SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0019
         (837 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY496232-1|AAS77218.1|  211|Homo sapiens truncated alpha-1,4-gal...    31   5.2  
X80818-1|CAA56784.1|  912|Homo sapiens metabotropic glutamate re...    31   6.8  
U92457-1|AAB51762.1|  912|Homo sapiens metabotropic glutamate re...    31   6.8  
BC130528-1|AAI30529.1|  912|Homo sapiens glutamate receptor, met...    31   6.8  
BC130526-1|AAI30527.1|  912|Homo sapiens glutamate receptor, met...    31   6.8  
AL590403-1|CAI17348.1|  912|Homo sapiens glutamate receptor, met...    31   6.8  
AK131536-1|BAD18673.1|  796|Homo sapiens protein ( Homo sapiens ...    31   6.8  

>AY496232-1|AAS77218.1|  211|Homo sapiens truncated
           alpha-1,4-galactosyltransferase protein.
          Length = 211

 Score = 31.1 bits (67), Expect = 5.2
 Identities = 12/23 (52%), Positives = 12/23 (52%)
 Frame = -3

Query: 427 TCSTCWGVWV*GWRRGTRPSPLG 359
           TC TCW  W  G   GT P P G
Sbjct: 144 TCWTCWNSWTCGSCSGTHPWPTG 166


>X80818-1|CAA56784.1|  912|Homo sapiens metabotropic glutamate
           receptor type 4 protein.
          Length = 912

 Score = 30.7 bits (66), Expect = 6.8
 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
 Frame = -3

Query: 442 RVERGTCSTC-WGVWV*GWRRGTRPSPLGRLQWGS 341
           +V+R TC TC + +     R G RP P+ +L+WGS
Sbjct: 551 QVDRYTCKTCPYDMRPTENRTGCRPIPIIKLEWGS 585


>U92457-1|AAB51762.1|  912|Homo sapiens metabotropic glutamate
           receptor 4 protein.
          Length = 912

 Score = 30.7 bits (66), Expect = 6.8
 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
 Frame = -3

Query: 442 RVERGTCSTC-WGVWV*GWRRGTRPSPLGRLQWGS 341
           +V+R TC TC + +     R G RP P+ +L+WGS
Sbjct: 551 QVDRYTCKTCPYDMRPTENRTGCRPIPIIKLEWGS 585


>BC130528-1|AAI30529.1|  912|Homo sapiens glutamate receptor,
           metabotropic 4 protein.
          Length = 912

 Score = 30.7 bits (66), Expect = 6.8
 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
 Frame = -3

Query: 442 RVERGTCSTC-WGVWV*GWRRGTRPSPLGRLQWGS 341
           +V+R TC TC + +     R G RP P+ +L+WGS
Sbjct: 551 QVDRYTCKTCPYDMRPTENRTGCRPIPIIKLEWGS 585


>BC130526-1|AAI30527.1|  912|Homo sapiens glutamate receptor,
           metabotropic 4 protein.
          Length = 912

 Score = 30.7 bits (66), Expect = 6.8
 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
 Frame = -3

Query: 442 RVERGTCSTC-WGVWV*GWRRGTRPSPLGRLQWGS 341
           +V+R TC TC + +     R G RP P+ +L+WGS
Sbjct: 551 QVDRYTCKTCPYDMRPTENRTGCRPIPIIKLEWGS 585


>AL590403-1|CAI17348.1|  912|Homo sapiens glutamate receptor,
           metabotropic 4 protein.
          Length = 912

 Score = 30.7 bits (66), Expect = 6.8
 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
 Frame = -3

Query: 442 RVERGTCSTC-WGVWV*GWRRGTRPSPLGRLQWGS 341
           +V+R TC TC + +     R G RP P+ +L+WGS
Sbjct: 551 QVDRYTCKTCPYDMRPTENRTGCRPIPIIKLEWGS 585


>AK131536-1|BAD18673.1|  796|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16766 fis, clone BRAWH3013197, highly  similar
           to Metabotropic glutamate receptor 4 precursor. ).
          Length = 796

 Score = 30.7 bits (66), Expect = 6.8
 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
 Frame = -3

Query: 442 RVERGTCSTC-WGVWV*GWRRGTRPSPLGRLQWGS 341
           +V+R TC TC + +     R G RP P+ +L+WGS
Sbjct: 435 QVDRYTCKTCPYDMRPTENRTGCRPIPIIKLEWGS 469


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 126,919,353
Number of Sequences: 237096
Number of extensions: 2760860
Number of successful extensions: 6069
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 5774
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6068
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 10538170902
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).