SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0013
         (823 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ109556-1|AAZ99795.1|  911|Homo sapiens adaptor protein HOFI pr...    31   3.8  
AB037716-1|BAA92533.1|  550|Homo sapiens KIAA1295 protein protein.     31   3.8  
AF178946-1|AAD53317.1|  624|Homo sapiens 70 kDa SHP-1L protein p...    31   6.7  
DQ020173-1|AAY26395.1|  536|Homo sapiens Fanconi anemia, complem...    30   8.8  
BC114334-1|AAI14335.2|  280|Homo sapiens NRG2 protein protein.         30   8.8  
BC114333-1|AAI14334.2|  280|Homo sapiens NRG2 protein protein.         30   8.8  
BC103984-1|AAI03985.2|  280|Homo sapiens NRG2 protein protein.         30   8.8  
BC103983-1|AAI03984.2|  280|Homo sapiens NRG2 protein protein.         30   8.8  
BC070359-1|AAH70359.1|  183|Homo sapiens defensin, beta 129 prot...    30   8.8  
BC046359-1|AAH46359.1|  536|Homo sapiens Fanconi anemia, complem...    30   8.8  
AY358186-1|AAQ88553.1|  183|Homo sapiens DEFB129 protein.              30   8.8  
AL360078-5|CAC17686.1|  183|Homo sapiens defensin, beta 129 prot...    30   8.8  
AL022721-6|CAD92504.1|  536|Homo sapiens Fanconi anemia, complem...    30   8.8  
AF529413-1|AAQ09522.1|  183|Homo sapiens beta-defensin protein.        30   8.8  
AF525931-1|AAP47224.1|  183|Homo sapiens beta-defensin 29 precur...    30   8.8  
AF265210-1|AAG16743.1|  536|Homo sapiens fanconi anemia protein ...    30   8.8  
AF119158-1|AAF28852.1|  426|Homo sapiens neuregulin 2 isoform 5 ...    30   8.8  
AF119157-1|AAF28853.1|  422|Homo sapiens neuregulin 2 isoform 6 ...    30   8.8  

>DQ109556-1|AAZ99795.1|  911|Homo sapiens adaptor protein HOFI
           protein.
          Length = 911

 Score = 31.5 bits (68), Expect = 3.8
 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 2/45 (4%)
 Frame = -1

Query: 613 SVPCPSGFYQDAVHER*--PVRSPPPLQYLAWEARLTPPLRGPQC 485
           SVP P    Q+A  +R   P R PPP +  +  +R  P +RGPQC
Sbjct: 742 SVPVP---LQEAPQQRPVVPPRRPPPPKKTSSSSRPLPEVRGPQC 783


>AB037716-1|BAA92533.1|  550|Homo sapiens KIAA1295 protein protein.
          Length = 550

 Score = 31.5 bits (68), Expect = 3.8
 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 2/45 (4%)
 Frame = -1

Query: 613 SVPCPSGFYQDAVHER*--PVRSPPPLQYLAWEARLTPPLRGPQC 485
           SVP P    Q+A  +R   P R PPP +  +  +R  P +RGPQC
Sbjct: 381 SVPVP---LQEAPQQRPVVPPRRPPPPKKTSSSSRPLPEVRGPQC 422


>AF178946-1|AAD53317.1|  624|Homo sapiens 70 kDa SHP-1L protein
           protein.
          Length = 624

 Score = 30.7 bits (66), Expect = 6.7
 Identities = 17/50 (34%), Positives = 26/50 (52%)
 Frame = +3

Query: 657 PSAHSGATATSCRTTAEEVC*SAYSKSNPWQVRGGSTGVPPPAPPALEQE 806
           P A   A A + RT+++ +  SA + +     RGG  G+P P PP L  +
Sbjct: 542 PPAMKNAHAKASRTSSKSLESSAGTVAASPVRRGGQRGLPVPGPPVLSPD 591


>DQ020173-1|AAY26395.1|  536|Homo sapiens Fanconi anemia,
           complementation group E protein.
          Length = 536

 Score = 30.3 bits (65), Expect = 8.8
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%)
 Frame = +1

Query: 511 LDAPPRPDIEEEEGFVPVISHGRRPGKNRRDRERK-APPRAHKTPQQ 648
           L +P  PD EEEE         ++PGK R+D E + A P   + P++
Sbjct: 178 LKSPQAPDPEEEEN-----RDSQQPGKRRKDSEEEAASPEGKRVPKR 219


>BC114334-1|AAI14335.2|  280|Homo sapiens NRG2 protein protein.
          Length = 280

 Score = 30.3 bits (65), Expect = 8.8
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 4/44 (9%)
 Frame = -1

Query: 640 VFYELSGV--LSVPCPSGFYQDAVHER*PVR--SPPPLQYLAWE 521
           V Y + G+  LS  CP+GF+     E+ P+R   P P Q + W+
Sbjct: 216 VCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQSVLWD 259


>BC114333-1|AAI14334.2|  280|Homo sapiens NRG2 protein protein.
          Length = 280

 Score = 30.3 bits (65), Expect = 8.8
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 4/44 (9%)
 Frame = -1

Query: 640 VFYELSGV--LSVPCPSGFYQDAVHER*PVR--SPPPLQYLAWE 521
           V Y + G+  LS  CP+GF+     E+ P+R   P P Q + W+
Sbjct: 216 VCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQSVLWD 259


>BC103984-1|AAI03985.2|  280|Homo sapiens NRG2 protein protein.
          Length = 280

 Score = 30.3 bits (65), Expect = 8.8
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 4/44 (9%)
 Frame = -1

Query: 640 VFYELSGV--LSVPCPSGFYQDAVHER*PVR--SPPPLQYLAWE 521
           V Y + G+  LS  CP+GF+     E+ P+R   P P Q + W+
Sbjct: 216 VCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQSVLWD 259


>BC103983-1|AAI03984.2|  280|Homo sapiens NRG2 protein protein.
          Length = 280

 Score = 30.3 bits (65), Expect = 8.8
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 4/44 (9%)
 Frame = -1

Query: 640 VFYELSGV--LSVPCPSGFYQDAVHER*PVR--SPPPLQYLAWE 521
           V Y + G+  LS  CP+GF+     E+ P+R   P P Q + W+
Sbjct: 216 VCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQSVLWD 259


>BC070359-1|AAH70359.1|  183|Homo sapiens defensin, beta 129
           protein.
          Length = 183

 Score = 30.3 bits (65), Expect = 8.8
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = +3

Query: 657 PSAHSGATATSCRTTAEEVC*SAYS-KSNPWQVRGGSTGVPPPAPP 791
           P+A    +AT    T  ++  +A S KSN  + R  +T  PPPAPP
Sbjct: 120 PNATPMNSATISTMTPGQITYTATSTKSNTKESRDSATASPPPAPP 165


>BC046359-1|AAH46359.1|  536|Homo sapiens Fanconi anemia,
           complementation group E protein.
          Length = 536

 Score = 30.3 bits (65), Expect = 8.8
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%)
 Frame = +1

Query: 511 LDAPPRPDIEEEEGFVPVISHGRRPGKNRRDRERK-APPRAHKTPQQ 648
           L +P  PD EEEE         ++PGK R+D E + A P   + P++
Sbjct: 178 LKSPQAPDPEEEEN-----RDSQQPGKRRKDSEEEAASPEGKRVPKR 219


>AY358186-1|AAQ88553.1|  183|Homo sapiens DEFB129 protein.
          Length = 183

 Score = 30.3 bits (65), Expect = 8.8
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = +3

Query: 657 PSAHSGATATSCRTTAEEVC*SAYS-KSNPWQVRGGSTGVPPPAPP 791
           P+A    +AT    T  ++  +A S KSN  + R  +T  PPPAPP
Sbjct: 120 PNATPMNSATISTMTPGQITYTATSTKSNTKESRDSATASPPPAPP 165


>AL360078-5|CAC17686.1|  183|Homo sapiens defensin, beta 129
           protein.
          Length = 183

 Score = 30.3 bits (65), Expect = 8.8
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = +3

Query: 657 PSAHSGATATSCRTTAEEVC*SAYS-KSNPWQVRGGSTGVPPPAPP 791
           P+A    +AT    T  ++  +A S KSN  + R  +T  PPPAPP
Sbjct: 120 PNATPMNSATISTMTPGQITYTATSTKSNTKESRDSATASPPPAPP 165


>AL022721-6|CAD92504.1|  536|Homo sapiens Fanconi anemia,
           complementation group E protein.
          Length = 536

 Score = 30.3 bits (65), Expect = 8.8
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%)
 Frame = +1

Query: 511 LDAPPRPDIEEEEGFVPVISHGRRPGKNRRDRERK-APPRAHKTPQQ 648
           L +P  PD EEEE         ++PGK R+D E + A P   + P++
Sbjct: 178 LKSPQAPDPEEEEN-----RDSQQPGKRRKDSEEEAASPEGKRVPKR 219


>AF529413-1|AAQ09522.1|  183|Homo sapiens beta-defensin protein.
          Length = 183

 Score = 30.3 bits (65), Expect = 8.8
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = +3

Query: 657 PSAHSGATATSCRTTAEEVC*SAYS-KSNPWQVRGGSTGVPPPAPP 791
           P+A    +AT    T  ++  +A S KSN  + R  +T  PPPAPP
Sbjct: 120 PNATPMNSATISTMTPGQITYTATSTKSNTKESRDSATASPPPAPP 165


>AF525931-1|AAP47224.1|  183|Homo sapiens beta-defensin 29 precursor
           protein.
          Length = 183

 Score = 30.3 bits (65), Expect = 8.8
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = +3

Query: 657 PSAHSGATATSCRTTAEEVC*SAYS-KSNPWQVRGGSTGVPPPAPP 791
           P+A    +AT    T  ++  +A S KSN  + R  +T  PPPAPP
Sbjct: 120 PNATPMNSATISTMTPGQITYTATSTKSNTKESRDSATASPPPAPP 165


>AF265210-1|AAG16743.1|  536|Homo sapiens fanconi anemia protein E
           protein.
          Length = 536

 Score = 30.3 bits (65), Expect = 8.8
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%)
 Frame = +1

Query: 511 LDAPPRPDIEEEEGFVPVISHGRRPGKNRRDRERK-APPRAHKTPQQ 648
           L +P  PD EEEE         ++PGK R+D E + A P   + P++
Sbjct: 178 LKSPQAPDPEEEEN-----RDSQQPGKRRKDSEEEAASPEGKRVPKR 219


>AF119158-1|AAF28852.1|  426|Homo sapiens neuregulin 2 isoform 5
           protein.
          Length = 426

 Score = 30.3 bits (65), Expect = 8.8
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 4/44 (9%)
 Frame = -1

Query: 640 VFYELSGV--LSVPCPSGFYQDAVHER*PVR--SPPPLQYLAWE 521
           V Y + G+  LS  CP+GF+     E+ P+R   P P Q + W+
Sbjct: 358 VCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQSVLWD 401


>AF119157-1|AAF28853.1|  422|Homo sapiens neuregulin 2 isoform 6
           protein.
          Length = 422

 Score = 30.3 bits (65), Expect = 8.8
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 4/44 (9%)
 Frame = -1

Query: 640 VFYELSGV--LSVPCPSGFYQDAVHER*PVR--SPPPLQYLAWE 521
           V Y + G+  LS  CP+GF+     E+ P+R   P P Q + W+
Sbjct: 358 VCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQSVLWD 401


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 117,533,675
Number of Sequences: 237096
Number of extensions: 2500664
Number of successful extensions: 9037
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 8001
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9005
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 10259383312
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).