SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0016
         (985 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U79745-1|AAC52014.1|  523|Homo sapiens monocarboxylate transport...    36   0.30 
BC032639-1|AAH32639.1| 1220|Homo sapiens eukaryotic translation ...    35   0.52 
AL133563-1|CAB63717.1| 1132|Homo sapiens hypothetical protein pr...    35   0.52 
AJ006776-1|CAB44357.1| 1220|Homo sapiens IF2 protein protein.          35   0.52 
AB018284-1|BAA34461.2| 1222|Homo sapiens KIAA0741 protein protein.     35   0.52 
AF180425-1|AAD55098.1| 1233|Homo sapiens retinoblastoma-associat...    34   0.92 
AF078035-1|AAD16006.1| 1220|Homo sapiens translation initiation ...    33   1.2  
Z99572-10|CAB16748.1| 2224|Homo sapiens coagulation factor V (pr...    33   1.6  
Z99572-9|CAI23065.1| 2229|Homo sapiens coagulation factor V (pro...    33   1.6  
M85165-1|AAA03631.1|  431|Homo sapiens SAP-1A protein protein.         33   1.6  
M85164-1|AAA03632.1|  405|Homo sapiens SAP-1B protein protein.         33   1.6  
M16967-1|AAA52424.1| 2224|Homo sapiens F5 protein.                     33   1.6  
M14335-1|AAB59532.1| 2224|Homo sapiens F5 protein.                     33   1.6  
L32779-1|AAB59401.1| 2224|Homo sapiens coagulation factor V prot...    33   1.6  
DQ377944-1|ABD23003.1|  939|Homo sapiens coagulation factor V pr...    33   1.6  
BC063676-1|AAH63676.1|  405|Homo sapiens ELK4, ETS-domain protei...    33   1.6  
BC040145-1|AAH40145.1|  521|Homo sapiens ELK4, ETS-domain protei...    33   1.6  
AY364535-1|AAQ55063.1| 2224|Homo sapiens coagulation factor V (p...    33   1.6  
AJ297255-1|CAC82573.1|  939|Homo sapiens coagulation factor V ji...    33   1.6  
U54628-1|AAC50670.1|  411|Homo sapiens pyruvate dehydrogenase ki...    32   2.8  
U54617-1|AAC50669.1|  411|Homo sapiens pyruvate dehydrogenase ki...    32   2.8  
BC040239-1|AAH40239.1|  411|Homo sapiens PDK4 protein protein.         32   2.8  
AK223328-1|BAD97048.1|  411|Homo sapiens pyruvate dehydrogenase ...    32   2.8  
AC002451-1|AAB67048.1|  411|Homo sapiens unknown protein.              32   2.8  
BC073884-1|AAH73884.1|  601|Homo sapiens TAF3 protein protein.         32   3.7  
BC062352-1|AAH62352.1|  771|Homo sapiens TAF3 protein protein.         32   3.7  
BC045106-1|AAH45106.1|  539|Homo sapiens TAF3 protein protein.         32   3.7  
BC017320-1|AAH17320.1|  539|Homo sapiens Unknown (protein for IM...    32   3.7  
AL390294-1|CAH73142.1|  929|Homo sapiens TAF3 RNA polymerase II,...    32   3.7  
AL353754-1|CAH73451.1|  929|Homo sapiens TAF3 RNA polymerase II,...    32   3.7  
AL159172-1|CAI15661.1|  929|Homo sapiens TAF3 RNA polymerase II,...    32   3.7  
AL117661-1|CAB56032.1|  681|Homo sapiens hypothetical protein pr...    32   3.7  
AJ292190-1|CAC34475.1|  727|Homo sapiens TAFII140 protein protein.     32   3.7  
U77327-1|AAC31117.1|  299|Homo sapiens Ki-1/57 intracellular ant...    31   4.9  
BC131515-1|AAI31516.1|  632|Homo sapiens GOLGA6 protein protein.       31   4.9  
BC129987-1|AAI29988.1| 1116|Homo sapiens C3orf63 protein protein.      31   4.9  
AL133477-4|CAI39620.1|  413|Homo sapiens hyaluronan binding prot...    31   4.9  
AF271379-1|AAG49889.1| 1241|Homo sapiens interphotoreceptor matr...    31   4.9  
AF266285-1|AAF72535.1|  693|Homo sapiens golgin-like protein pro...    31   4.9  
AF263742-1|AAF72196.1|  693|Homo sapiens golgin-like protein pro...    31   4.9  
AF241831-1|AAF62546.1|  413|Homo sapiens intracellular hyalurona...    31   4.9  
AF173155-1|AAF06999.1| 1241|Homo sapiens interphotoreceptor matr...    31   4.9  
AF157624-1|AAF13154.1| 1241|Homo sapiens Spacrcan protein.             31   4.9  
AY359091-1|AAQ89449.1|  499|Homo sapiens AAAP6077 protein.             31   6.5  
AL592148-8|CAI40470.1|  500|Homo sapiens C219-reactive peptide (...    31   6.5  
AL592148-7|CAI40469.1| 1907|Homo sapiens C219-reactive peptide (...    31   6.5  
AF273053-1|AAG34913.1| 1035|Homo sapiens CTCL tumor antigen se89...    31   6.5  
AB029028-1|BAA83057.1|  730|Homo sapiens KIAA1105 protein protein.     31   6.5  
M77830-1|AAA85135.1| 2871|Homo sapiens desmoplakin I protein.          31   8.5  
J05211-1|AAA35766.1| 1752|Homo sapiens protein ( Human desmoplak...    31   8.5  
BC150548-1|AAI50549.1|  206|Homo sapiens Unknown (protein for IM...    31   8.5  
BC150547-1|AAI50548.1|  206|Homo sapiens Unknown (protein for IM...    31   8.5  
BC141962-1|AAI41963.1|  206|Homo sapiens SLC16A6 protein protein.      31   8.5  
BC127750-1|AAI27751.1|  205|Homo sapiens SLC16A6 protein protein.      31   8.5  
BC127749-1|AAI27750.1|  206|Homo sapiens SLC16A6 protein protein.      31   8.5  
BC064832-1|AAH64832.1|  523|Homo sapiens solute carrier family 1...    31   8.5  
AL031058-1|CAA19927.1| 2871|Homo sapiens desmoplakin protein.          31   8.5  

>U79745-1|AAC52014.1|  523|Homo sapiens monocarboxylate transporter
           homologue MCT6 protein.
          Length = 523

 Score = 35.5 bits (78), Expect = 0.30
 Identities = 23/68 (33%), Positives = 38/68 (55%), Gaps = 5/68 (7%)
 Frame = -2

Query: 339 LLSLRMFSMSTFTSVFKLRSIGFSFGWFCFTIGG-----VLSFLSFC*TNNNSASSVAYL 175
           LL++ +F+ +  T  + L S    FG+   TIGG     +L  +S+     +SA+ V Y+
Sbjct: 368 LLTVSLFAFTFATEFWGLMSCSIFFGFMVGTIGGLTFHCLLKMMSWALQKMSSAAGV-YI 426

Query: 174 FIQKLSGL 151
           FIQ ++GL
Sbjct: 427 FIQSIAGL 434


>BC032639-1|AAH32639.1| 1220|Homo sapiens eukaryotic translation
           initiation factor 5B protein.
          Length = 1220

 Score = 34.7 bits (76), Expect = 0.52
 Identities = 23/77 (29%), Positives = 34/77 (44%), Gaps = 3/77 (3%)
 Frame = +2

Query: 710 QTPPLQEPAINETTRRTPKDD---LSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRR 880
           +TPP  EP   E T     DD   +++D ET  VE   V   + + P+E  E  EE    
Sbjct: 485 ETPPPVEPEEEEDTEDAGLDDWEAMASDEETEKVEGNTVHIEVKENPEEEEEEEEEEEED 544

Query: 881 ESNFNQVRRSSRAVGAE 931
           E +  +      + G+E
Sbjct: 545 EESEEEEEEEGESEGSE 561


>AL133563-1|CAB63717.1| 1132|Homo sapiens hypothetical protein
           protein.
          Length = 1132

 Score = 34.7 bits (76), Expect = 0.52
 Identities = 23/77 (29%), Positives = 34/77 (44%), Gaps = 3/77 (3%)
 Frame = +2

Query: 710 QTPPLQEPAINETTRRTPKDD---LSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRR 880
           +TPP  EP   E T     DD   +++D ET  VE   V   + + P+E  E  EE    
Sbjct: 397 ETPPPVEPEEEEDTEDAGLDDWEAMASDEETEKVEGNKVHIEVKENPEEEEEEEEEEEED 456

Query: 881 ESNFNQVRRSSRAVGAE 931
           E +  +      + G+E
Sbjct: 457 EESEEEEEEEGESEGSE 473


>AJ006776-1|CAB44357.1| 1220|Homo sapiens IF2 protein protein.
          Length = 1220

 Score = 34.7 bits (76), Expect = 0.52
 Identities = 23/77 (29%), Positives = 34/77 (44%), Gaps = 3/77 (3%)
 Frame = +2

Query: 710 QTPPLQEPAINETTRRTPKDD---LSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRR 880
           +TPP  EP   E T     DD   +++D ET  VE   V   + + P+E  E  EE    
Sbjct: 485 ETPPPVEPEEEEDTEDAGLDDWEAMASDEETEKVEGNTVHIEVKENPEEEEEEEEEEEED 544

Query: 881 ESNFNQVRRSSRAVGAE 931
           E +  +      + G+E
Sbjct: 545 EESEEEEEEEGESEGSE 561


>AB018284-1|BAA34461.2| 1222|Homo sapiens KIAA0741 protein protein.
          Length = 1222

 Score = 34.7 bits (76), Expect = 0.52
 Identities = 23/77 (29%), Positives = 34/77 (44%), Gaps = 3/77 (3%)
 Frame = +2

Query: 710 QTPPLQEPAINETTRRTPKDD---LSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRR 880
           +TPP  EP   E T     DD   +++D ET  VE   V   + + P+E  E  EE    
Sbjct: 487 ETPPPVEPEEEEDTEDAGLDDWEAMASDEETEKVEGNKVHIEVKENPEEEEEEEEEEEED 546

Query: 881 ESNFNQVRRSSRAVGAE 931
           E +  +      + G+E
Sbjct: 547 EESEEEEEEEGESEGSE 563


>AF180425-1|AAD55098.1| 1233|Homo sapiens retinoblastoma-associated
           protein RAP140 protein.
          Length = 1233

 Score = 33.9 bits (74), Expect = 0.92
 Identities = 30/113 (26%), Positives = 48/113 (42%), Gaps = 8/113 (7%)
 Frame = +2

Query: 608 SAETPSDSLDSNAE-----ALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDD 772
           +A +P D L  + E      L+ +  +D+LT    E  V     + PA++ETT RT   +
Sbjct: 528 NARSPEDQLGKHGEKQTPDTLKGTTEDDVLTGQVEEQCVPAAEAEPPAVSETTERTVLGE 587

Query: 773 ---LSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAV 922
               S  IE +L +           P   + +T+E  +R S F   + S   V
Sbjct: 588 YNLFSRKIEEILKQKNVSYVSRVSTP---IFSTQEKMKRLSEFIYSKTSKAGV 637


>AF078035-1|AAD16006.1| 1220|Homo sapiens translation initiation
           factor IF2 protein.
          Length = 1220

 Score = 33.5 bits (73), Expect = 1.2
 Identities = 23/77 (29%), Positives = 34/77 (44%), Gaps = 3/77 (3%)
 Frame = +2

Query: 710 QTPPLQEPAINETTRRTPKDD---LSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRR 880
           +TPP  EP   E T     DD   +++D ET  VE   V   + + P+E  E  EE    
Sbjct: 485 ETPPPVEPEEEEDTEDAGLDDWEAMASDEETEKVEGNTVHIEVKENPEEEEEEEEEEEED 544

Query: 881 ESNFNQVRRSSRAVGAE 931
           E +  +      + G+E
Sbjct: 545 EESEVEEEEEGESEGSE 561


>Z99572-10|CAB16748.1| 2224|Homo sapiens coagulation factor V
            (proaccelerin, labile factor) protein.
          Length = 2224

 Score = 33.1 bits (72), Expect = 1.6
 Identities = 23/87 (26%), Positives = 39/87 (44%)
 Frame = +2

Query: 611  AETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIE 790
            A  P  + +S+ +  QAS    +  T+P E   QT P+Q+P    +T        S ++ 
Sbjct: 1095 ASLPDHNQNSSNDTGQASCPPGLYQTVPPEEHYQTFPIQDPDQMHSTSDPSHRSSSPELS 1154

Query: 791  TLLVEIRDVQTRLTDLPDESLEATEEV 871
             +L   R  ++  TD+   S  +  EV
Sbjct: 1155 EMLEYDRSHKSFPTDISQMSPSSEHEV 1181


>Z99572-9|CAI23065.1| 2229|Homo sapiens coagulation factor V
            (proaccelerin, labile factor) protein.
          Length = 2229

 Score = 33.1 bits (72), Expect = 1.6
 Identities = 23/87 (26%), Positives = 39/87 (44%)
 Frame = +2

Query: 611  AETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIE 790
            A  P  + +S+ +  QAS    +  T+P E   QT P+Q+P    +T        S ++ 
Sbjct: 1100 ASLPDHNQNSSNDTGQASCPPGLYQTVPPEEHYQTFPIQDPDQMHSTSDPSHRSSSPELS 1159

Query: 791  TLLVEIRDVQTRLTDLPDESLEATEEV 871
             +L   R  ++  TD+   S  +  EV
Sbjct: 1160 EMLEYDRSHKSFPTDISQMSPSSEHEV 1186


>M85165-1|AAA03631.1|  431|Homo sapiens SAP-1A protein protein.
          Length = 431

 Score = 33.1 bits (72), Expect = 1.6
 Identities = 31/104 (29%), Positives = 54/104 (51%), Gaps = 4/104 (3%)
 Frame = +2

Query: 662 SATEDILTTLPTEPVVQT-PPLQEPAINETTRRTPKDDLSN--DIETLLVEIRDVQTRLT 832
           ++  +++T   T P + + PPLQEP       RTP   LS+  DI+T   +I  V ++  
Sbjct: 240 TSASNVMTAFATTPPISSIPPLQEPP------RTPSPPLSSHPDIDT---DIDSVASQPM 290

Query: 833 DLPDE-SLEATEEVSRRESNFNQVRRSSRAVGAEDHGVPPEVEV 961
           +LP+  SLE  ++ S      ++V  SSR+   +  G+ P + +
Sbjct: 291 ELPENLSLEPKDQDSVLLEK-DKVNNSSRSKKPKGLGLAPTLVI 333


>M85164-1|AAA03632.1|  405|Homo sapiens SAP-1B protein protein.
          Length = 405

 Score = 33.1 bits (72), Expect = 1.6
 Identities = 30/96 (31%), Positives = 48/96 (50%), Gaps = 6/96 (6%)
 Frame = +2

Query: 662 SATEDILTTLPTEPVVQT-PPLQEPAINETTRRTPKDDLSN--DIETLLVEIRDVQTRLT 832
           ++  +++T   T P + + PPLQEP       RTP   LS+  DI+T   +I  V ++  
Sbjct: 240 TSASNVMTAFATTPPISSIPPLQEPP------RTPSPPLSSHPDIDT---DIDSVASQPM 290

Query: 833 DLPDE-SLEATEE--VSRRESNFNQVRRSSRAVGAE 931
           +LP+  SLE  ++  V   +   N   RS +  G E
Sbjct: 291 ELPENLSLEPKDQDSVLLEKDKVNNSSRSKKPKGLE 326


>M16967-1|AAA52424.1| 2224|Homo sapiens F5 protein.
          Length = 2224

 Score = 33.1 bits (72), Expect = 1.6
 Identities = 23/87 (26%), Positives = 39/87 (44%)
 Frame = +2

Query: 611  AETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIE 790
            A  P  + +S+ +  QAS    +  T+P E   QT P+Q+P    +T        S ++ 
Sbjct: 1095 ASLPDHNQNSSNDTGQASCPPGLYQTVPPEEHYQTFPIQDPDQMHSTSDPSHRSSSPELS 1154

Query: 791  TLLVEIRDVQTRLTDLPDESLEATEEV 871
             +L   R  ++  TD+   S  +  EV
Sbjct: 1155 EMLEYDRSHKSFPTDISQMSPSSEHEV 1181


>M14335-1|AAB59532.1| 2224|Homo sapiens F5 protein.
          Length = 2224

 Score = 33.1 bits (72), Expect = 1.6
 Identities = 23/87 (26%), Positives = 39/87 (44%)
 Frame = +2

Query: 611  AETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIE 790
            A  P  + +S+ +  QAS    +  T+P E   QT P+Q+P    +T        S ++ 
Sbjct: 1095 ASLPDHNQNSSNDTGQASCPPGLYQTVPPEEHYQTFPIQDPDQMHSTSDPSHRSSSPELS 1154

Query: 791  TLLVEIRDVQTRLTDLPDESLEATEEV 871
             +L   R  ++  TD+   S  +  EV
Sbjct: 1155 EMLEYDRSHKSFPTDISQMSPSSEHEV 1181


>L32779-1|AAB59401.1| 2224|Homo sapiens coagulation factor V protein.
          Length = 2224

 Score = 33.1 bits (72), Expect = 1.6
 Identities = 23/87 (26%), Positives = 39/87 (44%)
 Frame = +2

Query: 611  AETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIE 790
            A  P  + +S+ +  QAS    +  T+P E   QT P+Q+P    +T        S ++ 
Sbjct: 1095 ASLPDHNQNSSNDTGQASCPPGLYQTVPPEEHYQTFPIQDPDQMHSTSDPSHRSSSPELS 1154

Query: 791  TLLVEIRDVQTRLTDLPDESLEATEEV 871
             +L   R  ++  TD+   S  +  EV
Sbjct: 1155 EMLEYDRSHKSFPTDISQMSPSSEHEV 1181


>DQ377944-1|ABD23003.1|  939|Homo sapiens coagulation factor V
           protein.
          Length = 939

 Score = 33.1 bits (72), Expect = 1.6
 Identities = 23/87 (26%), Positives = 39/87 (44%)
 Frame = +2

Query: 611 AETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIE 790
           A  P  + +S+ +  QAS    +  T+P E   QT P+Q+P    +T        S ++ 
Sbjct: 436 ASLPDHNQNSSNDTGQASCPPGLYQTVPPEEHYQTFPIQDPDQMHSTSDPSHRSSSPELS 495

Query: 791 TLLVEIRDVQTRLTDLPDESLEATEEV 871
            +L   R  ++  TD+   S  +  EV
Sbjct: 496 EMLEYDRSHKSFPTDISQMSPSSEHEV 522


>BC063676-1|AAH63676.1|  405|Homo sapiens ELK4, ETS-domain protein
           (SRF accessory protein 1) protein.
          Length = 405

 Score = 33.1 bits (72), Expect = 1.6
 Identities = 30/96 (31%), Positives = 48/96 (50%), Gaps = 6/96 (6%)
 Frame = +2

Query: 662 SATEDILTTLPTEPVVQT-PPLQEPAINETTRRTPKDDLSN--DIETLLVEIRDVQTRLT 832
           ++  +++T   T P + + PPLQEP       RTP   LS+  DI+T   +I  V ++  
Sbjct: 240 TSASNVMTAFATTPPISSIPPLQEPP------RTPSPPLSSHPDIDT---DIDSVASQPM 290

Query: 833 DLPDE-SLEATEE--VSRRESNFNQVRRSSRAVGAE 931
           +LP+  SLE  ++  V   +   N   RS +  G E
Sbjct: 291 ELPENLSLEPKDQDSVLLEKDKVNNSSRSKKPKGLE 326


>BC040145-1|AAH40145.1|  521|Homo sapiens ELK4, ETS-domain protein
           (SRF accessory protein 1) protein.
          Length = 521

 Score = 33.1 bits (72), Expect = 1.6
 Identities = 30/96 (31%), Positives = 48/96 (50%), Gaps = 6/96 (6%)
 Frame = +2

Query: 662 SATEDILTTLPTEPVVQT-PPLQEPAINETTRRTPKDDLSN--DIETLLVEIRDVQTRLT 832
           ++  +++T   T P + + PPLQEP       RTP   LS+  DI+T   +I  V ++  
Sbjct: 330 TSASNVMTAFATTPPISSIPPLQEPP------RTPSPPLSSHPDIDT---DIDSVASQPM 380

Query: 833 DLPDE-SLEATEE--VSRRESNFNQVRRSSRAVGAE 931
           +LP+  SLE  ++  V   +   N   RS +  G E
Sbjct: 381 ELPENLSLEPKDQDSVLLEKDKVNNSSRSKKPKGLE 416


>AY364535-1|AAQ55063.1| 2224|Homo sapiens coagulation factor V
            (proaccelerin, labile factor) protein.
          Length = 2224

 Score = 33.1 bits (72), Expect = 1.6
 Identities = 23/87 (26%), Positives = 39/87 (44%)
 Frame = +2

Query: 611  AETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIE 790
            A  P  + +S+ +  QAS    +  T+P E   QT P+Q+P    +T        S ++ 
Sbjct: 1095 ASLPDHNQNSSNDTGQASCPPGLYQTVPPEEHYQTFPIQDPDQMHSTSDPSHRSSSPELS 1154

Query: 791  TLLVEIRDVQTRLTDLPDESLEATEEV 871
             +L   R  ++  TD+   S  +  EV
Sbjct: 1155 EMLEYDRSHKSFPTDISQMSPSSEHEV 1181


>AJ297255-1|CAC82573.1|  939|Homo sapiens coagulation factor V
           jinjiang B domain protein.
          Length = 939

 Score = 33.1 bits (72), Expect = 1.6
 Identities = 23/87 (26%), Positives = 39/87 (44%)
 Frame = +2

Query: 611 AETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIE 790
           A  P  + +S+ +  QAS    +  T+P E   QT P+Q+P    +T        S ++ 
Sbjct: 436 ASLPDHNQNSSNDTGQASCPPGLYQTVPPEEHYQTFPIQDPDQMHSTSDPSHRSSSPELS 495

Query: 791 TLLVEIRDVQTRLTDLPDESLEATEEV 871
            +L   R  ++  TD+   S  +  EV
Sbjct: 496 EMLEYDRSHKSFPTDISQMSPSSEHEV 522


>U54628-1|AAC50670.1|  411|Homo sapiens pyruvate dehydrogenase
           kinase isoform 4 protein.
          Length = 411

 Score = 32.3 bits (70), Expect = 2.8
 Identities = 15/62 (24%), Positives = 31/62 (50%)
 Frame = +2

Query: 2   DDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINLKPDNFWINKY 181
           DD+K+       +I+   R   + P ++  + +      VDP+TN ++    D F++N+ 
Sbjct: 108 DDQKALSDFVDTLIKVRNRHHNVVPTMAQGIIEYKDACTVDPVTNQNLQYFLDRFYMNRI 167

Query: 182 AT 187
           +T
Sbjct: 168 ST 169


>U54617-1|AAC50669.1|  411|Homo sapiens pyruvate dehydrogenase
           kinase isoform 4 protein.
          Length = 411

 Score = 32.3 bits (70), Expect = 2.8
 Identities = 15/62 (24%), Positives = 31/62 (50%)
 Frame = +2

Query: 2   DDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINLKPDNFWINKY 181
           DD+K+       +I+   R   + P ++  + +      VDP+TN ++    D F++N+ 
Sbjct: 108 DDQKALSDFVDTLIKVRNRHHNVVPTMAQGIIEYKDACTVDPVTNQNLQYFLDRFYMNRI 167

Query: 182 AT 187
           +T
Sbjct: 168 ST 169


>BC040239-1|AAH40239.1|  411|Homo sapiens PDK4 protein protein.
          Length = 411

 Score = 32.3 bits (70), Expect = 2.8
 Identities = 15/62 (24%), Positives = 31/62 (50%)
 Frame = +2

Query: 2   DDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINLKPDNFWINKY 181
           DD+K+       +I+   R   + P ++  + +      VDP+TN ++    D F++N+ 
Sbjct: 108 DDQKALSDFVDTLIKVRNRHHNVVPTMAQGIIEYKDACTVDPVTNQNLQYFLDRFYMNRI 167

Query: 182 AT 187
           +T
Sbjct: 168 ST 169


>AK223328-1|BAD97048.1|  411|Homo sapiens pyruvate dehydrogenase
           kinase, isoenzyme 4 variant protein.
          Length = 411

 Score = 32.3 bits (70), Expect = 2.8
 Identities = 15/62 (24%), Positives = 31/62 (50%)
 Frame = +2

Query: 2   DDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINLKPDNFWINKY 181
           DD+K+       +I+   R   + P ++  + +      VDP+TN ++    D F++N+ 
Sbjct: 108 DDQKALSDFVDTLIKVRNRHHNVVPTMAQGIIEYKDACTVDPVTNQNLQYFLDRFYMNRI 167

Query: 182 AT 187
           +T
Sbjct: 168 ST 169


>AC002451-1|AAB67048.1|  411|Homo sapiens unknown protein.
          Length = 411

 Score = 32.3 bits (70), Expect = 2.8
 Identities = 15/62 (24%), Positives = 31/62 (50%)
 Frame = +2

Query: 2   DDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINLKPDNFWINKY 181
           DD+K+       +I+   R   + P ++  + +      VDP+TN ++    D F++N+ 
Sbjct: 108 DDQKALSDFVDTLIKVRNRHHNVVPTMAQGIIEYKDACTVDPVTNQNLQYFLDRFYMNRI 167

Query: 182 AT 187
           +T
Sbjct: 168 ST 169


>BC073884-1|AAH73884.1|  601|Homo sapiens TAF3 protein protein.
          Length = 601

 Score = 31.9 bits (69), Expect = 3.7
 Identities = 16/44 (36%), Positives = 21/44 (47%)
 Frame = +2

Query: 692 PTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQT 823
           P  P V T   Q P   ET  RTP   LS  I    ++++ +QT
Sbjct: 386 PKSPKVTTHIPQTPVRPETPNRTPSATLSEKISKETIQVKQIQT 429


>BC062352-1|AAH62352.1|  771|Homo sapiens TAF3 protein protein.
          Length = 771

 Score = 31.9 bits (69), Expect = 3.7
 Identities = 16/44 (36%), Positives = 21/44 (47%)
 Frame = +2

Query: 692 PTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQT 823
           P  P V T   Q P   ET  RTP   LS  I    ++++ +QT
Sbjct: 378 PKSPKVTTHIPQTPVRPETPNRTPSATLSEKISKETIQVKQIQT 421


>BC045106-1|AAH45106.1|  539|Homo sapiens TAF3 protein protein.
          Length = 539

 Score = 31.9 bits (69), Expect = 3.7
 Identities = 16/44 (36%), Positives = 21/44 (47%)
 Frame = +2

Query: 692 PTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQT 823
           P  P V T   Q P   ET  RTP   LS  I    ++++ +QT
Sbjct: 321 PKSPKVTTHIPQTPVRPETPNRTPSATLSEKISKETIQVKQIQT 364


>BC017320-1|AAH17320.1|  539|Homo sapiens Unknown (protein for
           IMAGE:3547166) protein.
          Length = 539

 Score = 31.9 bits (69), Expect = 3.7
 Identities = 16/44 (36%), Positives = 21/44 (47%)
 Frame = +2

Query: 692 PTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQT 823
           P  P V T   Q P   ET  RTP   LS  I    ++++ +QT
Sbjct: 321 PKSPKVTTHIPQTPVRPETPNRTPSATLSEKISKETIQVKQIQT 364


>AL390294-1|CAH73142.1|  929|Homo sapiens TAF3 RNA polymerase II,
           TATA box binding protein (TBP)-associated factor, 140kD
           protein.
          Length = 929

 Score = 31.9 bits (69), Expect = 3.7
 Identities = 16/44 (36%), Positives = 21/44 (47%)
 Frame = +2

Query: 692 PTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQT 823
           P  P V T   Q P   ET  RTP   LS  I    ++++ +QT
Sbjct: 321 PKSPKVTTHIPQTPVRPETPNRTPSATLSEKISKETIQVKQIQT 364


>AL353754-1|CAH73451.1|  929|Homo sapiens TAF3 RNA polymerase II,
           TATA box binding protein (TBP)-associated factor, 140kD
           protein.
          Length = 929

 Score = 31.9 bits (69), Expect = 3.7
 Identities = 16/44 (36%), Positives = 21/44 (47%)
 Frame = +2

Query: 692 PTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQT 823
           P  P V T   Q P   ET  RTP   LS  I    ++++ +QT
Sbjct: 321 PKSPKVTTHIPQTPVRPETPNRTPSATLSEKISKETIQVKQIQT 364


>AL159172-1|CAI15661.1|  929|Homo sapiens TAF3 RNA polymerase II,
           TATA box binding protein (TBP)-associated factor, 140kD
           protein.
          Length = 929

 Score = 31.9 bits (69), Expect = 3.7
 Identities = 16/44 (36%), Positives = 21/44 (47%)
 Frame = +2

Query: 692 PTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQT 823
           P  P V T   Q P   ET  RTP   LS  I    ++++ +QT
Sbjct: 321 PKSPKVTTHIPQTPVRPETPNRTPSATLSEKISKETIQVKQIQT 364


>AL117661-1|CAB56032.1|  681|Homo sapiens hypothetical protein
           protein.
          Length = 681

 Score = 31.9 bits (69), Expect = 3.7
 Identities = 16/44 (36%), Positives = 21/44 (47%)
 Frame = +2

Query: 692 PTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQT 823
           P  P V T   Q P   ET  RTP   LS  I    ++++ +QT
Sbjct: 299 PKSPKVTTHIPQTPVRPETPNRTPSATLSEKISKETIQVKQIQT 342


>AJ292190-1|CAC34475.1|  727|Homo sapiens TAFII140 protein protein.
          Length = 727

 Score = 31.9 bits (69), Expect = 3.7
 Identities = 16/44 (36%), Positives = 21/44 (47%)
 Frame = +2

Query: 692 PTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQT 823
           P  P V T   Q P   ET  RTP   LS  I    ++++ +QT
Sbjct: 321 PKSPKVTTHIPQTPVRPETPNRTPSATLSEKISKETIQVKQIQT 364


>U77327-1|AAC31117.1|  299|Homo sapiens Ki-1/57 intracellular
           antigen protein.
          Length = 299

 Score = 31.5 bits (68), Expect = 4.9
 Identities = 19/76 (25%), Positives = 40/76 (52%)
 Frame = +2

Query: 695 TEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVS 874
           T  V  T P++EP + E ++ TP+++    +  L VE    +T++ ++  +  +  +E +
Sbjct: 133 TSDVEPTAPMEEPTVVEESQGTPEEESPAKVPELEVE---EETQVQEMTLDEWKNLQEQT 189

Query: 875 RRESNFNQVRRSSRAV 922
           R +  FN +R+    V
Sbjct: 190 RPKPEFN-IRKPESTV 204


>BC131515-1|AAI31516.1|  632|Homo sapiens GOLGA6 protein protein.
          Length = 632

 Score = 31.5 bits (68), Expect = 4.9
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +2

Query: 800 VEIRDVQTRLTDLPDESLEATEEVSRRESNFNQ 898
           +E R+  +   DLP E  + TE+V RRE  F Q
Sbjct: 525 LESREATSSFMDLPKEKADGTEQVERRELGFVQ 557


>BC129987-1|AAI29988.1| 1116|Homo sapiens C3orf63 protein protein.
          Length = 1116

 Score = 31.5 bits (68), Expect = 4.9
 Identities = 25/95 (26%), Positives = 41/95 (43%), Gaps = 3/95 (3%)
 Frame = +2

Query: 647 EALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDD---LSNDIETLLVEIRDV 817
           + L+ +  +D+LT    E  V     + PA++ETT RT   +    S  IE +L +    
Sbjct: 587 DTLKGTTEDDVLTGQVEEQCVPAAEAEPPAVSETTERTVLGEYNLFSRKIEEILKQKNVS 646

Query: 818 QTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAV 922
                  P   + +T+E  +R S F   + S   V
Sbjct: 647 YVSTVSTP---IFSTQEKMKRLSEFIYSKTSKAGV 678


>AL133477-4|CAI39620.1|  413|Homo sapiens hyaluronan binding protein
           4 protein.
          Length = 413

 Score = 31.5 bits (68), Expect = 4.9
 Identities = 19/76 (25%), Positives = 40/76 (52%)
 Frame = +2

Query: 695 TEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVS 874
           T  V  T P++EP + E ++ TP+++    +  L VE    +T++ ++  +  +  +E +
Sbjct: 247 TSDVEPTAPMEEPTVVEESQGTPEEESPAKVPELEVE---EETQVQEMTLDEWKNLQEQT 303

Query: 875 RRESNFNQVRRSSRAV 922
           R +  FN +R+    V
Sbjct: 304 RPKPEFN-IRKPESTV 318


>AF271379-1|AAG49889.1| 1241|Homo sapiens interphotoreceptor matrix
           proteoglycan 200 protein.
          Length = 1241

 Score = 31.5 bits (68), Expect = 4.9
 Identities = 18/46 (39%), Positives = 23/46 (50%)
 Frame = +2

Query: 584 WKDHSSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPP 721
           W   SS L A TPS  LD+  +A   SA E I +++P       PP
Sbjct: 398 WNTQSSSLQA-TPSSILDNTFQAAWPSADESITSSIPPLDFSSGPP 442


>AF266285-1|AAF72535.1|  693|Homo sapiens golgin-like protein
           protein.
          Length = 693

 Score = 31.5 bits (68), Expect = 4.9
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +2

Query: 800 VEIRDVQTRLTDLPDESLEATEEVSRRESNFNQ 898
           +E R+  +   DLP E  + TE+V RRE  F Q
Sbjct: 525 LESREATSSFMDLPKEKADGTEQVERRELGFVQ 557


>AF263742-1|AAF72196.1|  693|Homo sapiens golgin-like protein
           protein.
          Length = 693

 Score = 31.5 bits (68), Expect = 4.9
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +2

Query: 800 VEIRDVQTRLTDLPDESLEATEEVSRRESNFNQ 898
           +E R+  +   DLP E  + TE+V RRE  F Q
Sbjct: 525 LESREATSSFMDLPKEKADGTEQVERRELGFVQ 557


>AF241831-1|AAF62546.1|  413|Homo sapiens intracellular
           hyaluronan-binding protein protein.
          Length = 413

 Score = 31.5 bits (68), Expect = 4.9
 Identities = 19/76 (25%), Positives = 40/76 (52%)
 Frame = +2

Query: 695 TEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVS 874
           T  V  T P++EP + E ++ TP+++    +  L VE    +T++ ++  +  +  +E +
Sbjct: 247 TSDVEPTAPMEEPTVVEESQGTPEEESPAKVPELEVE---EETQVQEMTLDEWKNLQEQT 303

Query: 875 RRESNFNQVRRSSRAV 922
           R +  FN +R+    V
Sbjct: 304 RPKPEFN-IRKPESTV 318


>AF173155-1|AAF06999.1| 1241|Homo sapiens interphotoreceptor matrix
           proteoglycan 200 protein.
          Length = 1241

 Score = 31.5 bits (68), Expect = 4.9
 Identities = 18/46 (39%), Positives = 23/46 (50%)
 Frame = +2

Query: 584 WKDHSSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPP 721
           W   SS L A TPS  LD+  +A   SA E I +++P       PP
Sbjct: 398 WNTQSSSLQA-TPSSILDNTFQAAWPSADESITSSIPPLDFSSGPP 442


>AF157624-1|AAF13154.1| 1241|Homo sapiens Spacrcan protein.
          Length = 1241

 Score = 31.5 bits (68), Expect = 4.9
 Identities = 18/46 (39%), Positives = 23/46 (50%)
 Frame = +2

Query: 584 WKDHSSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPP 721
           W   SS L A TPS  LD+  +A   SA E I +++P       PP
Sbjct: 398 WNTQSSSLQA-TPSSILDNTFQAAWPSADESITSSIPPLDFSSGPP 442


>AY359091-1|AAQ89449.1|  499|Homo sapiens AAAP6077 protein.
          Length = 499

 Score = 31.1 bits (67), Expect = 6.5
 Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 1/63 (1%)
 Frame = +2

Query: 182 ATDDAEXXXXXXXXXXESTPPIVKQNQPKEKPIDLNLKTDVKVDIENIRN-DNKFWVEKH 358
           A  D+E          E  P + K+ +P+ +P++ N +    V  EN  +   +F  +KH
Sbjct: 149 AATDSEKAVEKTLQDMEKNPELSKEREPEPEPVEANSEESDSVFSENTEDLQEQFTTQKH 208

Query: 359 LYH 367
             H
Sbjct: 209 HSH 211


>AL592148-8|CAI40470.1|  500|Homo sapiens C219-reactive peptide
           (FLJ39207) protein.
          Length = 500

 Score = 31.1 bits (67), Expect = 6.5
 Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 1/63 (1%)
 Frame = +2

Query: 182 ATDDAEXXXXXXXXXXESTPPIVKQNQPKEKPIDLNLKTDVKVDIENIRN-DNKFWVEKH 358
           A  D+E          E  P + K+ +P+ +P++ N +    V  EN  +   +F  +KH
Sbjct: 150 AATDSEKAVEKTLQDMEKNPELSKEREPEPEPVEANSEESDSVFSENTEDLQEQFTTQKH 209

Query: 359 LYH 367
             H
Sbjct: 210 HSH 212


>AL592148-7|CAI40469.1| 1907|Homo sapiens C219-reactive peptide
           (FLJ39207) protein.
          Length = 1907

 Score = 31.1 bits (67), Expect = 6.5
 Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 1/63 (1%)
 Frame = +2

Query: 182 ATDDAEXXXXXXXXXXESTPPIVKQNQPKEKPIDLNLKTDVKVDIENIRN-DNKFWVEKH 358
           A  D+E          E  P + K+ +P+ +P++ N +    V  EN  +   +F  +KH
Sbjct: 150 AATDSEKAVEKTLQDMEKNPELSKEREPEPEPVEANSEESDSVFSENTEDLQEQFTTQKH 209

Query: 359 LYH 367
             H
Sbjct: 210 HSH 212


>AF273053-1|AAG34913.1| 1035|Homo sapiens CTCL tumor antigen se89-1
           protein.
          Length = 1035

 Score = 31.1 bits (67), Expect = 6.5
 Identities = 25/95 (26%), Positives = 41/95 (43%), Gaps = 3/95 (3%)
 Frame = +2

Query: 647 EALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDD---LSNDIETLLVEIRDV 817
           + L+ +  +D+LT    E  V     + PA++ETT RT   +    S  IE +L +    
Sbjct: 348 DTLKGTTEDDVLTGQVEEQCVPAAEAEPPAVSETTERTVLGEYNLFSRKIEEILKQKNVS 407

Query: 818 QTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAV 922
                  P   + +T+E  +R S F   + S   V
Sbjct: 408 YVSRVSTP---IFSTQEKMKRLSEFIYSKTSKAGV 439


>AB029028-1|BAA83057.1|  730|Homo sapiens KIAA1105 protein protein.
          Length = 730

 Score = 31.1 bits (67), Expect = 6.5
 Identities = 25/95 (26%), Positives = 41/95 (43%), Gaps = 3/95 (3%)
 Frame = +2

Query: 647 EALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDD---LSNDIETLLVEIRDV 817
           + L+ +  +D+LT    E  V     + PA++ETT RT   +    S  IE +L +    
Sbjct: 43  DTLKGTTEDDVLTGQVEEQCVPAAEAEPPAVSETTERTVLGEYNLFSRKIEEILKQKNVS 102

Query: 818 QTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAV 922
                  P   + +T+E  +R S F   + S   V
Sbjct: 103 YVSRVSTP---IFSTQEKMKRLSEFIYSKTSKAGV 134


>M77830-1|AAA85135.1| 2871|Homo sapiens desmoplakin I protein.
          Length = 2871

 Score = 30.7 bits (66), Expect = 8.5
 Identities = 19/72 (26%), Positives = 37/72 (51%)
 Frame = +2

Query: 770  DLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVGAEDHGVPP 949
            +L N ++ L  E RD++  +  L D  L+ATE+  R E N  Q +     +  +   +  
Sbjct: 1234 NLRNQLDRLSRENRDLKDEIVRLNDSILQATEQRRRAEENALQQKACGSEIMQKKQHL-- 1291

Query: 950  EVEVQTLIKNSS 985
            E+E++ +++  S
Sbjct: 1292 EIELKQVMQQRS 1303


>J05211-1|AAA35766.1| 1752|Homo sapiens protein ( Human desmoplakin
           mRNA, 3' end. ).
          Length = 1752

 Score = 30.7 bits (66), Expect = 8.5
 Identities = 19/72 (26%), Positives = 37/72 (51%)
 Frame = +2

Query: 770 DLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVGAEDHGVPP 949
           +L N ++ L  E RD++  +  L D  L+ATE+  R E N  Q +     +  +   +  
Sbjct: 115 NLRNQLDRLSRENRDLKDEIVRLNDSILQATEQRRRAEENALQQKACGSEIMQKKQHL-- 172

Query: 950 EVEVQTLIKNSS 985
           E+E++ +++  S
Sbjct: 173 EIELKQVMQQRS 184


>BC150548-1|AAI50549.1|  206|Homo sapiens Unknown (protein for
           IMAGE:40127411) protein.
          Length = 206

 Score = 30.7 bits (66), Expect = 8.5
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 4/67 (5%)
 Frame = -2

Query: 339 LLSLRMFSMSTFTSVFKLRSIGFSFGWFCFTIGG----VLSFLSFC*TNNNSASSVAYLF 172
           LL++ +F+ +  T  + L S    FG+   TIGG    +L+          S+++  Y+F
Sbjct: 51  LLTVSLFAFTFATEFWGLMSCSIFFGFMVGTIGGTHIPLLAEDDVVGIEKMSSAAGVYIF 110

Query: 171 IQKLSGL 151
           IQ ++GL
Sbjct: 111 IQSIAGL 117


>BC150547-1|AAI50548.1|  206|Homo sapiens Unknown (protein for
           IMAGE:40127410) protein.
          Length = 206

 Score = 30.7 bits (66), Expect = 8.5
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 4/67 (5%)
 Frame = -2

Query: 339 LLSLRMFSMSTFTSVFKLRSIGFSFGWFCFTIGG----VLSFLSFC*TNNNSASSVAYLF 172
           LL++ +F+ +  T  + L S    FG+   TIGG    +L+          S+++  Y+F
Sbjct: 51  LLTVSLFAFTFATEFWGLMSCSIFFGFMVGTIGGTHIPLLAEDDVVGIEKMSSAAGVYIF 110

Query: 171 IQKLSGL 151
           IQ ++GL
Sbjct: 111 IQSIAGL 117


>BC141962-1|AAI41963.1|  206|Homo sapiens SLC16A6 protein protein.
          Length = 206

 Score = 30.7 bits (66), Expect = 8.5
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 4/67 (5%)
 Frame = -2

Query: 339 LLSLRMFSMSTFTSVFKLRSIGFSFGWFCFTIGG----VLSFLSFC*TNNNSASSVAYLF 172
           LL++ +F+ +  T  + L S    FG+   TIGG    +L+          S+++  Y+F
Sbjct: 51  LLTVSLFAFTFATEFWGLMSCSIFFGFMVGTIGGTHIPLLAEDDVVGIEKMSSAAGVYIF 110

Query: 171 IQKLSGL 151
           IQ ++GL
Sbjct: 111 IQSIAGL 117


>BC127750-1|AAI27751.1|  205|Homo sapiens SLC16A6 protein protein.
          Length = 205

 Score = 30.7 bits (66), Expect = 8.5
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 4/67 (5%)
 Frame = -2

Query: 339 LLSLRMFSMSTFTSVFKLRSIGFSFGWFCFTIGG----VLSFLSFC*TNNNSASSVAYLF 172
           LL++ +F+ +  T  + L S    FG+   TIGG    +L+          S+++  Y+F
Sbjct: 50  LLTVSLFAFTFATEFWGLMSCSIFFGFMVGTIGGTHIPLLAEDDVVGIEKMSSAAGVYIF 109

Query: 171 IQKLSGL 151
           IQ ++GL
Sbjct: 110 IQSIAGL 116


>BC127749-1|AAI27750.1|  206|Homo sapiens SLC16A6 protein protein.
          Length = 206

 Score = 30.7 bits (66), Expect = 8.5
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 4/67 (5%)
 Frame = -2

Query: 339 LLSLRMFSMSTFTSVFKLRSIGFSFGWFCFTIGG----VLSFLSFC*TNNNSASSVAYLF 172
           LL++ +F+ +  T  + L S    FG+   TIGG    +L+          S+++  Y+F
Sbjct: 51  LLTVSLFAFTFATEFWGLMSCSIFFGFMVGTIGGTHIPLLAEDDVVGIEKMSSAAGVYIF 110

Query: 171 IQKLSGL 151
           IQ ++GL
Sbjct: 111 IQSIAGL 117


>BC064832-1|AAH64832.1|  523|Homo sapiens solute carrier family 16,
           member 6 (monocarboxylic acid transporter 7) protein.
          Length = 523

 Score = 30.7 bits (66), Expect = 8.5
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 4/67 (5%)
 Frame = -2

Query: 339 LLSLRMFSMSTFTSVFKLRSIGFSFGWFCFTIGG----VLSFLSFC*TNNNSASSVAYLF 172
           LL++ +F+ +  T  + L S    FG+   TIGG    +L+          S+++  Y+F
Sbjct: 368 LLTVSLFAFTFATEFWGLMSCSIFFGFMVGTIGGTHIPLLAEDDVVGIEKMSSAAGVYIF 427

Query: 171 IQKLSGL 151
           IQ ++GL
Sbjct: 428 IQSIAGL 434


>AL031058-1|CAA19927.1| 2871|Homo sapiens desmoplakin protein.
          Length = 2871

 Score = 30.7 bits (66), Expect = 8.5
 Identities = 19/72 (26%), Positives = 37/72 (51%)
 Frame = +2

Query: 770  DLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVGAEDHGVPP 949
            +L N ++ L  E RD++  +  L D  L+ATE+  R E N  Q +     +  +   +  
Sbjct: 1234 NLRNQLDRLSRENRDLKDEIVRLNDSILQATEQRRRAEENALQQKACGSEIMQKKQHL-- 1291

Query: 950  EVEVQTLIKNSS 985
            E+E++ +++  S
Sbjct: 1292 EIELKQVMQQRS 1303


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 120,963,231
Number of Sequences: 237096
Number of extensions: 2313583
Number of successful extensions: 10993
Number of sequences better than 10.0: 57
Number of HSP's better than 10.0 without gapping: 10254
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10987
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 13158340014
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).