SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0015
         (721 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

D88153-1|BAA21667.1|  340|Homo sapiens HYA22 protein.                 198   2e-50
AY364238-1|AAQ76797.1|  265|Homo sapiens HYA22 protein.               198   2e-50
AY279532-1|AAP34400.1|  265|Homo sapiens small CTD phosphatase 3...   198   2e-50
AY279530-1|AAP34398.1|  213|Homo sapiens small CTD phosphatase 1...   198   2e-50
AJ575645-1|CAE11805.1|  276|Homo sapiens RB serine phosphatase p...   198   2e-50
AJ575644-1|CAE11804.1|  265|Homo sapiens RB serine phosphatase p...   198   2e-50
BC012977-1|AAH12977.1|  261|Homo sapiens CTD (carboxy-terminal d...   197   3e-50
AY279529-1|AAP34397.1|  260|Homo sapiens small CTD phosphatase 1...   197   3e-50
AF229163-3|AAG15404.1|  261|Homo sapiens nuclear LIM interactor-...   197   3e-50
AF229162-1|AAG15402.1|  261|Homo sapiens nuclear LIM interactor-...   197   3e-50
BC065920-1|AAH65920.1|  271|Homo sapiens CTD (carboxy-terminal d...   184   3e-46
AY279531-1|AAP34399.1|  283|Homo sapiens small CTD phosphatase 2...   184   3e-46
AF022231-1|AAD09331.1|  271|Homo sapiens unknown protein protein.     184   3e-46
AF000152-1|AAB71816.1|  283|Homo sapiens OS-4 protein protein.        184   3e-46
AY364237-1|AAQ76796.1|  466|Homo sapiens hypothetical protein pr...    99   1e-20
AK001385-1|BAA91664.1|  286|Homo sapiens protein ( Homo sapiens ...    99   1e-20
DQ128104-1|AAZ42188.1|  466|Homo sapiens unknown protein.              99   2e-20
BC035744-1|AAH35744.1|  466|Homo sapiens CTDSPL2 protein protein.      99   2e-20
BC009295-1|AAH09295.1|  244|Homo sapiens dullard homolog (Xenopu...    77   6e-14
AY364239-1|AAQ76798.1|  244|Homo sapiens DULLARD protein.              77   6e-14
AJ011916-1|CAA09865.1|  244|Homo sapiens hypothetical protein pr...    77   6e-14
BC121147-1|AAI21148.1|  456|Homo sapiens translocase of inner mi...    48   4e-05
BC121146-1|AAI21147.1|  240|Homo sapiens TIMM50 protein protein.       48   4e-05
BC050082-1|AAH50082.1|  359|Homo sapiens TIMM50 protein protein.       48   4e-05
BC010736-1|AAH10736.1|  351|Homo sapiens TIMM50 protein protein.       48   4e-05
BC009072-1|AAH09072.1|  344|Homo sapiens TIMM50 protein protein.       48   4e-05
AY551341-1|AAT01208.1|  353|Homo sapiens translocase of inner mi...    48   4e-05
AY444561-1|AAS68537.1|  240|Homo sapiens TIM50L protein.               48   4e-05
BC063447-1|AAH63447.1|  867|Homo sapiens CTD (carboxy-terminal d...    43   0.001
BC052576-1|AAH52576.1|  874|Homo sapiens CTDP1 protein protein.        43   0.001
AF154115-1|AAD42088.1|  961|Homo sapiens RNA polymerase II CTD p...    43   0.001
AF081287-1|AAC64549.1|  842|Homo sapiens serine phosphatase FCP1...    43   0.001
X98893-1|CAA67398.1|  589|Homo sapiens hTAFII68 protein.               30   7.3  
U51334-1|AAC50932.1|  592|Homo sapiens putative RNA binding prot...    30   7.3  
BC046099-1|AAH46099.2|  592|Homo sapiens TAF15 RNA polymerase II...    30   7.3  
AY197697-1|AAO13485.1|  589|Homo sapiens TAF15 RNA polymerase II...    30   7.3  
AB010067-2|BAA33812.1|  589|Homo sapiens RBP56/hTAFII68 protein.       30   7.3  
AB010067-1|BAA33811.1|  592|Homo sapiens RBP56/hTAFII68 protein.       30   7.3  
U00968-1|AAC50051.2| 1147|Homo sapiens SREBP-1 protein.                30   9.6  
BC063281-1|AAH63281.1| 1177|Homo sapiens sterol regulatory eleme...    30   9.6  
BC057388-1|AAH57388.1| 1147|Homo sapiens sterol regulatory eleme...    30   9.6  
BC026962-1|AAH26962.1|  750|Homo sapiens Unknown (protein for IM...    30   9.6  
BC023621-1|AAH23621.1|  686|Homo sapiens SREBF1 protein protein.       30   9.6  
AL356755-3|CAI23466.1|  299|Homo sapiens GDNF family receptor al...    30   9.6  
AJ291674-1|CAC19691.1|  299|Homo sapiens putative GDNF family re...    30   9.6  
AF202445-2|AAF82685.1|  709|Homo sapiens dsRNA binding protein N...    30   9.6  
AB209609-1|BAD92846.1|  697|Homo sapiens sterol regulatory eleme...    30   9.6  

>D88153-1|BAA21667.1|  340|Homo sapiens HYA22 protein.
          Length = 340

 Score =  198 bits (483), Expect = 2e-50
 Identities = 90/106 (84%), Positives = 99/106 (93%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +VIDLDETLVHSSFKPI+NA F+VPVEIDG +HQVYVLKRPHVDEFL+R G+L+ CV
Sbjct: 170 KKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECV 229

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           LFTASLAKYADPVADLLDRWGVFRARLFR+SCVFHRGNYVKDL+ L
Sbjct: 230 LFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRL 275


>AY364238-1|AAQ76797.1|  265|Homo sapiens HYA22 protein.
          Length = 265

 Score =  198 bits (483), Expect = 2e-50
 Identities = 90/106 (84%), Positives = 99/106 (93%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +VIDLDETLVHSSFKPI+NA F+VPVEIDG +HQVYVLKRPHVDEFL+R G+L+ CV
Sbjct: 95  KKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECV 154

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           LFTASLAKYADPVADLLDRWGVFRARLFR+SCVFHRGNYVKDL+ L
Sbjct: 155 LFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRL 200


>AY279532-1|AAP34400.1|  265|Homo sapiens small CTD phosphatase 3
           protein.
          Length = 265

 Score =  198 bits (483), Expect = 2e-50
 Identities = 90/106 (84%), Positives = 99/106 (93%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +VIDLDETLVHSSFKPI+NA F+VPVEIDG +HQVYVLKRPHVDEFL+R G+L+ CV
Sbjct: 95  KKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECV 154

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           LFTASLAKYADPVADLLDRWGVFRARLFR+SCVFHRGNYVKDL+ L
Sbjct: 155 LFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRL 200


>AY279530-1|AAP34398.1|  213|Homo sapiens small CTD phosphatase 1
           splice variant protein.
          Length = 213

 Score =  198 bits (483), Expect = 2e-50
 Identities = 99/145 (68%), Positives = 111/145 (76%), Gaps = 6/145 (4%)
 Frame = +2

Query: 305 PIVSTAGLLRPC-W-----SCLNMPPDLCYRQ*DTRTCIKSVMVIDLDETLVHSSFKPIN 466
           P + TAG  RPC W     S    P      +   +   K  +VIDLDETLVHSSFKP+N
Sbjct: 5   PCLLTAG--RPCLWRRMAPSLRQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVN 62

Query: 467 NAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWG 646
           NA F++PVEIDG VHQVYVLKRPHVDEFL+R GEL+ CVLFTASLAKYADPVADLLD+WG
Sbjct: 63  NADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWG 122

Query: 647 VFRARLFRDSCVFHRGNYVKDLNSL 721
            FRARLFR+SCVFHRGNYVKDL+ L
Sbjct: 123 AFRARLFRESCVFHRGNYVKDLSRL 147


>AJ575645-1|CAE11805.1|  276|Homo sapiens RB serine phosphatase
           protein.
          Length = 276

 Score =  198 bits (483), Expect = 2e-50
 Identities = 90/106 (84%), Positives = 99/106 (93%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +VIDLDETLVHSSFKPI+NA F+VPVEIDG +HQVYVLKRPHVDEFL+R G+L+ CV
Sbjct: 106 KKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECV 165

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           LFTASLAKYADPVADLLDRWGVFRARLFR+SCVFHRGNYVKDL+ L
Sbjct: 166 LFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRL 211


>AJ575644-1|CAE11804.1|  265|Homo sapiens RB serine phosphatase
           protein.
          Length = 265

 Score =  198 bits (483), Expect = 2e-50
 Identities = 90/106 (84%), Positives = 99/106 (93%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +VIDLDETLVHSSFKPI+NA F+VPVEIDG +HQVYVLKRPHVDEFL+R G+L+ CV
Sbjct: 95  KKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECV 154

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           LFTASLAKYADPVADLLDRWGVFRARLFR+SCVFHRGNYVKDL+ L
Sbjct: 155 LFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRL 200


>BC012977-1|AAH12977.1|  261|Homo sapiens CTD (carboxy-terminal
           domain, RNA polymerase II, polypeptide A) small
           phosphata protein.
          Length = 261

 Score =  197 bits (481), Expect = 3e-50
 Identities = 89/106 (83%), Positives = 98/106 (92%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +VIDLDETLVHSSFKP+NNA F++PVEIDG VHQVYVLKRPHVDEFL+R GEL+ CV
Sbjct: 90  KICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECV 149

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           LFTASLAKYADPVADLLD+WG FRARLFR+SCVFHRGNYVKDL+ L
Sbjct: 150 LFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRL 195


>AY279529-1|AAP34397.1|  260|Homo sapiens small CTD phosphatase 1
           protein.
          Length = 260

 Score =  197 bits (481), Expect = 3e-50
 Identities = 89/106 (83%), Positives = 98/106 (92%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +VIDLDETLVHSSFKP+NNA F++PVEIDG VHQVYVLKRPHVDEFL+R GEL+ CV
Sbjct: 89  KICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECV 148

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           LFTASLAKYADPVADLLD+WG FRARLFR+SCVFHRGNYVKDL+ L
Sbjct: 149 LFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRL 194


>AF229163-3|AAG15404.1|  261|Homo sapiens nuclear LIM
           interactor-interacting factor protein.
          Length = 261

 Score =  197 bits (481), Expect = 3e-50
 Identities = 89/106 (83%), Positives = 98/106 (92%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +VIDLDETLVHSSFKP+NNA F++PVEIDG VHQVYVLKRPHVDEFL+R GEL+ CV
Sbjct: 90  KICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECV 149

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           LFTASLAKYADPVADLLD+WG FRARLFR+SCVFHRGNYVKDL+ L
Sbjct: 150 LFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRL 195


>AF229162-1|AAG15402.1|  261|Homo sapiens nuclear LIM
           interactor-interacting factor protein.
          Length = 261

 Score =  197 bits (481), Expect = 3e-50
 Identities = 89/106 (83%), Positives = 98/106 (92%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +VIDLDETLVHSSFKP+NNA F++PVEIDG VHQVYVLKRPHVDEFL+R GEL+ CV
Sbjct: 90  KICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECV 149

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           LFTASLAKYADPVADLLD+WG FRARLFR+SCVFHRGNYVKDL+ L
Sbjct: 150 LFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRL 195


>BC065920-1|AAH65920.1|  271|Homo sapiens CTD (carboxy-terminal
           domain, RNA polymerase II, polypeptide A) small
           phosphata protein.
          Length = 271

 Score =  184 bits (448), Expect = 3e-46
 Identities = 99/173 (57%), Positives = 118/173 (68%), Gaps = 3/173 (1%)
 Frame = +2

Query: 212 GRNLAGPAASCDRCCAVGAVAEARDLP--EAMAPIVSTAGLLRPCWSCLNMPPDLCYRQ* 385
           GRN+      C R   VG  + + +L   +  A  ++ + LL+         P  C    
Sbjct: 34  GRNIFKALFCCFRAQHVGQSSSSTELAAYKEEANTIAKSDLLQCLQYQFYQIPGTCLLPE 93

Query: 386 DTRTCIKSV-MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRC 562
            T      + +VIDLDETLVHSSFKPINNA F+VP+EI+G  HQVYVLKRP+VDEFLRR 
Sbjct: 94  VTEEDQGRICVVIDLDETLVHSSFKPINNADFIVPIEIEGTTHQVYVLKRPYVDEFLRRM 153

Query: 563 GELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           GEL+ CVLFTASLAKYADPV DLLDR GVFRARLFR+SCVFH+G YVKDL+ L
Sbjct: 154 GELFECVLFTASLAKYADPVTDLLDRCGVFRARLFRESCVFHQGCYVKDLSRL 206


>AY279531-1|AAP34399.1|  283|Homo sapiens small CTD phosphatase 2
           protein.
          Length = 283

 Score =  184 bits (448), Expect = 3e-46
 Identities = 99/173 (57%), Positives = 118/173 (68%), Gaps = 3/173 (1%)
 Frame = +2

Query: 212 GRNLAGPAASCDRCCAVGAVAEARDLP--EAMAPIVSTAGLLRPCWSCLNMPPDLCYRQ* 385
           GRN+      C R   VG  + + +L   +  A  ++ + LL+         P  C    
Sbjct: 34  GRNIFKALFCCFRAQHVGQSSSSTELAAYKEEANTIAKSDLLQCLQYQFYQIPGTCLLPE 93

Query: 386 DTRTCIKSV-MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRC 562
            T      + +VIDLDETLVHSSFKPINNA F+VP+EI+G  HQVYVLKRP+VDEFLRR 
Sbjct: 94  VTEEDQGRICVVIDLDETLVHSSFKPINNADFIVPIEIEGTTHQVYVLKRPYVDEFLRRM 153

Query: 563 GELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           GEL+ CVLFTASLAKYADPV DLLDR GVFRARLFR+SCVFH+G YVKDL+ L
Sbjct: 154 GELFECVLFTASLAKYADPVTDLLDRCGVFRARLFRESCVFHQGCYVKDLSRL 206


>AF022231-1|AAD09331.1|  271|Homo sapiens unknown protein protein.
          Length = 271

 Score =  184 bits (448), Expect = 3e-46
 Identities = 99/173 (57%), Positives = 118/173 (68%), Gaps = 3/173 (1%)
 Frame = +2

Query: 212 GRNLAGPAASCDRCCAVGAVAEARDLP--EAMAPIVSTAGLLRPCWSCLNMPPDLCYRQ* 385
           GRN+      C R   VG  + + +L   +  A  ++ + LL+         P  C    
Sbjct: 34  GRNIFKALFCCFRAQHVGQSSSSTELAAYKEEANTIAKSDLLQCLQYQFYQIPGTCLLPE 93

Query: 386 DTRTCIKSV-MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRC 562
            T      + +VIDLDETLVHSSFKPINNA F+VP+EI+G  HQVYVLKRP+VDEFLRR 
Sbjct: 94  VTEEDQGRICVVIDLDETLVHSSFKPINNADFIVPIEIEGTTHQVYVLKRPYVDEFLRRM 153

Query: 563 GELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           GEL+ CVLFTASLAKYADPV DLLDR GVFRARLFR+SCVFH+G YVKDL+ L
Sbjct: 154 GELFECVLFTASLAKYADPVTDLLDRCGVFRARLFRESCVFHQGCYVKDLSRL 206


>AF000152-1|AAB71816.1|  283|Homo sapiens OS-4 protein protein.
          Length = 283

 Score =  184 bits (448), Expect = 3e-46
 Identities = 99/173 (57%), Positives = 118/173 (68%), Gaps = 3/173 (1%)
 Frame = +2

Query: 212 GRNLAGPAASCDRCCAVGAVAEARDLP--EAMAPIVSTAGLLRPCWSCLNMPPDLCYRQ* 385
           GRN+      C R   VG  + + +L   +  A  ++ + LL+         P  C    
Sbjct: 34  GRNIFKALFCCFRAQHVGQSSSSTELAAYKEEANTIAKSDLLQCLQYQFYQIPGTCLLPE 93

Query: 386 DTRTCIKSV-MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRC 562
            T      + +VIDLDETLVHSSFKPINNA F+VP+EI+G  HQVYVLKRP+VDEFLRR 
Sbjct: 94  VTEEDQGRICVVIDLDETLVHSSFKPINNADFIVPIEIEGTTHQVYVLKRPYVDEFLRRM 153

Query: 563 GELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           GEL+ CVLFTASLAKYADPV DLLDR GVFRARLFR+SCVFH+G YVKDL+ L
Sbjct: 154 GELFECVLFTASLAKYADPVTDLLDRCGVFRARLFRESCVFHQGCYVKDLSRL 206


>AY364237-1|AAQ76796.1|  466|Homo sapiens hypothetical protein
           protein.
          Length = 466

 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 52/112 (46%), Positives = 70/112 (62%), Gaps = 1/112 (0%)
 Frame = +2

Query: 389 TRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGE 568
           TR+  +  +V+DLDETLVH S   + +A    PV     V+QVYV  RP   EFL R  +
Sbjct: 282 TRSTPEFSLVLDLDETLVHCSLNELEDAALTFPVLFQDVVYQVYVRLRPFFREFLERMSQ 341

Query: 569 LY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +Y  +LFTAS   YAD + ++LD +  + R RLFR+ CV  +GNY+KDLN L
Sbjct: 342 MYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIKDLNIL 393


>AK001385-1|BAA91664.1|  286|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10523 fis, clone NT2RP2000863. ).
          Length = 286

 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 52/112 (46%), Positives = 70/112 (62%), Gaps = 1/112 (0%)
 Frame = +2

Query: 389 TRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGE 568
           TR+  +  +V+DLDETLVH S   + +A    PV     V+QVYV  RP   EFL R  +
Sbjct: 102 TRSTPEFSLVLDLDETLVHCSLNELEDAALTFPVLFQDVVYQVYVRLRPFFREFLERMSQ 161

Query: 569 LY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +Y  +LFTAS   YAD + ++LD +  + R RLFR+ CV  +GNY+KDLN L
Sbjct: 162 MYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIKDLNIL 213


>DQ128104-1|AAZ42188.1|  466|Homo sapiens unknown protein.
          Length = 466

 Score = 98.7 bits (235), Expect = 2e-20
 Identities = 51/112 (45%), Positives = 70/112 (62%), Gaps = 1/112 (0%)
 Frame = +2

Query: 389 TRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGE 568
           TR+  +  +V+DLDETLVH S   + +A    PV     ++QVYV  RP   EFL R  +
Sbjct: 282 TRSTPEFSLVLDLDETLVHCSLNELEDAALTFPVLFQDVIYQVYVRLRPFFREFLERMSQ 341

Query: 569 LY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +Y  +LFTAS   YAD + ++LD +  + R RLFR+ CV  +GNY+KDLN L
Sbjct: 342 MYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIKDLNIL 393


>BC035744-1|AAH35744.1|  466|Homo sapiens CTDSPL2 protein protein.
          Length = 466

 Score = 98.7 bits (235), Expect = 2e-20
 Identities = 51/112 (45%), Positives = 70/112 (62%), Gaps = 1/112 (0%)
 Frame = +2

Query: 389 TRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGE 568
           TR+  +  +V+DLDETLVH S   + +A    PV     ++QVYV  RP   EFL R  +
Sbjct: 282 TRSTPEFSLVLDLDETLVHCSLNELEDAALTFPVLFQDVIYQVYVRLRPFFREFLERMSQ 341

Query: 569 LY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +Y  +LFTAS   YAD + ++LD +  + R RLFR+ CV  +GNY+KDLN L
Sbjct: 342 MYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIKDLNIL 393


>BC009295-1|AAH09295.1|  244|Homo sapiens dullard homolog (Xenopus
           laevis) protein.
          Length = 244

 Score = 77.0 bits (181), Expect = 6e-14
 Identities = 43/113 (38%), Positives = 63/113 (55%), Gaps = 9/113 (7%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHS--------SFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRR 559
           + ++V+DLDETL+HS        + +P     F++ V ID    + +V KRPHVD FL  
Sbjct: 61  RKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEV 120

Query: 560 CGELY*CVLFTASLAKYADPVADLLDR-WGVFRARLFRDSCVFHRGNYVKDLN 715
             + Y  V+FTAS+  Y   VAD LD    + + R +R  C    G+Y+KDL+
Sbjct: 121 VSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLS 173


>AY364239-1|AAQ76798.1|  244|Homo sapiens DULLARD protein.
          Length = 244

 Score = 77.0 bits (181), Expect = 6e-14
 Identities = 43/113 (38%), Positives = 63/113 (55%), Gaps = 9/113 (7%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHS--------SFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRR 559
           + ++V+DLDETL+HS        + +P     F++ V ID    + +V KRPHVD FL  
Sbjct: 61  RKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEV 120

Query: 560 CGELY*CVLFTASLAKYADPVADLLDR-WGVFRARLFRDSCVFHRGNYVKDLN 715
             + Y  V+FTAS+  Y   VAD LD    + + R +R  C    G+Y+KDL+
Sbjct: 121 VSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLS 173


>AJ011916-1|CAA09865.1|  244|Homo sapiens hypothetical protein
           protein.
          Length = 244

 Score = 77.0 bits (181), Expect = 6e-14
 Identities = 43/113 (38%), Positives = 63/113 (55%), Gaps = 9/113 (7%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHS--------SFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRR 559
           + ++V+DLDETL+HS        + +P     F++ V ID    + +V KRPHVD FL  
Sbjct: 61  RKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEV 120

Query: 560 CGELY*CVLFTASLAKYADPVADLLDR-WGVFRARLFRDSCVFHRGNYVKDLN 715
             + Y  V+FTAS+  Y   VAD LD    + + R +R  C    G+Y+KDL+
Sbjct: 121 VSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLS 173


>BC121147-1|AAI21148.1|  456|Homo sapiens translocase of inner
           mitochondrial membrane 50 homolog (S. cerevisiae)
           protein.
          Length = 456

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 23/65 (35%), Positives = 37/65 (56%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVK 706
           KRP ++   ++   LY  V+FT+     A P+ D +D  G    RLFRD+  +  G++VK
Sbjct: 276 KRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVK 335

Query: 707 DLNSL 721
           D++ L
Sbjct: 336 DISCL 340


>BC121146-1|AAI21147.1|  240|Homo sapiens TIMM50 protein protein.
          Length = 240

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 23/65 (35%), Positives = 37/65 (56%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVK 706
           KRP ++   ++   LY  V+FT+     A P+ D +D  G    RLFRD+  +  G++VK
Sbjct: 60  KRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVK 119

Query: 707 DLNSL 721
           D++ L
Sbjct: 120 DISCL 124


>BC050082-1|AAH50082.1|  359|Homo sapiens TIMM50 protein protein.
          Length = 359

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 23/65 (35%), Positives = 37/65 (56%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVK 706
           KRP ++   ++   LY  V+FT+     A P+ D +D  G    RLFRD+  +  G++VK
Sbjct: 179 KRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVK 238

Query: 707 DLNSL 721
           D++ L
Sbjct: 239 DISCL 243


>BC010736-1|AAH10736.1|  351|Homo sapiens TIMM50 protein protein.
          Length = 351

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 23/65 (35%), Positives = 37/65 (56%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVK 706
           KRP ++   ++   LY  V+FT+     A P+ D +D  G    RLFRD+  +  G++VK
Sbjct: 171 KRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVK 230

Query: 707 DLNSL 721
           D++ L
Sbjct: 231 DISCL 235


>BC009072-1|AAH09072.1|  344|Homo sapiens TIMM50 protein protein.
          Length = 344

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 23/65 (35%), Positives = 37/65 (56%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVK 706
           KRP ++   ++   LY  V+FT+     A P+ D +D  G    RLFRD+  +  G++VK
Sbjct: 164 KRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVK 223

Query: 707 DLNSL 721
           D++ L
Sbjct: 224 DISCL 228


>AY551341-1|AAT01208.1|  353|Homo sapiens translocase of inner
           mitochondrial membrane 50-like protein protein.
          Length = 353

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 23/65 (35%), Positives = 37/65 (56%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVK 706
           KRP ++   ++   LY  V+FT+     A P+ D +D  G    RLFRD+  +  G++VK
Sbjct: 173 KRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVK 232

Query: 707 DLNSL 721
           D++ L
Sbjct: 233 DISCL 237


>AY444561-1|AAS68537.1|  240|Homo sapiens TIM50L protein.
          Length = 240

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 23/65 (35%), Positives = 37/65 (56%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVK 706
           KRP ++   ++   LY  V+FT+     A P+ D +D  G    RLFRD+  +  G++VK
Sbjct: 60  KRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVK 119

Query: 707 DLNSL 721
           D++ L
Sbjct: 120 DISCL 124


>BC063447-1|AAH63447.1|  867|Homo sapiens CTD (carboxy-terminal
           domain, RNA polymerase II, polypeptide A) phosphatase,
           su protein.
          Length = 867

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 28/97 (28%), Positives = 48/97 (49%), Gaps = 4/97 (4%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHF--VVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY* 577
           K V+++DLD+TL+H++ +         +   ++      ++   RPH  +FL +  +LY 
Sbjct: 182 KLVLMVDLDQTLIHTTEQHCQQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYE 241

Query: 578 CVLFTASLAKYADPVADLLD-RWGVFRAR-LFRDSCV 682
             +FT     YA  +A  LD    +F  R L RD C+
Sbjct: 242 LHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECI 278


>BC052576-1|AAH52576.1|  874|Homo sapiens CTDP1 protein protein.
          Length = 874

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 28/97 (28%), Positives = 48/97 (49%), Gaps = 4/97 (4%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHF--VVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY* 577
           K V+++DLD+TL+H++ +         +   ++      ++   RPH  +FL +  +LY 
Sbjct: 95  KLVLMVDLDQTLIHTTEQHCQQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYE 154

Query: 578 CVLFTASLAKYADPVADLLD-RWGVFRAR-LFRDSCV 682
             +FT     YA  +A  LD    +F  R L RD C+
Sbjct: 155 LHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECI 191


>AF154115-1|AAD42088.1|  961|Homo sapiens RNA polymerase II CTD
           phosphatase protein.
          Length = 961

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 28/97 (28%), Positives = 48/97 (49%), Gaps = 4/97 (4%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHF--VVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY* 577
           K V+++DLD+TL+H++ +         +   ++      ++   RPH  +FL +  +LY 
Sbjct: 182 KLVLMVDLDQTLIHTTEQHCQQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYE 241

Query: 578 CVLFTASLAKYADPVADLLD-RWGVFRAR-LFRDSCV 682
             +FT     YA  +A  LD    +F  R L RD C+
Sbjct: 242 LHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECI 278


>AF081287-1|AAC64549.1|  842|Homo sapiens serine phosphatase FCP1a
           protein.
          Length = 842

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 28/97 (28%), Positives = 48/97 (49%), Gaps = 4/97 (4%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHF--VVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY* 577
           K V+++DLD+TL+H++ +         +   ++      ++   RPH  +FL +  +LY 
Sbjct: 63  KLVLMVDLDQTLIHTTEQHCQQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYE 122

Query: 578 CVLFTASLAKYADPVADLLD-RWGVFRAR-LFRDSCV 682
             +FT     YA  +A  LD    +F  R L RD C+
Sbjct: 123 LHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECI 159


>X98893-1|CAA67398.1|  589|Homo sapiens hTAFII68 protein.
          Length = 589

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 15/37 (40%), Positives = 18/37 (48%)
 Frame = +1

Query: 127 YGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGG 237
           YG DRG   G +   G G    G +  GG +S G GG
Sbjct: 512 YGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGG 548


>U51334-1|AAC50932.1|  592|Homo sapiens putative RNA binding protein
           RBP56 protein.
          Length = 592

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 15/37 (40%), Positives = 18/37 (48%)
 Frame = +1

Query: 127 YGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGG 237
           YG DRG   G +   G G    G +  GG +S G GG
Sbjct: 515 YGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGG 551


>BC046099-1|AAH46099.2|  592|Homo sapiens TAF15 RNA polymerase II,
           TATA box binding protein (TBP)-associated factor, 68kD
           protein.
          Length = 592

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 15/37 (40%), Positives = 18/37 (48%)
 Frame = +1

Query: 127 YGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGG 237
           YG DRG   G +   G G    G +  GG +S G GG
Sbjct: 515 YGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGG 551


>AY197697-1|AAO13485.1|  589|Homo sapiens TAF15 RNA polymerase II,
           TATA box binding protein (TBP)-associated factor, 68kD
           protein.
          Length = 589

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 15/37 (40%), Positives = 18/37 (48%)
 Frame = +1

Query: 127 YGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGG 237
           YG DRG   G +   G G    G +  GG +S G GG
Sbjct: 512 YGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGG 548


>AB010067-2|BAA33812.1|  589|Homo sapiens RBP56/hTAFII68 protein.
          Length = 589

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 15/37 (40%), Positives = 18/37 (48%)
 Frame = +1

Query: 127 YGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGG 237
           YG DRG   G +   G G    G +  GG +S G GG
Sbjct: 512 YGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGG 548


>AB010067-1|BAA33811.1|  592|Homo sapiens RBP56/hTAFII68 protein.
          Length = 592

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 15/37 (40%), Positives = 18/37 (48%)
 Frame = +1

Query: 127 YGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGG 237
           YG DRG   G +   G G    G +  GG +S G GG
Sbjct: 515 YGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGG 551


>U00968-1|AAC50051.2| 1147|Homo sapiens SREBP-1 protein.
          Length = 1147

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 21/47 (44%), Positives = 24/47 (51%), Gaps = 2/47 (4%)
 Frame = +2

Query: 152 LVCSIMRVTAPQFRGRPLWVGRNLAGPAASCDRCCA--VGAVAEARD 286
           L CS++         R LWVGR LAG A    + CA  V A A ARD
Sbjct: 623 LACSLLWNLIRHLLQR-LWVGRWLAGRAGGLQQDCALRVDASASARD 668


>BC063281-1|AAH63281.1| 1177|Homo sapiens sterol regulatory element
           binding transcription factor 1 protein.
          Length = 1177

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 21/47 (44%), Positives = 24/47 (51%), Gaps = 2/47 (4%)
 Frame = +2

Query: 152 LVCSIMRVTAPQFRGRPLWVGRNLAGPAASCDRCCA--VGAVAEARD 286
           L CS++         R LWVGR LAG A    + CA  V A A ARD
Sbjct: 653 LACSLLWNLIRHLLQR-LWVGRWLAGRAGGLQQDCALRVDASASARD 698


>BC057388-1|AAH57388.1| 1147|Homo sapiens sterol regulatory element
           binding transcription factor 1 protein.
          Length = 1147

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 21/47 (44%), Positives = 24/47 (51%), Gaps = 2/47 (4%)
 Frame = +2

Query: 152 LVCSIMRVTAPQFRGRPLWVGRNLAGPAASCDRCCA--VGAVAEARD 286
           L CS++         R LWVGR LAG A    + CA  V A A ARD
Sbjct: 623 LACSLLWNLIRHLLQR-LWVGRWLAGRAGGLQQDCALRVDASASARD 668


>BC026962-1|AAH26962.1|  750|Homo sapiens Unknown (protein for
           IMAGE:5103173) protein.
          Length = 750

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 21/47 (44%), Positives = 24/47 (51%), Gaps = 2/47 (4%)
 Frame = +2

Query: 152 LVCSIMRVTAPQFRGRPLWVGRNLAGPAASCDRCCA--VGAVAEARD 286
           L CS++         R LWVGR LAG A    + CA  V A A ARD
Sbjct: 226 LACSLLWNLIRHLLQR-LWVGRWLAGRAGGLQQDCALRVDASASARD 271


>BC023621-1|AAH23621.1|  686|Homo sapiens SREBF1 protein protein.
          Length = 686

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 21/47 (44%), Positives = 24/47 (51%), Gaps = 2/47 (4%)
 Frame = +2

Query: 152 LVCSIMRVTAPQFRGRPLWVGRNLAGPAASCDRCCA--VGAVAEARD 286
           L CS++         R LWVGR LAG A    + CA  V A A ARD
Sbjct: 162 LACSLLWNLIRHLLQR-LWVGRWLAGRAGGLQQDCALRVDASASARD 207


>AL356755-3|CAI23466.1|  299|Homo sapiens GDNF family receptor alpha
           4 protein.
          Length = 299

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 20/54 (37%), Positives = 26/54 (48%)
 Frame = -2

Query: 327 SPAVDTIGAIASGRSLASATAPTAQQRSQEAAGPARFLPTQRGRPRNWGAVTLI 166
           SPA     A AS   L+    P+AQ+  +  AGP R LP +   PR   A T +
Sbjct: 148 SPAHRPPAAQASPPGLSGLVHPSAQRPRRLPAGPGRPLPARLRGPRGVPAGTAV 201


>AJ291674-1|CAC19691.1|  299|Homo sapiens putative GDNF family
           receptor alpha 4, GPI anchored isoform b protein.
          Length = 299

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 20/54 (37%), Positives = 26/54 (48%)
 Frame = -2

Query: 327 SPAVDTIGAIASGRSLASATAPTAQQRSQEAAGPARFLPTQRGRPRNWGAVTLI 166
           SPA     A AS   L+    P+AQ+  +  AGP R LP +   PR   A T +
Sbjct: 148 SPAHRPPAAQASPPGLSGLVHPSAQRPRRLPAGPGRPLPARLRGPRGVPAGTAV 201


>AF202445-2|AAF82685.1|  709|Homo sapiens dsRNA binding protein
           NFAR-2/MPP4 protein.
          Length = 709

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 14/46 (30%), Positives = 21/46 (45%)
 Frame = +1

Query: 94  QVSRDDEQLNNYGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGT 231
           Q S +    +NYGP +G   G  H +G  +  +     GG   SG+
Sbjct: 569 QQSYNQSPYSNYGPPQGKQKGYNHGQGSYSYSNSYNSPGGGGGSGS 614


>AB209609-1|BAD92846.1|  697|Homo sapiens sterol regulatory element
           binding transcription factor 1 isoform a variant
           protein.
          Length = 697

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 21/47 (44%), Positives = 24/47 (51%), Gaps = 2/47 (4%)
 Frame = +2

Query: 152 LVCSIMRVTAPQFRGRPLWVGRNLAGPAASCDRCCA--VGAVAEARD 286
           L CS++         R LWVGR LAG A    + CA  V A A ARD
Sbjct: 173 LACSLLWNLIRHLLQR-LWVGRWLAGRAGGLQQDCALRVDASASARD 218


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 111,800,610
Number of Sequences: 237096
Number of extensions: 2604741
Number of successful extensions: 7538
Number of sequences better than 10.0: 47
Number of HSP's better than 10.0 without gapping: 6880
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7511
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8455186714
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).