sapiens discs, large homolog 5 ...    31   3.6  
AL450306-2|CAI17323.1|  880|Homo sapiens discs, large homolog 5 ...    31   3.6  
AL391421-2|CAI12104.2| 1919|Homo sapiens discs, large homolog 5 ...    31   3.6  
AL391421-1|CAI12103.1|  880|Homo sapiens discs, large homolog 5 ...    31   3.6  
AJ406945-1|CAC27584.1|  193|Homo sapiens keratin associated prot...    31   3.6  
AF352034-1|AAL83938.1| 1809|Homo sapiens DLG5 protein.                 31   3.6  
AF352033-1|AAL83937.1| 1809|Homo sapiens DLG5 protein.                 31   3.6  
AF257166-1|AAG18515.1|  147|Homo sapiens intestinal mucin 2 prot...    31   3.6  
AF082556-1|AAC79841.1| 1327|Homo sapiens TRF1-interacting ankyri...    31   3.6  
AB091676-1|BAC65420.1| 1764|Homo sapiens discs large protein lp-...    31   3.6  
AB011155-1|BAA25509.2| 1952|Homo sapiens KIAA0583 protein protein.     31   3.6  
S77905-1|AAB34217.2|  321|Homo sapiens paired box protein 8 isof...    31   4.7  
S77904-1|AAB34216.1|  398|Homo sapiens PAX8 protein.                   31   4.7  
M57417-1|AAA63229.2|  294|Homo sapiens mucin protein.                  31   4.7  
BC139779-1|AAI39780.1|  606|Homo sapiens zinc finger protein 652...    31   4.7  
BC074982-1|AAH74982.1|  159|Homo sapiens keratin associated prot...    31   4.7  
BC074981-1|AAH74981.1|  159|Homo sapiens keratin associated prot...    31   4.7  
BC074919-1|AAH74919.1|  159|Homo sapiens keratin associated prot...    31   4.7  
BC074918-1|AAH74918.1|  159|Homo sapiens keratin associated prot...    31   4.7  
AY280968-1|AAQ18786.1| 1283|Homo sapiens Rab11-family interactin...    31   4.7  
AJ406950-1|CAC27589.1|  159|Homo sapiens keratin associated prot...    31   4.7  
AJ406947-1|CAC27586.1|  159|Homo sapiens keratin associated prot...    31   4.7  
AB023141-1|BAA76768.2|  617|Homo sapiens KIAA0924 protein protein.     31   4.7  
Y16787-1|CAA76383.1|  416|Homo sapiens type I hair keratin 1 pro...    31   6.3  
X86570-1|CAA60378.1|  416|Homo sapiens type I keratin protein.         31   6.3  
S75797-1|AAB32812.1|   85|Homo sapiens type I hair keratin protein.    31   6.3  
BC127252-1|AAI27253.1|  136|Homo sapiens keratin associated prot...    31   6.3  
BC120938-1|AAI20939.1|   72|Homo sapiens small proline-rich prot...    31   6.3  
BC114468-1|AAI14469.1|  416|Homo sapiens keratin 31 protein.           31   6.3  
BC052959-1|AAH52959.1|  559|Homo sapiens FIP1L1 protein protein.       31   6.3  
AL356867-7|CAI19806.1|   72|Homo sapiens small proline-rich prot...    31   6.3  
AL157405-2|CAI19766.1|   73|Homo sapiens small proline-rich prot...    31   6.3  
AJ406934-1|CAC27573.1|  136|Homo sapiens keratin associated prot...    31   6.3  
AF333957-1|AAK70944.1|   73|Homo sapiens small proline-rich prot...    31   6.3  
AF333954-1|AAK70941.1|   72|Homo sapiens small proline-rich prot...    31   6.3  
AB048287-1|BAB40642.1|   73|Homo sapiens small proline rich prot...    31   6.3  
M22404-1|AAA36333.1|  167|Homo sapiens protein ( Human intestina...    30   8.3  
BC070050-1|AAH70050.1| 1022|Homo sapiens SRRM2 protein protein.        30   8.3  
BC056886-1|AAH56886.1|  392|Homo sapiens LUC7-like 2 (S. cerevis...    30   8.3  
BC050708-1|AAH50708.1|  392|Homo sapiens LUC7-like 2 (S. cerevis...    30   8.3  
BC042625-1|AAH42625.1|  391|Homo sapiens LUC7L2 protein protein.       30   8.3  
BC017163-1|AAH17163.1|  392|Homo sapiens LUC7-like 2 (S. cerevis...    30   8.3  
AK128338-1|BAC87390.1|  909|Homo sapiens protein ( Homo sapiens ...    30   8.3  
AK022895-1|BAB14297.1|  392|Homo sapiens protein ( Homo sapiens ...    30   8.3  
AK001519-1|BAA91737.1|  392|Homo sapiens protein ( Homo sapiens ...    30   8.3  
AK001476-1|BAA91713.1|  392|Homo sapiens protein ( Homo sapiens ...    30   8.3  
AF201422-1|AAF21439.1| 2296|Homo sapiens splicing coactivator su...    30   8.3  
AF151832-1|AAD34069.1|  402|Homo sapiens CGI-74 protein protein.       30   8.3  
AF151817-1|AAD34054.1|  383|Homo sapiens CGI-59 protein protein.       30   8.3  
AB081753-1|BAC16513.1|  985|Homo sapiens RIN3 protein.                 30   8.3  
AB016092-1|BAA83718.1| 2752|Homo sapiens RNA binding protein pro...    30   8.3  
AB016088-1|BAA83714.1|  956|Homo sapiens RNA binding protein pro...    30   8.3  
AB016087-1|BAA83713.1| 1262|Homo sapiens RNA binding protein pro...    30   8.3  
AB002322-1|BAA20782.3| 2800|Homo sapiens KIAA0324 protein protein.     30   8.3  

>X04098-1|CAA27723.1|  375|Homo sapiens gamma-actin protein.
          Length = 375

 Score =  489 bits (1207), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>M19283-1|AAA51579.1|  375|Homo sapiens ACTG1 protein.
          Length = 375

 Score =  489 bits (1207), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>BT019856-1|AAV38659.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  489 bits (1207), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>BC053572-1|AAH53572.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  489 bits (1207), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>BC018774-1|AAH18774.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  489 bits (1207), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>BC015779-1|AAH15779.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  489 bits (1207), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>BC015695-1|AAH15695.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  489 bits (1207), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>BC015005-1|AAH15005.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  489 bits (1207), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>BC012050-1|AAH12050.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  489 bits (1207), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>BC010999-1|AAH10999.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  489 bits (1207), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>BC009848-1|AAH09848.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  489 bits (1207), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>BC007442-1|AAH07442.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  489 bits (1207), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>BC001920-1|AAH01920.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  489 bits (1207), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>BC000292-1|AAH00292.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  489 bits (1207), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>X00351-1|CAA25099.1|  375|Homo sapiens protein ( Human mRNA for
           beta-actin. ).
          Length = 375

 Score =  489 bits (1206), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>M10277-1|AAA51567.1|  375|Homo sapiens protein ( Human cytoplasmic
           beta-actin gene, complete cds. ).
          Length = 375

 Score =  489 bits (1206), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>DQ471327-1|ABF01018.1|  375|Homo sapiens PS1TP5-binding protein 1
           protein.
          Length = 375

 Score =  489 bits (1206), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>BC014861-1|AAH14861.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  489 bits (1206), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>BC013380-1|AAH13380.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  489 bits (1206), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>BC004251-1|AAH04251.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  489 bits (1206), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>BC002409-1|AAH02409.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  489 bits (1206), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>BC001301-1|AAH01301.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  489 bits (1206), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>AY582799-1|AAS79319.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  489 bits (1206), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>AK223055-1|BAD96775.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  489 bits (1206), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>AK223032-1|BAD96752.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  489 bits (1206), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>AK222925-1|BAD96645.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  489 bits (1206), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>AC006483-1|AAP22343.1|  375|Homo sapiens unknown protein.
          Length = 375

 Score =  489 bits (1206), Expect = e-138
 Identities = 230/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>X63432-1|CAA45026.1|  375|Homo sapiens mutant beta-actin
           (beta'-actin) protein.
          Length = 375

 Score =  488 bits (1203), Expect = e-137
 Identities = 229/235 (97%), Positives = 235/235 (100%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQA+LSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAMLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>BC016045-1|AAH16045.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  487 bits (1201), Expect = e-137
 Identities = 229/235 (97%), Positives = 234/235 (99%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRV PEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVPPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 236


>BC008633-1|AAH08633.1|  368|Homo sapiens actin, beta protein.
          Length = 368

 Score =  481 bits (1185), Expect = e-135
 Identities = 227/229 (99%), Positives = 229/229 (100%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL
Sbjct: 1   LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 60

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 459
           KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF
Sbjct: 61  KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 120

Query: 460 NTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD 639
           NTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTD
Sbjct: 121 NTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTD 180

Query: 640 YLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           YLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 181 YLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 229


>X16940-1|CAA34814.1|  376|Homo sapiens protein ( Human mRNA for
           enteric smooth muscle gamma-actin. ).
          Length = 376

 Score =  478 bits (1178), Expect = e-134
 Identities = 223/237 (94%), Positives = 229/237 (96%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD
Sbjct: 121 TQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSL 237


>D00654-1|BAA00546.1|  376|Homo sapiens enteric smooth muscle
           gamma-actin protein.
          Length = 376

 Score =  478 bits (1178), Expect = e-134
 Identities = 223/237 (94%), Positives = 229/237 (96%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD
Sbjct: 121 TQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSL 237


>CR541794-1|CAG46593.1|  376|Homo sapiens ACTG2 protein.
          Length = 376

 Score =  478 bits (1178), Expect = e-134
 Identities = 223/237 (94%), Positives = 229/237 (96%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD
Sbjct: 121 TQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSL 237


>BC094877-1|AAH94877.1|  376|Homo sapiens ACTG2 protein protein.
          Length = 376

 Score =  478 bits (1178), Expect = e-134
 Identities = 223/237 (94%), Positives = 229/237 (96%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD
Sbjct: 121 TQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSL 237


>BC012617-1|AAH12617.1|  376|Homo sapiens actin, gamma 2, smooth
           muscle, enteric protein.
          Length = 376

 Score =  478 bits (1178), Expect = e-134
 Identities = 223/237 (94%), Positives = 229/237 (96%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD
Sbjct: 121 TQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSL 237


>AC073046-2|AAX88909.1|  376|Homo sapiens unknown protein.
          Length = 376

 Score =  478 bits (1178), Expect = e-134
 Identities = 223/237 (94%), Positives = 229/237 (96%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD
Sbjct: 121 TQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSL 237


>CR536515-1|CAG38753.1|  376|Homo sapiens ACTG2 protein.
          Length = 376

 Score =  477 bits (1176), Expect = e-134
 Identities = 223/237 (94%), Positives = 229/237 (96%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLD
Sbjct: 121 TQIMFETFNFPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMATAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSL 237


>X13839-1|CAA32064.1|  377|Homo sapiens protein ( Human mRNA for
           vascular smooth muscle alpha-actin. ).
          Length = 377

 Score =  473 bits (1165), Expect = e-133
 Identities = 223/238 (93%), Positives = 230/238 (96%), Gaps = 1/238 (0%)
 Frame = +1

Query: 76  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           QSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREK
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
           MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RL
Sbjct: 121 MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL 180

Query: 613 DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           DLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMATAASSSSL
Sbjct: 181 DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSL 238


>M20543-1|AAA60296.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  473 bits (1165), Expect = e-133
 Identities = 224/238 (94%), Positives = 228/238 (95%), Gaps = 1/238 (0%)
 Frame = +1

Query: 76  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           QSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREK
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
           MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RL
Sbjct: 121 MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL 180

Query: 613 DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           DLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMATAASSSSL
Sbjct: 181 DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSL 238


>J00073-1|AAB59619.1|  377|Homo sapiens alpha-cardiac actin protein.
          Length = 377

 Score =  473 bits (1165), Expect = e-133
 Identities = 224/238 (94%), Positives = 228/238 (95%), Gaps = 1/238 (0%)
 Frame = +1

Query: 76  MCD-EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           MCD EE  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           QSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREK
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
           MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RL
Sbjct: 121 MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL 180

Query: 613 DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           DLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMATAASSSSL
Sbjct: 181 DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSL 238


>J00068-1|AAB59376.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  473 bits (1165), Expect = e-133
 Identities = 224/238 (94%), Positives = 228/238 (95%), Gaps = 1/238 (0%)
 Frame = +1

Query: 76  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           QSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREK
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
           MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RL
Sbjct: 121 MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL 180

Query: 613 DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           DLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMATAASSSSL
Sbjct: 181 DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSL 238


>CR541796-1|CAG46595.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  473 bits (1165), Expect = e-133
 Identities = 224/238 (94%), Positives = 228/238 (95%), Gaps = 1/238 (0%)
 Frame = +1

Query: 76  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           QSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREK
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
           MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RL
Sbjct: 121 MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL 180

Query: 613 DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           DLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMATAASSSSL
Sbjct: 181 DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSL 238


>CR541795-1|CAG46594.1|  377|Homo sapiens ACTC protein.
          Length = 377

 Score =  473 bits (1165), Expect = e-133
 Identities = 224/238 (94%), Positives = 228/238 (95%), Gaps = 1/238 (0%)
 Frame = +1

Query: 76  MCD-EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           MCD EE  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           QSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREK
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
           MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RL
Sbjct: 121 MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL 180

Query: 613 DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           DLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMATAASSSSL
Sbjct: 181 DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSL 238


>CR536518-1|CAG38756.1|  377|Homo sapiens ACTA2 protein.
          Length = 377

 Score =  473 bits (1165), Expect = e-133
 Identities = 223/238 (93%), Positives = 230/238 (96%), Gaps = 1/238 (0%)
 Frame = +1

Query: 76  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           QSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREK
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
           MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RL
Sbjct: 121 MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL 180

Query: 613 DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           DLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMATAASSSSL
Sbjct: 181 DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSL 238


>CR536516-1|CAG38754.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  473 bits (1165), Expect = e-133
 Identities = 224/238 (94%), Positives = 228/238 (95%), Gaps = 1/238 (0%)
 Frame = +1

Query: 76  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           QSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREK
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
           MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RL
Sbjct: 121 MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL 180

Query: 613 DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           DLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMATAASSSSL
Sbjct: 181 DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSL 238


>BC093052-1|AAH93052.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  473 bits (1165), Expect = e-133
 Identities = 223/238 (93%), Positives = 230/238 (96%), Gaps = 1/238 (0%)
 Frame = +1

Query: 76  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           QSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREK
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
           MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RL
Sbjct: 121 MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL 180

Query: 613 DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           DLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMATAASSSSL
Sbjct: 181 DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSL 238


>BC017554-1|AAH17554.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  473 bits (1165), Expect = e-133
 Identities = 223/238 (93%), Positives = 230/238 (96%), Gaps = 1/238 (0%)
 Frame = +1

Query: 76  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           QSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREK
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
           MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RL
Sbjct: 121 MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL 180

Query: 613 DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           DLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMATAASSSSL
Sbjct: 181 DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSL 238


>BC012597-1|AAH12597.1|  377|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 377

 Score =  473 bits (1165), Expect = e-133
 Identities = 224/238 (94%), Positives = 228/238 (95%), Gaps = 1/238 (0%)
 Frame = +1

Query: 76  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           QSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREK
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
           MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RL
Sbjct: 121 MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL 180

Query: 613 DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           DLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMATAASSSSL
Sbjct: 181 DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSL 238


>BC009978-1|AAH09978.1|  377|Homo sapiens actin, alpha, cardiac
           muscle 1 protein.
          Length = 377

 Score =  473 bits (1165), Expect = e-133
 Identities = 224/238 (94%), Positives = 228/238 (95%), Gaps = 1/238 (0%)
 Frame = +1

Query: 76  MCD-EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           MCD EE  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           QSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREK
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
           MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RL
Sbjct: 121 MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL 180

Query: 613 DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           DLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMATAASSSSL
Sbjct: 181 DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSL 238


>AY692464-1|AAW29811.1|  377|Homo sapiens growth-inhibiting gene 46
           protein.
          Length = 377

 Score =  473 bits (1165), Expect = e-133
 Identities = 223/238 (93%), Positives = 230/238 (96%), Gaps = 1/238 (0%)
 Frame = +1

Query: 76  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           QSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREK
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
           MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RL
Sbjct: 121 MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL 180

Query: 613 DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           DLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMATAASSSSL
Sbjct: 181 DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSL 238


>AL160004-6|CAI19050.1|  377|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 377

 Score =  473 bits (1165), Expect = e-133
 Identities = 224/238 (94%), Positives = 228/238 (95%), Gaps = 1/238 (0%)
 Frame = +1

Query: 76  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           QSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREK
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
           MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RL
Sbjct: 121 MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL 180

Query: 613 DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           DLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMATAASSSSL
Sbjct: 181 DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSL 238


>AL157394-6|CAI13864.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  473 bits (1165), Expect = e-133
 Identities = 223/238 (93%), Positives = 230/238 (96%), Gaps = 1/238 (0%)
 Frame = +1

Query: 76  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           QSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREK
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
           MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RL
Sbjct: 121 MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL 180

Query: 613 DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           DLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMATAASSSSL
Sbjct: 181 DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSL 238


>AF182035-1|AAF02694.1|  377|Homo sapiens skeletal muscle
           alpha-actin precursor protein.
          Length = 377

 Score =  473 bits (1165), Expect = e-133
 Identities = 224/238 (94%), Positives = 228/238 (95%), Gaps = 1/238 (0%)
 Frame = +1

Query: 76  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           QSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREK
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
           MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RL
Sbjct: 121 MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL 180

Query: 613 DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           DLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMATAASSSSL
Sbjct: 181 DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSL 238


>J05192-1|AAA51577.1|  377|Homo sapiens ACTA3 protein.
          Length = 377

 Score =  470 bits (1158), Expect = e-132
 Identities = 222/238 (93%), Positives = 229/238 (96%), Gaps = 1/238 (0%)
 Frame = +1

Query: 76  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           QSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREK
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
           MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RL
Sbjct: 121 MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL 180

Query: 613 DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           DLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMATAA SSSL
Sbjct: 181 DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAAWSSSL 238


>K01747-1|AAA51586.1|  330|Homo sapiens ACTA2 protein.
          Length = 330

 Score =  467 bits (1151), Expect = e-131
 Identities = 221/238 (92%), Positives = 228/238 (95%), Gaps = 1/238 (0%)
 Frame = +1

Query: 76  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG EA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGHEA 60

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           QSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREK
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
           MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RL
Sbjct: 121 MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL 180

Query: 613 DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           DLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMATAA SSSL
Sbjct: 181 DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAAWSSSL 238


>BC012854-1|AAH12854.1|  360|Homo sapiens ACTB protein protein.
          Length = 360

 Score =  462 bits (1138), Expect = e-130
 Identities = 218/221 (98%), Positives = 220/221 (99%)
 Frame = +1

Query: 124 MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI 303
           MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI 60

Query: 304 VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVA 483
           VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN EKMTQIMFETFNTPAMYVA
Sbjct: 61  VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANLEKMTQIMFETFNTPAMYVA 120

Query: 484 IQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 663
           IQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE
Sbjct: 121 IQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 180

Query: 664 RGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           RGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 181 RGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 221


>BC017450-1|AAH17450.1|  363|Homo sapiens Unknown (protein for
           IMAGE:3538275) protein.
          Length = 363

 Score =  459 bits (1131), Expect = e-129
 Identities = 217/219 (99%), Positives = 219/219 (100%)
 Frame = +1

Query: 130 KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVT 309
           KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVT
Sbjct: 6   KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVT 65

Query: 310 NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQ 489
           NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQ
Sbjct: 66  NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQ 125

Query: 490 AVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 669
           AVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 126 AVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 185

Query: 670 YSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           YSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 186 YSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 224


>EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin protein.
          Length = 1075

 Score =  448 bits (1105), Expect = e-126
 Identities = 211/235 (89%), Positives = 221/235 (94%)
 Frame = +1

Query: 82   DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
            D++ A LV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPR QG+M GM QK+SYVG EAQSK
Sbjct: 702  DDDTAVLVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRQQGMMGGMHQKESYVGKEAQSK 761

Query: 262  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
            RGILTLKYP+EHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPKANREKMTQ
Sbjct: 762  RGILTLKYPMEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEATLNPKANREKMTQ 821

Query: 442  IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
            IMFETFNTPAMYVAIQAVLSLY SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLDLA
Sbjct: 822  IMFETFNTPAMYVAIQAVLSLYTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLA 881

Query: 622  GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
            GR+L DYLMKILTE GY FTT AEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 882  GRELPDYLMKILTEHGYRFTTMAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 936


>AY280960-1|AAP37280.1|  254|Homo sapiens actin alpha 1 skeletal
           muscle protein protein.
          Length = 254

 Score =  325 bits (798), Expect = 1e-88
 Identities = 152/161 (94%), Positives = 154/161 (95%), Gaps = 1/161 (0%)
 Frame = +1

Query: 76  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           QSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREK
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGV 555
           MTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV
Sbjct: 121 MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGV 161


>AL157394-7|CAI13865.1|  151|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 151

 Score =  305 bits (748), Expect = 1e-82
 Identities = 141/151 (93%), Positives = 146/151 (96%), Gaps = 1/151 (0%)
 Frame = +1

Query: 76  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           QSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREK
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK 120

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYASGRTT 525
           MTQIMFETFN PAMYVAIQAVLSLYASGRTT
Sbjct: 121 MTQIMFETFNVPAMYVAIQAVLSLYASGRTT 151


>X82207-1|CAA57691.1|  376|Homo sapiens beta-centracetin protein.
          Length = 376

 Score =  291 bits (714), Expect = 2e-78
 Identities = 124/222 (55%), Positives = 178/222 (80%), Gaps = 1/222 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  RG+LT+
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTI 71

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           +YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP  NREK  ++ FET
Sbjct: 72  RYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFFET 131

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           FN PA+++++QAVLSLYA+GRTTG+VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD++
Sbjct: 132 FNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVS 191

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
            YL  +L + G  F T+AE E+VR IKE+ CY++++ +++ A
Sbjct: 192 RYLRLLLRKEGVDFHTSAEFEVVRTIKERACYLSINPQKDEA 233


>BC010090-1|AAH10090.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score =  291 bits (714), Expect = 2e-78
 Identities = 124/222 (55%), Positives = 178/222 (80%), Gaps = 1/222 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  RG+LT+
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTI 71

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           +YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP  NREK  ++ FET
Sbjct: 72  RYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFFET 131

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           FN PA+++++QAVLSLYA+GRTTG+VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD++
Sbjct: 132 FNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVS 191

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
            YL  +L + G  F T+AE E+VR IKE+ CY++++ +++ A
Sbjct: 192 RYLRLLLRKEGVDFHTSAEFEVVRTIKERACYLSINPQKDEA 233


>BC006372-1|AAH06372.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score =  291 bits (714), Expect = 2e-78
 Identities = 124/222 (55%), Positives = 178/222 (80%), Gaps = 1/222 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  RG+LT+
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTI 71

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           +YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP  NREK  ++ FET
Sbjct: 72  RYPMEHGVVRDWNDMERIWQYAYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFFET 131

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           FN PA+++++QAVLSLYA+GRTTG+VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD++
Sbjct: 132 FNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVS 191

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
            YL  +L + G  F T+AE E+VR IKE+ CY++++ +++ A
Sbjct: 192 RYLRLLLRKEGVDFHTSAEFEVVRTIKERACYLSINPQKDEA 233


>BC004374-1|AAH04374.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score =  291 bits (714), Expect = 2e-78
 Identities = 124/222 (55%), Positives = 178/222 (80%), Gaps = 1/222 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  RG+LT+
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTI 71

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           +YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP  NREK  ++ FET
Sbjct: 72  RYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFFET 131

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           FN PA+++++QAVLSLYA+GRTTG+VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD++
Sbjct: 132 FNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVS 191

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
            YL  +L + G  F T+AE E+VR IKE+ CY++++ +++ A
Sbjct: 192 RYLRLLLRKEGVDFHTSAEFEVVRTIKERACYLSINPQKDEA 233


>AC017099-2|AAY24280.1|  376|Homo sapiens unknown protein.
          Length = 376

 Score =  291 bits (714), Expect = 2e-78
 Identities = 124/222 (55%), Positives = 178/222 (80%), Gaps = 1/222 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  RG+LT+
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTI 71

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           +YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP  NREK  ++ FET
Sbjct: 72  RYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFFET 131

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           FN PA+++++QAVLSLYA+GRTTG+VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD++
Sbjct: 132 FNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVS 191

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
            YL  +L + G  F T+AE E+VR IKE+ CY++++ +++ A
Sbjct: 192 RYLRLLLRKEGVDFHTSAEFEVVRTIKERACYLSINPQKDEA 233


>Z14978-1|CAA78701.1|  376|Homo sapiens actin-related protein
           protein.
          Length = 376

 Score =  285 bits (698), Expect = 2e-76
 Identities = 120/220 (54%), Positives = 178/220 (80%), Gaps = 1/220 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  RG+L++
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           +YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+ NRE+  ++ FET
Sbjct: 72  RYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFET 131

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           FN PA+++++QAVLSLYA+GRTTG+VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD++
Sbjct: 132 FNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVS 191

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQE 756
            +L   L + GY F +++E EIV+ IKE+ CY++++ +++
Sbjct: 192 RFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKD 231


>X82206-1|CAA57690.1|  376|Homo sapiens alpha-centractin protein.
          Length = 376

 Score =  285 bits (698), Expect = 2e-76
 Identities = 120/220 (54%), Positives = 178/220 (80%), Gaps = 1/220 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  RG+L++
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           +YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+ NRE+  ++ FET
Sbjct: 72  RYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFET 131

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           FN PA+++++QAVLSLYA+GRTTG+VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD++
Sbjct: 132 FNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVS 191

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQE 756
            +L   L + GY F +++E EIV+ IKE+ CY++++ +++
Sbjct: 192 RFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKD 231


>BC026016-1|AAH26016.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score =  285 bits (698), Expect = 2e-76
 Identities = 120/220 (54%), Positives = 178/220 (80%), Gaps = 1/220 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  RG+L++
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           +YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+ NRE+  ++ FET
Sbjct: 72  RYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFET 131

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           FN PA+++++QAVLSLYA+GRTTG+VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD++
Sbjct: 132 FNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVS 191

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQE 756
            +L   L + GY F +++E EIV+ IKE+ CY++++ +++
Sbjct: 192 RFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKD 231


>BC000693-1|AAH00693.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score =  285 bits (698), Expect = 2e-76
 Identities = 120/220 (54%), Positives = 178/220 (80%), Gaps = 1/220 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  RG+L++
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           +YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+ NRE+  ++ FET
Sbjct: 72  RYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFET 131

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           FN PA+++++QAVLSLYA+GRTTG+VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD++
Sbjct: 132 FNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVS 191

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQE 756
            +L   L + GY F +++E EIV+ IKE+ CY++++ +++
Sbjct: 192 RFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKD 231


>AL121928-12|CAC08404.1|  376|Homo sapiens ARP1 actin-related
           protein 1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score =  285 bits (698), Expect = 2e-76
 Identities = 120/220 (54%), Positives = 178/220 (80%), Gaps = 1/220 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  RG+L++
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           +YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+ NRE+  ++ FET
Sbjct: 72  RYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFET 131

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           FN PA+++++QAVLSLYA+GRTTG+VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD++
Sbjct: 132 FNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVS 191

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQE 756
            +L   L + GY F +++E EIV+ IKE+ CY++++ +++
Sbjct: 192 RFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKD 231


>EF095209-1|ABL01513.1|  121|Homo sapiens beta-actin protein.
          Length = 121

 Score =  268 bits (656), Expect = 2e-71
 Identities = 121/121 (100%), Positives = 121/121 (100%)
 Frame = +1

Query: 109 DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYP 288
           DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYP
Sbjct: 1   DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYP 60

Query: 289 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 468
           IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP
Sbjct: 61  IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 120

Query: 469 A 471
           A
Sbjct: 121 A 121


>X82208-1|CAA57692.1|  329|Homo sapiens beta-centractin protein.
          Length = 329

 Score =  262 bits (642), Expect = 1e-69
 Identities = 111/203 (54%), Positives = 162/203 (79%), Gaps = 1/203 (0%)
 Frame = +1

Query: 157 PRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIW 336
           P+  FP+ VGRP+H  VM G  + D ++G +A+  RG+LT++YP+EHG+V +W+DME+IW
Sbjct: 1   PKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTIRYPMEHGVVRDWNDMERIW 60

Query: 337 HHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYAS 513
            + +  ++L+   EEHPVLLTEAPLNP  NREK  ++ FETFN PA+++++QAVLSLYA+
Sbjct: 61  QYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFFETFNVPALFISMQAVLSLYAT 120

Query: 514 GRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE 693
           GRTTG+VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD++ YL  +L + G  F T+AE
Sbjct: 121 GRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYLRLLLRKEGVDFHTSAE 180

Query: 694 REIVRDIKEKLCYVALDFEQEMA 762
            E+VR IKE+ CY++++ +++ A
Sbjct: 181 FEVVRTIKERACYLSINPQKDEA 203


>BC023548-1|AAH23548.1|  263|Homo sapiens ACTG1 protein protein.
          Length = 263

 Score =  251 bits (615), Expect = 2e-66
 Identities = 122/124 (98%), Positives = 124/124 (100%)
 Frame = +1

Query: 415 KANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 594
           KANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALP
Sbjct: 1   KANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 60

Query: 595 HAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAS 774
           HAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAS
Sbjct: 61  HAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAS 120

Query: 775 SSSL 786
           SSSL
Sbjct: 121 SSSL 124


>AF006082-1|AAB64187.1|  394|Homo sapiens Arp2 protein.
          Length = 394

 Score =  250 bits (611), Expect = 6e-66
 Identities = 119/232 (51%), Positives = 160/232 (68%), Gaps = 3/232 (1%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           +V DNG+G  K G+AG + P  +FP++VGRP  R    +  +  KD  VGDEA   R +L
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASELRSML 68

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMF 450
            + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP  NREK+ ++MF
Sbjct: 69  EVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVEVMF 128

Query: 451 ETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRD 630
           ET+    +YVAIQAVL+LYA G  TG+V+DSGDGV+H  P+YEG++LPH   RLD+AGRD
Sbjct: 129 ETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRD 188

Query: 631 LTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           +T YL+K+L  RGY+F  +A+ E VR IKEKLCYV  + EQE   A  ++ L
Sbjct: 189 ITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVL 240


>BC014546-1|AAH14546.1|  394|Homo sapiens ARP2 actin-related protein
           2 homolog (yeast) protein.
          Length = 394

 Score =  246 bits (603), Expect = 5e-65
 Identities = 118/232 (50%), Positives = 158/232 (68%), Gaps = 3/232 (1%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           +V DNG+G  K G+AG + P  +FP++VGRP  R    +  +  KD  VGDEA   R  L
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASELRSTL 68

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMF 450
            + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP  NREK+ ++MF
Sbjct: 69  EVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVEVMF 128

Query: 451 ETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRD 630
           ET+    +YVAIQAVL+LYA G  TG+V+DSGDGV+H  P+YE ++LPH   RLD+AGRD
Sbjct: 129 ETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYESFSLPHLTRRLDIAGRD 188

Query: 631 LTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           +T YL+K+L  RGY+F  +A+ E VR IKEKLCYV  + EQE   A  ++ L
Sbjct: 189 ITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVL 240


>Z74696-1|CAI42428.1|  376|Homo sapiens actin-related protein T1
           (ACTRT1) protein.
          Length = 376

 Score =  245 bits (600), Expect = 1e-64
 Identities = 112/224 (50%), Positives = 158/224 (70%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 267
           +V A++ DNGSG+CKAG +G+  PR V  S++G  +    +  + QK  +VG EA  K  
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK-YFVGQEALYKYE 66

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
            L L YPIE G+VT WDDMEK+W H F  EL V P + PVL+TE  LNP+  REK+ ++M
Sbjct: 67  ALHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREKLAEMM 126

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGR 627
           FETF+ P  Y++  AV +LYAS   TG+V+DSGDGV+ TVPI+EGY+LPHA+ +L +AGR
Sbjct: 127 FETFSVPGFYLSNHAVAALYASACVTGLVVDSGDGVTCTVPIFEGYSLPHAVTKLCMAGR 186

Query: 628 DLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           D+T++L ++L   G++F     + +V +IKEKLCY+AL+ E+E+
Sbjct: 187 DITEHLTRLLFASGFNFPCILNKAVVNNIKEKLCYIALEPEKEL 230


>BC014597-1|AAH14597.1|  376|Homo sapiens actin-related protein T1
           protein.
          Length = 376

 Score =  245 bits (600), Expect = 1e-64
 Identities = 112/224 (50%), Positives = 158/224 (70%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 267
           +V A++ DNGSG+CKAG +G+  PR V  S++G  +    +  + QK  +VG EA  K  
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK-YFVGQEALYKYE 66

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
            L L YPIE G+VT WDDMEK+W H F  EL V P + PVL+TE  LNP+  REK+ ++M
Sbjct: 67  ALHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREKLAEMM 126

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGR 627
           FETF+ P  Y++  AV +LYAS   TG+V+DSGDGV+ TVPI+EGY+LPHA+ +L +AGR
Sbjct: 127 FETFSVPGFYLSNHAVAALYASACVTGLVVDSGDGVTCTVPIFEGYSLPHAVTKLCMAGR 186

Query: 628 DLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           D+T++L ++L   G++F     + +V +IKEKLCY+AL+ E+E+
Sbjct: 187 DITEHLTRLLFASGFNFPCILNKAVVNNIKEKLCYIALEPEKEL 230


>AL356984-1|CAH72587.1|  377|Homo sapiens actin-related protein M2
           (ARPM2) protein.
          Length = 377

 Score =  245 bits (600), Expect = 1e-64
 Identities = 112/222 (50%), Positives = 156/222 (70%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT 276
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+EA  K+  L 
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYKQEALQ 70

Query: 277 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+ NREKM ++MFE 
Sbjct: 71  LHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVMFEN 130

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           F  PA Y++ QAVL+LYAS   TG+V+DSGD V+ TVPI+EGY+LPHA+ +L +AGRD+T
Sbjct: 131 FGVPAFYLSDQAVLALYASACVTGLVVDSGDAVTCTVPIFEGYSLPHAVTKLHVAGRDIT 190

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
           + LM++L   G++F    ++ +V DIK+KLCYVAL+ E+E++
Sbjct: 191 ELLMQLLLASGHTFPCQLDKGLVDDIKKKLCYVALEPEKELS 232


>AK058153-1|BAB71690.1|  328|Homo sapiens protein ( Homo sapiens
           cDNA FLJ25424 fis, clone TST04169. ).
          Length = 328

 Score =  245 bits (600), Expect = 1e-64
 Identities = 112/222 (50%), Positives = 156/222 (70%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT 276
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+EA  K+  L 
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYKQEALQ 70

Query: 277 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+ NREKM ++MFE 
Sbjct: 71  LHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVMFEN 130

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           F  PA Y++ QAVL+LYAS   TG+V+DSGD V+ TVPI+EGY+LPHA+ +L +AGRD+T
Sbjct: 131 FGVPAFYLSDQAVLALYASACVTGLVVDSGDAVTCTVPIFEGYSLPHAVTKLHVAGRDIT 190

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
           + LM++L   G++F    ++ +V DIK+KLCYVAL+ E+E++
Sbjct: 191 ELLMQLLLASGHTFPCQLDKGLVDDIKKKLCYVALEPEKELS 232


>AF440740-1|AAM00433.1|  377|Homo sapiens actin-related protein T2
           protein.
          Length = 377

 Score =  245 bits (600), Expect = 1e-64
 Identities = 112/222 (50%), Positives = 156/222 (70%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT 276
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+EA  K+  L 
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYKQEALQ 70

Query: 277 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+ NREKM ++MFE 
Sbjct: 71  LHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVMFEN 130

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           F  PA Y++ QAVL+LYAS   TG+V+DSGD V+ TVPI+EGY+LPHA+ +L +AGRD+T
Sbjct: 131 FGVPAFYLSDQAVLALYASACVTGLVVDSGDAVTCTVPIFEGYSLPHAVTKLHVAGRDIT 190

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
           + LM++L   G++F    ++ +V DIK+KLCYVAL+ E+E++
Sbjct: 191 ELLMQLLLASGHTFPCQLDKGLVDDIKKKLCYVALEPEKELS 232


>AF440739-1|AAM00432.1|  376|Homo sapiens actin-related protein T1
           protein.
          Length = 376

 Score =  245 bits (600), Expect = 1e-64
 Identities = 112/224 (50%), Positives = 158/224 (70%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 267
           +V A++ DNGSG+CKAG +G+  PR V  S++G  +    +  + QK  +VG EA  K  
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK-YFVGQEALYKYE 66

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
            L L YPIE G+VT WDDMEK+W H F  EL V P + PVL+TE  LNP+  REK+ ++M
Sbjct: 67  ALHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREKLAEMM 126

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGR 627
           FETF+ P  Y++  AV +LYAS   TG+V+DSGDGV+ TVPI+EGY+LPHA+ +L +AGR
Sbjct: 127 FETFSVPGFYLSNHAVAALYASACVTGLVVDSGDGVTCTVPIFEGYSLPHAVTKLCMAGR 186

Query: 628 DLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           D+T++L ++L   G++F     + +V +IKEKLCY+AL+ E+E+
Sbjct: 187 DITEHLTRLLFASGFNFPCILNKAVVNNIKEKLCYIALEPEKEL 230


>AL160004-5|CAI19052.1|  342|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 342

 Score =  244 bits (596), Expect = 4e-64
 Identities = 126/187 (67%), Positives = 141/187 (75%)
 Frame = +1

Query: 226 KDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAP 405
           K  + GD+A        +  P   G++      +        ++  +   ++P+   E  
Sbjct: 20  KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPI---EHG 76

Query: 406 LNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGY 585
           +  KANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGY
Sbjct: 77  IITKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGY 136

Query: 586 ALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMAT 765
           ALPHAI+RLDLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCYVALDFE EMAT
Sbjct: 137 ALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMAT 196

Query: 766 AASSSSL 786
           AASSSSL
Sbjct: 197 AASSSSL 203



 Score =  157 bits (380), Expect = 6e-38
 Identities = 77/94 (81%), Positives = 81/94 (86%), Gaps = 3/94 (3%)
 Frame = +1

Query: 76  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 253 QSKRGILTLKYPIEHGIVT--NWDDMEKIWHHTF 348
           QSKRGILTLKYPIEHGI+T  N + M +I   TF
Sbjct: 61  QSKRGILTLKYPIEHGIITKANREKMTQIMFETF 94


>AL160004-4|CAI19051.1|  287|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 287

 Score =  244 bits (596), Expect = 4e-64
 Identities = 112/124 (90%), Positives = 115/124 (92%), Gaps = 1/124 (0%)
 Frame = +1

Query: 76  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           QSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANRE 
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREI 120

Query: 433 MTQI 444
           +  I
Sbjct: 121 VRDI 124



 Score = 63.7 bits (148), Expect = 7e-10
 Identities = 31/33 (93%), Positives = 31/33 (93%)
 Frame = +1

Query: 688 AEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           A REIVRDIKEKLCYVALDFE EMATAASSSSL
Sbjct: 116 ANREIVRDIKEKLCYVALDFENEMATAASSSSL 148


>AB057364-1|BAB85862.1|  377|Homo sapiens actin-related protein
           hArpM2 protein.
          Length = 377

 Score =  243 bits (595), Expect = 5e-64
 Identities = 111/222 (50%), Positives = 155/222 (69%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT 276
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+EA  K+  L 
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYKQEALQ 70

Query: 277 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+ NREKM ++MFE 
Sbjct: 71  LHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVMFEN 130

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           F  PA Y++ QAVL+LYAS   TG+V+DSGD V+ TVPI+EGY+LPHA+ +L +AGRD+T
Sbjct: 131 FGVPAFYLSDQAVLALYASACVTGLVVDSGDAVTCTVPIFEGYSLPHAVTKLHVAGRDIT 190

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
           + LM++L   G++F    ++ +V DIK+KLCYV L+ E+E++
Sbjct: 191 ELLMQLLLASGHTFPCQLDKGLVDDIKKKLCYVPLEPEKELS 232


>AK055346-1|BAB70906.1|  372|Homo sapiens protein ( Homo sapiens
           cDNA FLJ30784 fis, clone FEBRA2000881, moderately
           similar to ACTIN 6. ).
          Length = 372

 Score =  242 bits (593), Expect = 9e-64
 Identities = 109/221 (49%), Positives = 159/221 (71%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VGD+AQ  R  L +
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVGDQAQDWRSSLFI 66

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 459
            YP+E G++T+W+DME +W H +   L++ P + PVL+TE  LNP ANR+++T++ FE  
Sbjct: 67  SYPVERGLITSWEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITEMFFEHL 126

Query: 460 NTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD 639
             PA Y++IQAVL+L+A+G TTG+VL+SG GV+ +VPI+EGY LPH + +LDLAG DLT+
Sbjct: 127 GVPAFYMSIQAVLALFAAGFTTGLVLNSGAGVTQSVPIFEGYCLPHGVQQLDLAGLDLTN 186

Query: 640 YLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
           YLM ++   G    + ++R+IV DIKE  CYVA+++E+EMA
Sbjct: 187 YLMVLMKNHGIMLLSASDRKIVEDIKESFCYVAMNYEEEMA 227


>AB049117-1|BAB39481.1|  372|Homo sapiens actin related protein
           protein.
          Length = 372

 Score =  242 bits (593), Expect = 9e-64
 Identities = 109/221 (49%), Positives = 159/221 (71%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VGD+AQ  R  L +
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVGDQAQDWRSSLFI 66

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 459
            YP+E G++T+W+DME +W H +   L++ P + PVL+TE  LNP ANR+++T++ FE  
Sbjct: 67  SYPVERGLITSWEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITEMFFEHL 126

Query: 460 NTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD 639
             PA Y++IQAVL+L+A+G TTG+VL+SG GV+ +VPI+EGY LPH + +LDLAG DLT+
Sbjct: 127 GVPAFYMSIQAVLALFAAGFTTGLVLNSGAGVTQSVPIFEGYCLPHGVQQLDLAGLDLTN 186

Query: 640 YLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
           YLM ++   G    + ++R+IV DIKE  CYVA+++E+EMA
Sbjct: 187 YLMVLMKNHGIMLLSASDRKIVEDIKESFCYVAMNYEEEMA 227


>BC029499-1|AAH29499.1|  376|Homo sapiens actin-related protein T2
           protein.
          Length = 376

 Score =  241 bits (590), Expect = 2e-63
 Identities = 112/222 (50%), Positives = 156/222 (70%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT 276
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+EA  K+  L 
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQK-YFVGEEALYKQEALQ 69

Query: 277 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+ NREKM ++MFE 
Sbjct: 70  LHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVMFEN 129

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           F  PA Y++ QAVL+LYAS   TG+V+DSGD V+ TVPI+EGY+LPHA+ +L +AGRD+T
Sbjct: 130 FGVPAFYLSDQAVLALYASACVTGLVVDSGDAVTCTVPIFEGYSLPHAVTKLHVAGRDIT 189

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
           + LM++L   G++F    ++ +V DIK+KLCYVAL+ E+E++
Sbjct: 190 ELLMQLLLASGHTFPCQLDKGLVDDIKKKLCYVALEPEKELS 231


>BC007289-1|AAH07289.1|  372|Homo sapiens actin related protein M1
           protein.
          Length = 372

 Score =  237 bits (580), Expect = 3e-62
 Identities = 108/221 (48%), Positives = 158/221 (71%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VGD+AQ  R  L +
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVGDQAQDWRSSLFI 66

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 459
            YP+E G++T+ +DME +W H +   L++ P + PVL+TE  LNP ANR+++T++ FE  
Sbjct: 67  SYPVERGLITSCEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITEMFFEHL 126

Query: 460 NTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD 639
             PA Y++IQAVL+L+A+G TTG+VL+SG GV+ +VPI+EGY LPH + +LDLAG DLT+
Sbjct: 127 GVPAFYMSIQAVLALFAAGFTTGLVLNSGAGVTQSVPIFEGYCLPHGVQQLDLAGLDLTN 186

Query: 640 YLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
           YLM ++   G    + ++R+IV DIKE  CYVA+++E+EMA
Sbjct: 187 YLMVLMKNHGIMLLSASDRKIVEDIKESFCYVAMNYEEEMA 227


>BC014610-1|AAH14610.1|  435|Homo sapiens actin-like 7A protein.
          Length = 435

 Score =  222 bits (542), Expect = 1e-57
 Identities = 106/234 (45%), Positives = 150/234 (64%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG E  +  
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTN 126

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
             L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P  NREK  ++
Sbjct: 127 VHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEM 186

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           +FE FNTPAM++A Q+ LS+Y+ GRT+G+V++ G GVS+ VPIYEGY LP    RLD AG
Sbjct: 187 LFEAFNTPAMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSITGRLDYAG 246

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
            DLT YL+ +L   G  FT   +  IV DIK+K C+VALD  +E     S  ++
Sbjct: 247 SDLTAYLLGLLNSAGNEFTQD-QMGIVEDIKKKCCFVALDPIEEKKVPLSEHTI 299


>AL359692-4|CAI40571.1|  435|Homo sapiens actin-like 7A protein.
          Length = 435

 Score =  222 bits (542), Expect = 1e-57
 Identities = 106/234 (45%), Positives = 150/234 (64%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG E  +  
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTN 126

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
             L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P  NREK  ++
Sbjct: 127 VHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEM 186

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           +FE FNTPAM++A Q+ LS+Y+ GRT+G+V++ G GVS+ VPIYEGY LP    RLD AG
Sbjct: 187 LFEAFNTPAMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSITGRLDYAG 246

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
            DLT YL+ +L   G  FT   +  IV DIK+K C+VALD  +E     S  ++
Sbjct: 247 SDLTAYLLGLLNSAGNEFTQD-QMGIVEDIKKKCCFVALDPIEEKKVPLSEHTI 299


>AF113526-1|AAD44109.1|  435|Homo sapiens actin-like-7-alpha
           protein.
          Length = 435

 Score =  222 bits (542), Expect = 1e-57
 Identities = 106/234 (45%), Positives = 150/234 (64%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG E  +  
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTN 126

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
             L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P  NREK  ++
Sbjct: 127 VHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEM 186

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           +FE FNTPAM++A Q+ LS+Y+ GRT+G+V++ G GVS+ VPIYEGY LP    RLD AG
Sbjct: 187 LFEAFNTPAMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSITGRLDYAG 246

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
            DLT YL+ +L   G  FT   +  IV DIK+K C+VALD  +E     S  ++
Sbjct: 247 SDLTAYLLGLLNSAGNEFTQD-QMGIVEDIKKKCCFVALDPIEEKKVPLSEHTI 299


>AB284520-1|BAF41971.1|  435|Homo sapiens human t-actin 2 protein.
          Length = 435

 Score =  222 bits (542), Expect = 1e-57
 Identities = 106/234 (45%), Positives = 150/234 (64%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG E  +  
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTN 126

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
             L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P  NREK  ++
Sbjct: 127 VHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEM 186

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           +FE FNTPAM++A Q+ LS+Y+ GRT+G+V++ G GVS+ VPIYEGY LP    RLD AG
Sbjct: 187 LFEAFNTPAMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSITGRLDYAG 246

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
            DLT YL+ +L   G  FT   +  IV DIK+K C+VALD  +E     S  ++
Sbjct: 247 SDLTAYLLGLLNSAGNEFTQD-QMGIVEDIKKKCCFVALDPIEEKKVPLSEHTI 299


>AY970501-1|AAX82307.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970498-1|AAX82304.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970497-1|AAX82303.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970495-1|AAX82301.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970494-1|AAX82300.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970493-1|AAX82299.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970491-1|AAX82297.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970489-1|AAX82295.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970488-1|AAX82294.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970487-1|AAX82293.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970486-1|AAX82292.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970478-1|AAX82284.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970476-1|AAX82282.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970474-1|AAX82280.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970473-1|AAX82279.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970472-1|AAX82278.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970471-1|AAX82277.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970470-1|AAX82276.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970469-1|AAX82275.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970468-1|AAX82274.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970443-1|AAX82252.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970441-1|AAX82250.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970419-1|AAX82228.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970418-1|AAX82227.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970417-1|AAX82226.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970416-1|AAX82225.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970415-1|AAX82224.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970414-1|AAX82223.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970413-1|AAX82222.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970412-1|AAX82221.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970411-1|AAX82220.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970410-1|AAX82219.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970409-1|AAX82218.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970408-1|AAX82217.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970406-1|AAX82215.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970405-1|AAX82214.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970404-1|AAX82213.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970403-1|AAX82212.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970402-1|AAX82211.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970382-1|AAX82191.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970381-1|AAX82190.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970380-1|AAX82189.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970377-1|AAX82186.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970375-1|AAX82184.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970372-1|AAX82182.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970371-1|AAX82181.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970370-1|AAX82180.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970369-1|AAX82179.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970368-1|AAX82178.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970366-1|AAX82176.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970364-1|AAX82174.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970363-1|AAX82173.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  218 bits (533), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970492-1|AAX82298.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  217 bits (530), Expect = 4e-56
 Identities = 100/103 (97%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLT+APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTQAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970490-1|AAX82296.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  217 bits (529), Expect = 5e-56
 Identities = 100/103 (97%), Positives = 102/103 (99%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRV PEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVTPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970444-1|AAX82253.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  217 bits (529), Expect = 5e-56
 Identities = 100/103 (97%), Positives = 103/103 (100%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYN+LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNKLRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970500-1|AAX82306.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  216 bits (528), Expect = 7e-56
 Identities = 100/103 (97%), Positives = 102/103 (99%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ MFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQTMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970442-1|AAX82251.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  216 bits (528), Expect = 7e-56
 Identities = 100/103 (97%), Positives = 102/103 (99%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN EKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANHEKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970374-1|AAX82183.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  216 bits (527), Expect = 9e-56
 Identities = 100/103 (97%), Positives = 102/103 (99%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPL PKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLTPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>BC036253-1|AAH36253.1|  339|Homo sapiens ACTR2 protein protein.
          Length = 339

 Score =  215 bits (526), Expect = 1e-55
 Identities = 100/184 (54%), Positives = 132/184 (71%), Gaps = 1/184 (0%)
 Frame = +1

Query: 238 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNP 414
           VGDEA   R +L + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP
Sbjct: 2   VGDEASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNP 61

Query: 415 KANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 594
             NREK+ ++MFET+    +YVAIQAVL+LYA G  TG+V+DSGDGV+H  P+YEG++LP
Sbjct: 62  TKNREKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLP 121

Query: 595 HAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAS 774
           H   RLD+AGRD+T YL+K+L  RGY+F  +A+ E VR IKEKLCYV  + EQE   A  
Sbjct: 122 HLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALE 181

Query: 775 SSSL 786
           ++ L
Sbjct: 182 TTVL 185


>AY970485-1|AAX82291.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  215 bits (526), Expect = 1e-55
 Identities = 100/103 (97%), Positives = 102/103 (99%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF TFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFGTFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970477-1|AAX82283.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  215 bits (526), Expect = 1e-55
 Identities = 100/103 (97%), Positives = 102/103 (99%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAG DLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGPDLT 103


>AY970383-1|AAX82192.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  215 bits (526), Expect = 1e-55
 Identities = 100/103 (97%), Positives = 102/103 (99%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRD T
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDPT 103


>AY970376-1|AAX82185.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  215 bits (526), Expect = 1e-55
 Identities = 100/103 (97%), Positives = 102/103 (99%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILR DLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRPDLAGRDLT 103


>AY970365-1|AAX82175.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  215 bits (526), Expect = 1e-55
 Identities = 100/103 (97%), Positives = 102/103 (99%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNEL VAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELGVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970496-1|AAX82302.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  215 bits (525), Expect = 2e-55
 Identities = 100/103 (97%), Positives = 102/103 (99%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWH TFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHRTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970420-1|AAX82229.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  215 bits (525), Expect = 2e-55
 Identities = 100/103 (97%), Positives = 102/103 (99%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASG TTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGCTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970421-1|AAX82230.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  215 bits (524), Expect = 2e-55
 Identities = 99/103 (96%), Positives = 102/103 (99%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAIL LDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILCLDLAGRDLT 103


>AY970367-1|AAX82177.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  213 bits (521), Expect = 5e-55
 Identities = 99/103 (96%), Positives = 102/103 (99%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIW HTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWRHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIY+GYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYKGYALPHAILRLDLAGRDLT 103


>AY970502-1|AAX82308.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  213 bits (519), Expect = 8e-55
 Identities = 98/103 (95%), Positives = 101/103 (98%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+HTVPIYEG ALPHAILRLDLAGRDLT
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALPHAILRLDLAGRDLT 103


>AY970475-1|AAX82281.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  213 bits (519), Expect = 8e-55
 Identities = 98/103 (95%), Positives = 102/103 (99%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHT YNELRVAPEEHPVLLTEAPLNPKANRE++TQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTLYNELRVAPEEHPVLLTEAPLNPKANREEITQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970390-1|AAX82199.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  213 bits (519), Expect = 8e-55
 Identities = 97/103 (94%), Positives = 101/103 (98%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+HTVPIYEGYALPHA LRLDLAGR+LT
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGYALPHATLRLDLAGRELT 103


>AY970483-1|AAX82289.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  212 bits (518), Expect = 1e-54
 Identities = 98/103 (95%), Positives = 101/103 (98%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           +IWHHTFYNELRVAPEEHPVLLTEA LNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   RIWHHTFYNELRVAPEEHPVLLTEATLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970385-1|AAX82194.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  211 bits (516), Expect = 2e-54
 Identities = 96/103 (93%), Positives = 100/103 (97%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKAN EKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANHEKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+H VPIYEGYALPHAI+RLDLAGRDLT
Sbjct: 61  TSGRTTGIVMDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLT 103


>AY970440-1|AAX82249.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  211 bits (515), Expect = 2e-54
 Identities = 97/103 (94%), Positives = 100/103 (97%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLY
Sbjct: 1   KIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLT
Sbjct: 61  ASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLT 103


>AY970439-1|AAX82248.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  211 bits (515), Expect = 2e-54
 Identities = 97/103 (94%), Positives = 100/103 (97%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLY
Sbjct: 1   KIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIVLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLT
Sbjct: 61  ASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLT 103


>AY970460-1|AAX82267.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  210 bits (514), Expect = 3e-54
 Identities = 97/103 (94%), Positives = 100/103 (97%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLDLAGRDLT
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRDLT 103


>AY970407-1|AAX82216.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  210 bits (513), Expect = 4e-54
 Identities = 98/103 (95%), Positives = 101/103 (98%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHT YNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM VAIQAVLSLY
Sbjct: 1   KIWHHTSYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMCVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGI++DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGILMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970384-1|AAX82193.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  210 bits (513), Expect = 4e-54
 Identities = 96/103 (93%), Positives = 101/103 (98%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIW+HTFYNELRVAP+EHP+LLTEAPLNPK NREKMTQIMFE FNTPAMYVAIQAVLSLY
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMTQIMFEAFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970499-1|AAX82305.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  210 bits (512), Expect = 6e-54
 Identities = 98/103 (95%), Positives = 100/103 (97%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+D GDGV+HTV IYEGYALPHAILRLDLAG DLT
Sbjct: 61  ASGRTTGIVMDFGDGVTHTVSIYEGYALPHAILRLDLAGLDLT 103


>AY970479-1|AAX82285.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  209 bits (511), Expect = 8e-54
 Identities = 97/103 (94%), Positives = 100/103 (97%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970457-1|AAX82264.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  209 bits (510), Expect = 1e-53
 Identities = 96/103 (93%), Positives = 100/103 (97%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970431-1|AAX82240.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  209 bits (510), Expect = 1e-53
 Identities = 96/103 (93%), Positives = 100/103 (97%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970430-1|AAX82239.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  209 bits (510), Expect = 1e-53
 Identities = 96/103 (93%), Positives = 100/103 (97%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970428-1|AAX82237.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  209 bits (510), Expect = 1e-53
 Identities = 96/103 (93%), Positives = 100/103 (97%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970389-1|AAX82198.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  209 bits (510), Expect = 1e-53
 Identities = 96/103 (93%), Positives = 100/103 (97%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970446-1|AAX82255.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  208 bits (509), Expect = 1e-53
 Identities = 96/103 (93%), Positives = 100/103 (97%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGDALPHATLRLDLAGRELT 103


>AY970386-1|AAX82195.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  208 bits (509), Expect = 1e-53
 Identities = 96/103 (93%), Positives = 100/103 (97%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRL+LAGRDLT
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLNLAGRDLT 103


>AY970456-1|AAX82263.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  207 bits (506), Expect = 3e-53
 Identities = 95/103 (92%), Positives = 100/103 (97%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPA+YVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAIYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970429-1|AAX82238.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  207 bits (506), Expect = 3e-53
 Identities = 95/103 (92%), Positives = 100/103 (97%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMT+IMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTRIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970388-1|AAX82197.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  207 bits (506), Expect = 3e-53
 Identities = 95/103 (92%), Positives = 99/103 (96%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYV IQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVTIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970387-1|AAX82196.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  207 bits (506), Expect = 3e-53
 Identities = 95/103 (92%), Positives = 99/103 (96%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYV IQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVTIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970464-1|AAX82271.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  207 bits (505), Expect = 4e-53
 Identities = 95/103 (92%), Positives = 99/103 (96%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDG +HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 61  TSGRTTGIVMDSGDGFTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970378-1|AAX82187.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  207 bits (505), Expect = 4e-53
 Identities = 95/103 (92%), Positives = 99/103 (96%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLDL GR+LT
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLPGRELT 103


>AY970480-1|AAX82286.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  206 bits (503), Expect = 7e-53
 Identities = 95/103 (92%), Positives = 99/103 (96%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+HTVPIYEG ALPHA L LDLAGR+LT
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLPLDLAGRELT 103


>AY970452-1|AAX82260.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  206 bits (503), Expect = 7e-53
 Identities = 94/103 (91%), Positives = 99/103 (96%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIW+HTFYNELRVAP+EHP+LLTEAPLNPK NREKMTQIMFE FNTPAMY AIQAVLSLY
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMTQIMFEAFNTPAMYAAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+H VPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHIVPIYEGYALPHAILRLDLAGRDLT 103


>AY970454-1|AAX82261.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  206 bits (502), Expect = 9e-53
 Identities = 95/103 (92%), Positives = 99/103 (96%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEH +LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHSILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970432-1|AAX82241.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  206 bits (502), Expect = 9e-53
 Identities = 94/103 (91%), Positives = 98/103 (95%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKAN EKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANHEKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SG TTGIV+DSGDGV+HTVPIYEG ALPHA LRLDLAGRD+T
Sbjct: 61  TSGHTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRDMT 103


>AY970455-1|AAX82262.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  205 bits (501), Expect = 1e-52
 Identities = 95/103 (92%), Positives = 99/103 (96%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAM VAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMCVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970433-1|AAX82242.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  205 bits (501), Expect = 1e-52
 Identities = 94/103 (91%), Positives = 99/103 (96%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIW+HTFYNELRVAP+EHP+LLTEAPLNPK NREKM QIMFE FNTPAMYVAIQAVLSLY
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMIQIMFEAFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+H VPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTHIVPIYEGYALPHAILRLDLAGRDLT 103


>AY970463-1|AAX82270.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  205 bits (500), Expect = 2e-52
 Identities = 94/103 (91%), Positives = 99/103 (96%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFY+ELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYSELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDG +HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 61  TSGRTTGIVMDSGDGFTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970426-1|AAX82235.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  205 bits (500), Expect = 2e-52
 Identities = 94/103 (91%), Positives = 99/103 (96%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV SLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVPSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+HTVPIY+G ALPHA LRLDLAGR+LT
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYDGNALPHATLRLDLAGRELT 103


>AY970392-1|AAX82201.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  205 bits (500), Expect = 2e-52
 Identities = 94/103 (91%), Positives = 99/103 (96%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKAN EKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANHEKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRL+LAGR+LT
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLNLAGRELT 103


>BC033789-1|AAH33789.1|  415|Homo sapiens actin-like 7B protein.
          Length = 415

 Score =  204 bits (499), Expect = 2e-52
 Identities = 97/224 (43%), Positives = 144/224 (64%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 267
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG E  +   
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHELLNTEA 107

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
            L L  P++HGIV +WD ++ IW + F   +++ PEEH VL+++ PL+P +NREK  ++M
Sbjct: 108 PLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELM 167

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGR 627
           FETF  PAM+V  Q++LS+Y+ G+T+G+V++SG GVSH VPI EG  LP    R D AG 
Sbjct: 168 FETFGIPAMHVTSQSLLSIYSYGKTSGLVVESGHGVSHVVPISEGDVLPGLTSRADYAGG 227

Query: 628 DLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           DLT+YLM++L E G++FT      I+  IK+K CY A   E+E+
Sbjct: 228 DLTNYLMQLLNEAGHAFTDD-HLHIIEHIKKKCCYAAFLPEEEL 270


>AL359692-3|CAI40570.1|  415|Homo sapiens actin-like 7B protein.
          Length = 415

 Score =  204 bits (499), Expect = 2e-52
 Identities = 97/224 (43%), Positives = 144/224 (64%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 267
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG E  +   
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHELLNTEA 107

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
            L L  P++HGIV +WD ++ IW + F   +++ PEEH VL+++ PL+P +NREK  ++M
Sbjct: 108 PLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELM 167

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGR 627
           FETF  PAM+V  Q++LS+Y+ G+T+G+V++SG GVSH VPI EG  LP    R D AG 
Sbjct: 168 FETFGIPAMHVTSQSLLSIYSYGKTSGLVVESGHGVSHVVPISEGDVLPGLTSRADYAGG 227

Query: 628 DLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           DLT+YLM++L E G++FT      I+  IK+K CY A   E+E+
Sbjct: 228 DLTNYLMQLLNEAGHAFTDD-HLHIIEHIKKKCCYAAFLPEEEL 270


>AF113527-1|AAD44110.1|  415|Homo sapiens actin-like-7-beta protein.
          Length = 415

 Score =  204 bits (499), Expect = 2e-52
 Identities = 97/224 (43%), Positives = 144/224 (64%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 267
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG E  +   
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHELLNTEA 107

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
            L L  P++HGIV +WD ++ IW + F   +++ PEEH VL+++ PL+P +NREK  ++M
Sbjct: 108 PLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELM 167

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGR 627
           FETF  PAM+V  Q++LS+Y+ G+T+G+V++SG GVSH VPI EG  LP    R D AG 
Sbjct: 168 FETFGIPAMHVTSQSLLSIYSYGKTSGLVVESGHGVSHVVPISEGDVLPGLTSRADYAGG 227

Query: 628 DLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           DLT+YLM++L E G++FT      I+  IK+K CY A   E+E+
Sbjct: 228 DLTNYLMQLLNEAGHAFTDD-HLHIIEHIKKKCCYAAFLPEEEL 270


>AB284521-1|BAF41972.1|  415|Homo sapiens t-actin 1 protein.
          Length = 415

 Score =  204 bits (499), Expect = 2e-52
 Identities = 97/224 (43%), Positives = 144/224 (64%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 267
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG E  +   
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHELLNTEA 107

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
            L L  P++HGIV +WD ++ IW + F   +++ PEEH VL+++ PL+P +NREK  ++M
Sbjct: 108 PLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELM 167

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGR 627
           FETF  PAM+V  Q++LS+Y+ G+T+G+V++SG GVSH VPI EG  LP    R D AG 
Sbjct: 168 FETFGIPAMHVTSQSLLSIYSYGKTSGLVVESGHGVSHVVPISEGDVLPGLTSRADYAGG 227

Query: 628 DLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           DLT+YLM++L E G++FT      I+  IK+K CY A   E+E+
Sbjct: 228 DLTNYLMQLLNEAGHAFTDD-HLHIIEHIKKKCCYAAFLPEEEL 270


>AY970451-1|AAX82259.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  203 bits (496), Expect = 5e-52
 Identities = 94/103 (91%), Positives = 99/103 (96%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIW+HTFYNELRVAP+EHP+LLTEAPLNPK NREKMTQIMFE FNTPAMYVAIQAVLSLY
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMTQIMFEAFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV+DSGDGV+  VPIYEGYALPHAILRLDLAGRDLT
Sbjct: 61  ASGRTTGIVMDSGDGVTLIVPIYEGYALPHAILRLDLAGRDLT 103


>AY970462-1|AAX82269.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  202 bits (493), Expect = 1e-51
 Identities = 93/102 (91%), Positives = 98/102 (96%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV SLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVPSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 633
            SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRL+LAGR+L
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLNLAGREL 102


>AY970391-1|AAX82200.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  202 bits (493), Expect = 1e-51
 Identities = 93/103 (90%), Positives = 97/103 (94%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNP ANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPMANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGI +DSGDGV+HT PIYEG ALPHA LRLDLAGR+LT
Sbjct: 61  TSGRTTGIFMDSGDGVTHTAPIYEGNALPHAPLRLDLAGRELT 103


>AY970461-1|AAX82268.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  200 bits (489), Expect = 3e-51
 Identities = 93/102 (91%), Positives = 97/102 (95%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHT YNELRVAPEEHPVLLTEA LNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTLYNELRVAPEEHPVLLTEATLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 633
            SGRTTGIV+DSGDGV+HTVPIY+G ALPHA LRLDLAGR+L
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYDGNALPHATLRLDLAGREL 102


>BC045752-1|AAH45752.1|  416|Homo sapiens hypothetical protein
           MGC33407 protein.
          Length = 416

 Score =  200 bits (488), Expect = 5e-51
 Identities = 95/225 (42%), Positives = 144/225 (64%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 267
           +  A+V+D G+G CK GFAG  +P     +I+G    +    G     +++G+ A+    
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIGEAARVLPE 107

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
            LTL  P+  GIV +WD  E IW H   ++LRVA  +HP+L ++ P +P  NREK+ ++ 
Sbjct: 108 -LTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLFSDPPFSPATNREKLVEVA 166

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGR 627
           FE+  +PAMYVA Q+VLS+YA GR +G+V+D+G GV++TVP+++GY L HA  RLDLAG 
Sbjct: 167 FESLRSPAMYVASQSVLSVYAHGRVSGLVVDTGHGVTYTVPVFQGYNLLHATERLDLAGN 226

Query: 628 DLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
           +LT +L ++L + G       + ++V +IK   CYVA DF++E A
Sbjct: 227 NLTAFLAEMLLQAGLPL-GQQDLDLVENIKHHYCYVASDFQKEQA 270


>BC024028-1|AAH24028.1|  416|Homo sapiens hypothetical protein
           MGC33407 protein.
          Length = 416

 Score =  200 bits (488), Expect = 5e-51
 Identities = 95/225 (42%), Positives = 144/225 (64%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 267
           +  A+V+D G+G CK GFAG  +P     +I+G    +    G     +++G+ A+    
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIGEAARVLPE 107

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
            LTL  P+  GIV +WD  E IW H   ++LRVA  +HP+L ++ P +P  NREK+ ++ 
Sbjct: 108 -LTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLFSDPPFSPATNREKLVEVA 166

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGR 627
           FE+  +PAMYVA Q+VLS+YA GR +G+V+D+G GV++TVP+++GY L HA  RLDLAG 
Sbjct: 167 FESLRSPAMYVASQSVLSVYAHGRVSGLVVDTGHGVTYTVPVFQGYNLLHATERLDLAGN 226

Query: 628 DLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
           +LT +L ++L + G       + ++V +IK   CYVA DF++E A
Sbjct: 227 NLTAFLAEMLLQAGLPL-GQQDLDLVENIKHHYCYVASDFQKEQA 270


>AY970458-1|AAX82265.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  200 bits (487), Expect = 6e-51
 Identities = 93/103 (90%), Positives = 98/103 (95%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPL+PKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLSPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGD V+ TVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 61  TSGRTTGIVMDSGDRVTPTVPIYEGNALPHATLRLDLAGRELT 103


>AY970447-1|AAX82256.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  200 bits (487), Expect = 6e-51
 Identities = 92/103 (89%), Positives = 97/103 (94%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIM E F+ PAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMLEIFDRPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLDLAG+DLT
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGQDLT 103


>AY970427-1|AAX82236.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  198 bits (484), Expect = 1e-50
 Identities = 91/102 (89%), Positives = 97/102 (95%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIM ETFNTPAMYVA QA+LSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMSETFNTPAMYVANQAMLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 633
            SGRTTGIV+DSGDGV+HTVPIY+G ALPHA LRLDLAGR+L
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYDGNALPHATLRLDLAGREL 102


>AY970459-1|AAX82266.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  197 bits (481), Expect = 3e-50
 Identities = 90/103 (87%), Positives = 99/103 (96%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHH F+NELRVAP++HP+LLT+APL+PKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHIFHNELRVAPKQHPMLLTKAPLDPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>BC113036-1|AAI13037.1|  103|Homo sapiens ACTB protein protein.
          Length = 103

 Score =  196 bits (479), Expect = 6e-50
 Identities = 93/95 (97%), Positives = 95/95 (100%)
 Frame = +1

Query: 409 NPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYA 588
           NPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYA
Sbjct: 4   NPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYA 63

Query: 589 LPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE 693
           LPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE
Sbjct: 64  LPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE 98


>AY970424-1|AAX82233.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  196 bits (478), Expect = 8e-50
 Identities = 90/103 (87%), Positives = 98/103 (95%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAP++HPVLLT+APLNPKANREKMTQIMFETFNT AMYVAIQA+LSLY
Sbjct: 1   KIWHHTFYNELRVAPKQHPVLLTKAPLNPKANREKMTQIMFETFNTAAMYVAIQALLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGI++DSGD V+HTVP Y GYALPH+IL LDLAGRDLT
Sbjct: 61  ASGRTTGIMMDSGDEVTHTVPFYGGYALPHSILCLDLAGRDLT 103


>AY970425-1|AAX82234.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  195 bits (475), Expect = 2e-49
 Identities = 90/103 (87%), Positives = 98/103 (95%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNEL VA +EHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA+LSLY
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAMLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+DSGDGV+HTVPIY+G ALPHAILR+ LAG+DLT
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYDGNALPHAILRVCLAGQDLT 103


>AY970422-1|AAX82231.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  192 bits (469), Expect = 9e-49
 Identities = 89/103 (86%), Positives = 96/103 (93%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEE P+LL EAPLNP+AN +KMTQI+FETFNTPAMY+AIQ +LSLY
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKKMTQIIFETFNTPAMYLAIQTMLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIV DS DGV+HTVPIYEGYALPHAIL LDLAGRDLT
Sbjct: 61  ASGRTTGIVSDSSDGVTHTVPIYEGYALPHAILLLDLAGRDLT 103


>AY970467-1|AAX82273.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  192 bits (468), Expect = 1e-48
 Identities = 89/103 (86%), Positives = 97/103 (94%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEE P+LL EAPLNP+AN +KMTQI+FETFNTPAMY+AIQ +LSLY
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKKMTQIIFETFNTPAMYLAIQTMLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIVLDS DGV+HTVPIYEGYALP+AIL LDLAGRDLT
Sbjct: 61  ASGRTTGIVLDSSDGVTHTVPIYEGYALPNAILLLDLAGRDLT 103


>AY970448-1|AAX82257.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  192 bits (468), Expect = 1e-48
 Identities = 88/103 (85%), Positives = 94/103 (91%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFY E+RV PEEHPVL+TEA LNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYKEVRVVPEEHPVLVTEATLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
             GR  GIV+DSGDGV+HTVPIY+G ALPHA LRLDLAGR+LT
Sbjct: 61  TFGRNNGIVMDSGDGVTHTVPIYDGNALPHATLRLDLAGRELT 103


>AY970401-1|AAX82210.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  192 bits (468), Expect = 1e-48
 Identities = 89/103 (86%), Positives = 97/103 (94%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEE P+LL EAPLNP+AN +KMTQI+FETFNTPAMY+AIQ +LSLY
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKKMTQIIFETFNTPAMYLAIQTMLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIVLDS DGV+HTVPIYEGYALP+AIL LDLAGRDLT
Sbjct: 61  ASGRTTGIVLDSSDGVTHTVPIYEGYALPNAILLLDLAGRDLT 103


>AY970396-1|AAX82205.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  191 bits (466), Expect = 2e-48
 Identities = 88/103 (85%), Positives = 95/103 (92%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYN+L VAPEE+ VL+T+APLNPKANREKMTQIMFE FNTPAMY+AIQAVLSLY
Sbjct: 1   KIWHHTFYNKLHVAPEEYLVLMTKAPLNPKANREKMTQIMFEVFNTPAMYMAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+D GDGV+HTVPIYEGY LPHAIL LDLAG DLT
Sbjct: 61  TSGRTTGIVMDFGDGVAHTVPIYEGYPLPHAILHLDLAGWDLT 103


>AY970398-1|AAX82207.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  191 bits (465), Expect = 3e-48
 Identities = 88/103 (85%), Positives = 96/103 (93%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHH F+NELRVAP++HPVLLT+APLNPKANREKMT IMFETFNT AMYVAIQA+LSLY
Sbjct: 1   KIWHHIFHNELRVAPKQHPVLLTKAPLNPKANREKMTHIMFETFNTAAMYVAIQALLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGI++DSGD V+HTVP Y GYALPHAIL LDLAGRDLT
Sbjct: 61  ASGRTTGIMMDSGDEVTHTVPFYGGYALPHAILCLDLAGRDLT 103


>AY970423-1|AAX82232.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  190 bits (464), Expect = 4e-48
 Identities = 88/103 (85%), Positives = 97/103 (94%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           +IWHHTFYNELRVAPEE P+LL EAPLNP+AN +KMTQI+FETFNTPAMY+AIQ +LSLY
Sbjct: 1   EIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKKMTQIIFETFNTPAMYLAIQTMLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIVLDS DGV+HTVPIYEGYALP+AIL LDLAGRDLT
Sbjct: 61  ASGRTTGIVLDSSDGVTHTVPIYEGYALPNAILLLDLAGRDLT 103


>AY970481-1|AAX82287.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  190 bits (462), Expect = 7e-48
 Identities = 89/103 (86%), Positives = 94/103 (91%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM E F+ PAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMLEIFDRPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTT IV+D  DGV+HTVPIYE YALPHAILR+ LAG+DLT
Sbjct: 61  TSGRTTDIVMDYDDGVTHTVPIYEEYALPHAILRVCLAGQDLT 103


>M16247-1|AAA51580.1|  232|Homo sapiens ACTG1 protein.
          Length = 232

 Score =  189 bits (461), Expect = 9e-48
 Identities = 91/93 (97%), Positives = 93/93 (100%)
 Frame = +1

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTT 687
           ASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTT
Sbjct: 1   ASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTT 60

Query: 688 AEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           AEREIVRDIKEKLCYVALDFEQEMATAASSSSL
Sbjct: 61  AEREIVRDIKEKLCYVALDFEQEMATAASSSSL 93


>AY970400-1|AAX82209.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  188 bits (459), Expect = 2e-47
 Identities = 88/103 (85%), Positives = 94/103 (91%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNELRVAPEE P+LL EAPLNPKAN +KMTQI+FETFNTPAMY+AIQ +LSLY
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLIEAPLNPKANCKKMTQIIFETFNTPAMYLAIQTMLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGIVLDS DGV+HTVPIYEGYALP AIL LDLAG D T
Sbjct: 61  ASGRTTGIVLDSSDGVTHTVPIYEGYALPQAILHLDLAGWDRT 103


>AY970445-1|AAX82254.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  183 bits (446), Expect = 6e-46
 Identities = 85/103 (82%), Positives = 94/103 (91%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHH F+NELRVAP++HPVLLT+APLNP+ANREKMT IMFETF T AMYVAIQA+LSLY
Sbjct: 1   KIWHHIFHNELRVAPKQHPVLLTKAPLNPRANREKMTHIMFETFYTAAMYVAIQALLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTTGI++DSGD V+HTV  Y GYALPHAIL LDLAGRDLT
Sbjct: 61  ASGRTTGIMMDSGDEVTHTVAFYGGYALPHAILCLDLAGRDLT 103


>AY970395-1|AAX82204.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  183 bits (446), Expect = 6e-46
 Identities = 85/103 (82%), Positives = 94/103 (91%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHH FYN LRVAPEE  VLLTEAPLNP+ANREKMTQIMF+TFNTPAMYVAIQAVL+L+
Sbjct: 1   KIWHHVFYNVLRVAPEEQVVLLTEAPLNPRANREKMTQIMFKTFNTPAMYVAIQAVLTLH 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           +SG TTGIV+DSGDGV+HTVPIYE + LPH IL LDLAG+DLT
Sbjct: 61  SSGCTTGIVMDSGDGVTHTVPIYERHHLPHTILHLDLAGQDLT 103


>AY970379-1|AAX82188.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  183 bits (446), Expect = 6e-46
 Identities = 84/103 (81%), Positives = 93/103 (90%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNEL VAP+EH +LLTE PLNPKAN +KMTQIMFETFNTPA+Y+AIQA+LSLY
Sbjct: 1   KIWHHTFYNELHVAPKEHRMLLTEVPLNPKANHKKMTQIMFETFNTPAVYMAIQAMLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
             G TTGIV+DS DGV+HTVPIYEGYALP AIL LD+AGRDLT
Sbjct: 61  TYGCTTGIVMDSSDGVTHTVPIYEGYALPRAILCLDVAGRDLT 103


>BC015207-1|AAH15207.1|  348|Homo sapiens ARP3 actin-related protein
           3 homolog B (yeast) protein.
          Length = 348

 Score =  183 bits (445), Expect = 7e-46
 Identities = 97/236 (41%), Positives = 137/236 (58%), Gaps = 16/236 (6%)
 Frame = +1

Query: 103 VVDNGSGMCKAGFAGDDAPRAVFPSIVG--------RPRHQGVMVGMGQKDSYVGDEAQS 258
           VVD G+G  K G+AG+  P+ + PS +             + V+ G+   D ++GDEA  
Sbjct: 9   VVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAID 68

Query: 259 KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 438
           K    T K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE PLN   NRE + 
Sbjct: 69  KPTYAT-KWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLA 127

Query: 439 QIMFETFNTPAMYVAIQAVLSLYAS-------GRT-TGIVLDSGDGVSHTVPIYEGYALP 594
           +IMFE+FN P +Y+A+QAVL+L AS        RT TGIV+DSGDGV+H +P+ EGY + 
Sbjct: 128 EIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIG 187

Query: 595 HAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
             I  + +AGRD+T ++ ++L ER          E  + IKEK CY+  D  +E A
Sbjct: 188 SCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFA 243


>BC008682-1|AAH08682.1|  418|Homo sapiens ARP3 actin-related protein
           3 homolog B (yeast) protein.
          Length = 418

 Score =  183 bits (445), Expect = 7e-46
 Identities = 97/236 (41%), Positives = 137/236 (58%), Gaps = 16/236 (6%)
 Frame = +1

Query: 103 VVDNGSGMCKAGFAGDDAPRAVFPSIVG--------RPRHQGVMVGMGQKDSYVGDEAQS 258
           VVD G+G  K G+AG+  P+ + PS +             + V+ G+   D ++GDEA  
Sbjct: 9   VVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAID 68

Query: 259 KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 438
           K    T K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE PLN   NRE + 
Sbjct: 69  KPTYAT-KWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLA 127

Query: 439 QIMFETFNTPAMYVAIQAVLSLYAS-------GRT-TGIVLDSGDGVSHTVPIYEGYALP 594
           +IMFE+FN P +Y+A+QAVL+L AS        RT TGIV+DSGDGV+H +P+ EGY + 
Sbjct: 128 EIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIG 187

Query: 595 HAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
             I  + +AGRD+T ++ ++L ER          E  + IKEK CY+  D  +E A
Sbjct: 188 SCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFA 243


>AF023453-1|AAC98904.1|  418|Homo sapiens actin-related protein
           3-beta protein.
          Length = 418

 Score =  183 bits (445), Expect = 7e-46
 Identities = 97/236 (41%), Positives = 137/236 (58%), Gaps = 16/236 (6%)
 Frame = +1

Query: 103 VVDNGSGMCKAGFAGDDAPRAVFPSIVG--------RPRHQGVMVGMGQKDSYVGDEAQS 258
           VVD G+G  K G+AG+  P+ + PS +             + V+ G+   D ++GDEA  
Sbjct: 9   VVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAID 68

Query: 259 KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 438
           K    T K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE PLN   NRE + 
Sbjct: 69  KPTYAT-KWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLA 127

Query: 439 QIMFETFNTPAMYVAIQAVLSLYAS-------GRT-TGIVLDSGDGVSHTVPIYEGYALP 594
           +IMFE+FN P +Y+A+QAVL+L AS        RT TGIV+DSGDGV+H +P+ EGY + 
Sbjct: 128 EIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIG 187

Query: 595 HAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
             I  + +AGRD+T ++ ++L ER          E  + IKEK CY+  D  +E A
Sbjct: 188 SCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFA 243


>AY970438-1|AAX82247.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  181 bits (441), Expect = 2e-45
 Identities = 85/103 (82%), Positives = 93/103 (90%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIW H FYNEL VAPEE  VLLTEAPLNP+ANREKMTQIMF+TFNTPAMYVAIQAVLSL+
Sbjct: 1   KIWDHVFYNELWVAPEEQVVLLTEAPLNPRANREKMTQIMFKTFNTPAMYVAIQAVLSLH 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           +SG TTGIV+DSGDGV+HTVPIYE + LPH IL LDLAG+DLT
Sbjct: 61  SSGCTTGIVMDSGDGVTHTVPIYERHTLPHTILHLDLAGQDLT 103


>AY970484-1|AAX82290.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  180 bits (438), Expect = 5e-45
 Identities = 83/103 (80%), Positives = 92/103 (89%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNEL VAP+EH +LLTE PLN KAN +KMTQIMFETFNTPA+Y+AIQA+LSLY
Sbjct: 1   KIWHHTFYNELHVAPKEHRMLLTEVPLNSKANHKKMTQIMFETFNTPAVYMAIQAMLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
             G TTGIV+DS DGV+HTVPIYEGYALP AIL LD+AGRDLT
Sbjct: 61  TYGCTTGIVMDSSDGVTHTVPIYEGYALPRAILCLDVAGRDLT 103


>AY970397-1|AAX82206.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  180 bits (437), Expect = 7e-45
 Identities = 84/103 (81%), Positives = 91/103 (88%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYN+L VAPEE+ VL+T+APL  KANRE MTQIMFE FNT AMY+AIQAVLSLY
Sbjct: 1   KIWHHTFYNKLHVAPEEYLVLMTKAPLMTKANREMMTQIMFEVFNTLAMYMAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGI +DSGDGV+HTVPIYEGY LPHAIL LDLAG DLT
Sbjct: 61  TSGRTTGIAMDSGDGVAHTVPIYEGYTLPHAILHLDLAGWDLT 103


>BC044590-1|AAH44590.1|  418|Homo sapiens ARP3 actin-related protein
           3 homolog (yeast) protein.
          Length = 418

 Score =  179 bits (435), Expect = 1e-44
 Identities = 98/236 (41%), Positives = 135/236 (57%), Gaps = 16/236 (6%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 252
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GDEA
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
             K    T K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE 
Sbjct: 67  IEKPTYAT-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREY 125

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYAS-------GRT-TGIVLDSGDGVSHTVPIYEGYA 588
             +IMFE+FN P +Y+A+QAVL+L AS        RT TG V+DSGDGV+H +P+ EGY 
Sbjct: 126 TAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYV 185

Query: 589 LPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQE 756
           +   I  + +AGRD+T ++ ++L +R          E  + +KE+  YV  D  +E
Sbjct: 186 IGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKE 241


>AF127773-1|AAD51904.1|  418|Homo sapiens unknown protein.
          Length = 418

 Score =  179 bits (435), Expect = 1e-44
 Identities = 98/236 (41%), Positives = 135/236 (57%), Gaps = 16/236 (6%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 252
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GDEA
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
             K    T K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE 
Sbjct: 67  IEKPTYAT-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREY 125

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYAS-------GRT-TGIVLDSGDGVSHTVPIYEGYA 588
             +IMFE+FN P +Y+A+QAVL+L AS        RT TG V+DSGDGV+H +P+ EGY 
Sbjct: 126 TAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYV 185

Query: 589 LPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQE 756
           +   I  + +AGRD+T ++ ++L +R          E  + +KE+  YV  D  +E
Sbjct: 186 IGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKE 241


>AF006083-1|AAB64188.1|  418|Homo sapiens Arp3 protein.
          Length = 418

 Score =  179 bits (435), Expect = 1e-44
 Identities = 98/236 (41%), Positives = 135/236 (57%), Gaps = 16/236 (6%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 252
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GDEA
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
             K    T K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE 
Sbjct: 67  IEKPTYAT-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREY 125

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYAS-------GRT-TGIVLDSGDGVSHTVPIYEGYA 588
             +IMFE+FN P +Y+A+QAVL+L AS        RT TG V+DSGDGV+H +P+ EGY 
Sbjct: 126 TAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYV 185

Query: 589 LPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQE 756
           +   I  + +AGRD+T ++ ++L +R          E  + +KE+  YV  D  +E
Sbjct: 186 IGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKE 241


>AC110769-1|AAX93226.1|  418|Homo sapiens unknown protein.
          Length = 418

 Score =  179 bits (435), Expect = 1e-44
 Identities = 98/236 (41%), Positives = 135/236 (57%), Gaps = 16/236 (6%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 252
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GDEA
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
             K    T K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE 
Sbjct: 67  IEKPTYAT-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREY 125

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYAS-------GRT-TGIVLDSGDGVSHTVPIYEGYA 588
             +IMFE+FN P +Y+A+QAVL+L AS        RT TG V+DSGDGV+H +P+ EGY 
Sbjct: 126 TAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYV 185

Query: 589 LPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQE 756
           +   I  + +AGRD+T ++ ++L +R          E  + +KE+  YV  D  +E
Sbjct: 186 IGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKE 241


>AY970503-1|AAX82309.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  178 bits (433), Expect = 2e-44
 Identities = 83/103 (80%), Positives = 92/103 (89%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNEL VA +EHP+LLT+ PL+PKANREKMTQIM E F+ PAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTKVPLSPKANREKMTQIMLEIFDRPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTTGIV+D  DGV+HTVPIYE YALPHAILR+ LAG+DLT
Sbjct: 61  TSGRTTGIVMDYDDGVTHTVPIYEEYALPHAILRVCLAGQDLT 103


>AY970437-1|AAX82246.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  177 bits (431), Expect = 4e-44
 Identities = 87/103 (84%), Positives = 91/103 (88%), Gaps = 2/103 (1%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIW HTFYNEL VA EEHPVLL EA  NPKANREKMTQIMFETFN+PAMYVAIQ VLSLY
Sbjct: 1   KIWDHTFYNELCVALEEHPVLLIEACPNPKANREKMTQIMFETFNSPAMYVAIQPVLSLY 60

Query: 508 ASGRTTGIVLDSGDG--VSHTVPIYEGYALPHAILRLDLAGRD 630
           ASGRT+GIV DSGDG  V+HTVPIY GYALPHA+L LDLAGRD
Sbjct: 61  ASGRTSGIVRDSGDGVRVTHTVPIYVGYALPHAVLHLDLAGRD 103


>AY970436-1|AAX82245.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  176 bits (429), Expect = 6e-44
 Identities = 83/103 (80%), Positives = 92/103 (89%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHH FYNEL VA EE  VLLTEAPLNP+ANREKMTQIMF+TFNT AMYVAIQAVL+L+
Sbjct: 1   KIWHHVFYNELCVALEEQVVLLTEAPLNPRANREKMTQIMFKTFNTQAMYVAIQAVLTLH 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           +SG TTGIV+DSGDGV+HTVPIYE + LPH IL LDLAG+DLT
Sbjct: 61  SSGCTTGIVMDSGDGVTHTVPIYERHTLPHTILHLDLAGQDLT 103


>AY970465-1|AAX82272.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  176 bits (428), Expect = 9e-44
 Identities = 90/105 (85%), Positives = 95/105 (90%), Gaps = 2/105 (1%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF-NTPAMYVAIQA-VLS 501
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN  KMTQI FETF NTPA+Y+AIQA VLS
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN-HKMTQITFETFSNTPAIYMAIQAVVLS 59

Query: 502 LYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           LYASG TTGIV+DSG+GV+HT  IYE YALPHAILRLDLAG DLT
Sbjct: 60  LYASGLTTGIVMDSGNGVTHTA-IYEWYALPHAILRLDLAGLDLT 103


>AY970394-1|AAX82203.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  174 bits (424), Expect = 3e-43
 Identities = 81/103 (78%), Positives = 90/103 (87%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNEL VA +EHP+LLT+APL+PKAN EKMTQIM E F+ PAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTKAPLSPKANHEKMTQIMLEIFSRPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTT IV+D  DGV+HTVPIY+G ALPHA LRLDL GR+LT
Sbjct: 61  TSGRTTDIVMDYDDGVTHTVPIYDGNALPHATLRLDLGGRELT 103


>AY970434-1|AAX82243.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  174 bits (423), Expect = 3e-43
 Identities = 82/103 (79%), Positives = 91/103 (88%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHH FYNEL VA EE  VLLTEAPL P+ANREKMTQIMF+TFNT AMYVAIQAVL+L+
Sbjct: 1   KIWHHVFYNELCVALEEQVVLLTEAPLKPRANREKMTQIMFKTFNTQAMYVAIQAVLTLH 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           +SG TTGIV+DSGDGV+HTVPIYE + LPH IL LDLAG+DLT
Sbjct: 61  SSGWTTGIVMDSGDGVTHTVPIYERHTLPHTILHLDLAGQDLT 103


>AY970435-1|AAX82244.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  173 bits (420), Expect = 8e-43
 Identities = 81/103 (78%), Positives = 91/103 (88%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHH FYNEL VA EE  VLLTE PLNP+ANREKMTQIMF+TFNT AMYVAI+AVL+L+
Sbjct: 1   KIWHHVFYNELCVALEEQVVLLTEPPLNPRANREKMTQIMFKTFNTQAMYVAIRAVLTLH 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           +SG TTGIV+DSGDGV+HTVPIYE + LPH IL LDLAG+DLT
Sbjct: 61  SSGCTTGIVMDSGDGVTHTVPIYERHTLPHTILHLDLAGQDLT 103


>AY970482-1|AAX82288.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  171 bits (417), Expect = 2e-42
 Identities = 80/103 (77%), Positives = 90/103 (87%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNEL VA +EHP+LLT+ PL+PKAN +KMTQIM E F+ PAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTKVPLSPKANHKKMTQIMLEIFDRPAMYVAIQAVLSLY 60

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            SGRTT IV+D  DGV+HTVPIYE YALPHAILR+ LAG+DLT
Sbjct: 61  TSGRTTDIVMDYDDGVTHTVPIYEEYALPHAILRVCLAGQDLT 103


>AY970393-1|AAX82202.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  170 bits (414), Expect = 4e-42
 Identities = 83/104 (79%), Positives = 94/104 (90%), Gaps = 2/104 (1%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF-NTPAMYVAIQAV-LS 501
           KIWHHTFYN+L + PEEHP+LLT+APLNPKAN  KMTQI FETF NTPA+Y+AIQAV LS
Sbjct: 1   KIWHHTFYNKLCMTPEEHPMLLTQAPLNPKANH-KMTQITFETFSNTPAIYMAIQAVVLS 59

Query: 502 LYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 633
           LYASG TTGIV+DSG+GV+HTVPIY+G ALPHA LRLDLAGR+L
Sbjct: 60  LYASGLTTGIVMDSGNGVTHTVPIYDGNALPHATLRLDLAGREL 103


>AF086920-1|AAP97150.1|  402|Homo sapiens actin related protein ARP4
           protein.
          Length = 402

 Score =  162 bits (394), Expect = 1e-39
 Identities = 84/195 (43%), Positives = 118/195 (60%), Gaps = 9/195 (4%)
 Frame = +1

Query: 205 VMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP 384
           V+ G+   + ++GDEA  K    T K+PI HGI+ +WD ME+      +  LR  PE+H 
Sbjct: 32  VLRGVDDLNFFIGDEAIDKPTYAT-KWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHY 90

Query: 385 VLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYAS-------GRT-TGIVLD 540
            L+TE PLN   NRE + +IMFE+FN P +Y+A+QAVL+L AS        RT TGIV+D
Sbjct: 91  FLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVID 150

Query: 541 SGDGVSHTVPI-YEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIK 717
           SGDGV+H +P+  EGY +   I  + +AGRD+T ++ ++L ER          E  + IK
Sbjct: 151 SGDGVTHVIPVGQEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIK 210

Query: 718 EKLCYVALDFEQEMA 762
           EK CY+  D  +E A
Sbjct: 211 EKYCYICPDIVKEFA 225


>AB209353-1|BAD92590.1|  369|Homo sapiens ARP3 actin-related protein
           3 homolog variant protein.
          Length = 369

 Score =  158 bits (384), Expect = 2e-38
 Identities = 82/192 (42%), Positives = 114/192 (59%), Gaps = 8/192 (4%)
 Frame = +1

Query: 205 VMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP 384
           VM G+   D ++GDEA  K    T K+PI HGIV +WD ME+      +  LR  PE+H 
Sbjct: 2   VMKGVDDLDFFIGDEAIEKPTYAT-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHY 60

Query: 385 VLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYAS-------GRT-TGIVLD 540
            LLTE PLN   NRE   +IMFE+FN P +Y+A+QAVL+L AS        RT TG V++
Sbjct: 61  FLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIN 120

Query: 541 SGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKE 720
           SGDGV+H +P+ EGY +   I  + +AGRD+T ++ ++L +R          E  + +KE
Sbjct: 121 SGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKE 180

Query: 721 KLCYVALDFEQE 756
           +  YV  D  +E
Sbjct: 181 RYSYVCPDLVKE 192


>AY970399-1|AAX82208.1|   97|Homo sapiens actin-like protein
           protein.
          Length = 97

 Score =  157 bits (380), Expect = 6e-38
 Identities = 78/103 (75%), Positives = 88/103 (85%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIW    YNEL VAPEEHPV LTEAP+N KAN +KMTQIMFETFNTPA+YVA    +SLY
Sbjct: 1   KIW---LYNELGVAPEEHPVQLTEAPMNHKANCKKMTQIMFETFNTPAIYVAF---VSLY 54

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASGRTT I++DSGDGV+HTVP+Y+G+ALPHAIL LDLAG DLT
Sbjct: 55  ASGRTTSIMMDSGDGVTHTVPMYKGHALPHAILYLDLAGWDLT 97


>AY970450-1|AAX82258.1|  102|Homo sapiens actin-like protein
           protein.
          Length = 102

 Score =  149 bits (361), Expect = 1e-35
 Identities = 73/103 (70%), Positives = 84/103 (81%)
 Frame = +1

Query: 328 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
           KIWHHTFYNEL VAP+EHPVLLT+ PLNPKAN EK+ QIMFETFN PAMY+AI  +LS+Y
Sbjct: 1   KIWHHTFYNEL-VAPKEHPVLLTKVPLNPKANHEKIAQIMFETFNIPAMYMAIWVMLSVY 59

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           ASG TTGIV+DS    +++V I E YAL +AIL  DLA RDLT
Sbjct: 60  ASGHTTGIVMDSSGRFTYSVLISEDYALLYAILHPDLACRDLT 102


>BC028909-1|AAH28909.1|  366|Homo sapiens actin-like 8 protein.
          Length = 366

 Score =  138 bits (334), Expect = 2e-32
 Identities = 82/235 (34%), Positives = 127/235 (54%), Gaps = 7/235 (2%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGR-PRHQGVMVGMGQKDSYVGDEAQSKRGILT 276
           +++D+GSG  KAG AG + P+ VFP+IV   P  +       ++   +G +        T
Sbjct: 6   VIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPD---T 62

Query: 277 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
             YPIE G + NW+ ++ +W     N  R   E  PV++TE PL   A+R+KM +I+FE 
Sbjct: 63  FSYPIERGRILNWEGVQYLWSFVLENHRR-EQEVPPVIITETPLREPADRKKMLEILFEL 121

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            + P++ +A Q  +SLYASG  TG+V+DSG G++   P ++G  LP +   L+ AG+DL+
Sbjct: 122 LHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLS 181

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYV------ALDFEQEMATAASSSS 783
            YL+K L +         + E V   +   CYV      ALDF +   +A   S+
Sbjct: 182 AYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESN 236


>AL136529-1|CAC15940.1|  366|Homo sapiens actin-like 8 protein.
          Length = 366

 Score =  138 bits (334), Expect = 2e-32
 Identities = 82/235 (34%), Positives = 127/235 (54%), Gaps = 7/235 (2%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGR-PRHQGVMVGMGQKDSYVGDEAQSKRGILT 276
           +++D+GSG  KAG AG + P+ VFP+IV   P  +       ++   +G +        T
Sbjct: 6   VIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPD---T 62

Query: 277 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
             YPIE G + NW+ ++ +W     N  R   E  PV++TE PL   A+R+KM +I+FE 
Sbjct: 63  FSYPIERGRILNWEGVQYLWSFVLENHRR-EQEVPPVIITETPLREPADRKKMLEILFEL 121

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            + P++ +A Q  +SLYASG  TG+V+DSG G++   P ++G  LP +   L+ AG+DL+
Sbjct: 122 LHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLS 181

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYV------ALDFEQEMATAASSSS 783
            YL+K L +         + E V   +   CYV      ALDF +   +A   S+
Sbjct: 182 AYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESN 236


>AK057339-1|BAB71434.1|  366|Homo sapiens protein ( Homo sapiens
           cDNA FLJ32777 fis, clone TESTI2002057, highly similar to
           Human actin-like peptide mRNA. ).
          Length = 366

 Score =  138 bits (334), Expect = 2e-32
 Identities = 82/235 (34%), Positives = 127/235 (54%), Gaps = 7/235 (2%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGR-PRHQGVMVGMGQKDSYVGDEAQSKRGILT 276
           +++D+GSG  KAG AG + P+ VFP+IV   P  +       ++   +G +        T
Sbjct: 6   VIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPD---T 62

Query: 277 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
             YPIE G + NW+ ++ +W     N  R   E  PV++TE PL   A+R+KM +I+FE 
Sbjct: 63  FSYPIERGRILNWEGVQYLWSFVLENHRR-EQEVPPVIITETPLREPADRKKMLEILFEL 121

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            + P++ +A Q  +SLYASG  TG+V+DSG G++   P ++G  LP +   L+ AG+DL+
Sbjct: 122 LHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLS 181

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYV------ALDFEQEMATAASSSS 783
            YL+K L +         + E V   +   CYV      ALDF +   +A   S+
Sbjct: 182 AYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESN 236


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 129,045,442
Number of Sequences: 237096
Number of extensions: 3315761
Number of successful extensions: 14495
Number of sequences better than 10.0: 417
Number of HSP's better than 10.0 without gapping: 11292
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14024
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9646050614
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).