SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0011
         (939 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF013758-1|AAC39697.2|  479|Homo sapiens polyadenylate binding p...    60   2e-11
BC005295-1|AAH05295.1|  400|Homo sapiens poly(A) binding protein...    60   2e-11
BC015937-1|AAH15937.1|  479|Homo sapiens poly(A) binding protein...    57   2e-10
M83566-1|AAA35629.1| 2181|Homo sapiens calcium channel alpha-1 s...    31   6.0  
M76558-1|AAA58402.1| 2161|Homo sapiens calcium channel alpha-1D ...    31   6.0  
D43747-1|BAA07804.1| 2170|Homo sapiens voltage-dependent calcium...    31   6.0  
AK097139-1|BAC04960.1|  138|Homo sapiens protein ( Homo sapiens ...    31   6.0  
AB209171-1|BAD92408.1| 1854|Homo sapiens calcium channel, voltag...    31   6.0  
X95808-1|CAA65075.1| 1358|Homo sapiens DXS6673E protein.               31   8.0  
BT007095-1|AAP35759.1|  495|Homo sapiens zinc finger protein 261...    31   8.0  
BC069057-1|AAH69057.1| 1370|Homo sapiens zinc finger, MYM-type 3...    31   8.0  
BC013009-1|AAH13009.1|  495|Homo sapiens ZMYM3 protein protein.        31   8.0  
AL133380-4|CAI23046.1| 1036|Homo sapiens mixed lineage kinase 4 ...    31   8.0  
AL133380-3|CAI23045.1|  570|Homo sapiens mixed lineage kinase 4 ...    31   8.0  
AJ311798-1|CAC84640.1| 1036|Homo sapiens mixed lineage kinase 4b...    31   8.0  
AJ311797-1|CAC84639.1|  570|Homo sapiens mixed lineage kinase 4a...    31   8.0  
AB002383-1|BAA20839.2| 1380|Homo sapiens KIAA0385 protein.             31   8.0  

>AF013758-1|AAC39697.2|  479|Homo sapiens polyadenylate binding
           protein-interacting protein-1 protein.
          Length = 479

 Score = 60.1 bits (139), Expect(2) = 2e-11
 Identities = 33/114 (28%), Positives = 55/114 (48%), Gaps = 5/114 (4%)
 Frame = +1

Query: 544 ITFDPGKFDTLCGPLVDSFASTLNDESYTRPLVDAIVNQSIGEANFRYNGARLCS--MYD 717
           +T  PG F+T      ++    +  +   + LV+ I  Q+    NF Y GARLC+   + 
Sbjct: 169 LTEQPGSFETEIEQFAETLNGCVTTDDALQELVELIYQQATSIPNFSYMGARLCNYLSHH 228

Query: 718 SVAQPEESVFRECLLERCSVE---ENKIISGLETSEENMRGFAMFLAEIILSFE 870
               P+   FR+ LL+RC  E   +++   G E + +    F +FL E+ L+ E
Sbjct: 229 LTISPQSGNFRQLLLQRCRTEYEVKDQAAKGDEVTRKRFHAFVLFLGELYLNLE 282



 Score = 29.1 bits (62), Expect(2) = 2e-11
 Identities = 16/47 (34%), Positives = 22/47 (46%)
 Frame = +1

Query: 304 SKLSADAKEWYPANYTSQALPAYNTEPAPYRPSRPSVQGRLRQAQDQ 444
           SKLS +A E+YP+ Y+S    +Y      Y      VQ  L    +Q
Sbjct: 126 SKLSVNAPEFYPSGYSSSYTESYEDGCEDYPTLSEYVQDFLNHLTEQ 172


>BC005295-1|AAH05295.1|  400|Homo sapiens poly(A) binding protein
           interacting protein 1 protein.
          Length = 400

 Score = 60.1 bits (139), Expect(2) = 2e-11
 Identities = 33/114 (28%), Positives = 55/114 (48%), Gaps = 5/114 (4%)
 Frame = +1

Query: 544 ITFDPGKFDTLCGPLVDSFASTLNDESYTRPLVDAIVNQSIGEANFRYNGARLCS--MYD 717
           +T  PG F+T      ++    +  +   + LV+ I  Q+    NF Y GARLC+   + 
Sbjct: 90  LTEQPGSFETEIEQFAETLNGCVTTDDALQELVELIYQQATSIPNFSYMGARLCNYLSHH 149

Query: 718 SVAQPEESVFRECLLERCSVE---ENKIISGLETSEENMRGFAMFLAEIILSFE 870
               P+   FR+ LL+RC  E   +++   G E + +    F +FL E+ L+ E
Sbjct: 150 LTISPQSGNFRQLLLQRCRTEYEVKDQAAKGDEVTRKRFHAFVLFLGELYLNLE 203



 Score = 29.1 bits (62), Expect(2) = 2e-11
 Identities = 16/47 (34%), Positives = 22/47 (46%)
 Frame = +1

Query: 304 SKLSADAKEWYPANYTSQALPAYNTEPAPYRPSRPSVQGRLRQAQDQ 444
           SKLS +A E+YP+ Y+S    +Y      Y      VQ  L    +Q
Sbjct: 47  SKLSVNAPEFYPSGYSSSYTESYEDGCEDYPTLSEYVQDFLNHLTEQ 93


>BC015937-1|AAH15937.1|  479|Homo sapiens poly(A) binding protein
           interacting protein 1 protein.
          Length = 479

 Score = 56.8 bits (131), Expect(2) = 2e-10
 Identities = 32/114 (28%), Positives = 54/114 (47%), Gaps = 5/114 (4%)
 Frame = +1

Query: 544 ITFDPGKFDTLCGPLVDSFASTLNDESYTRPLVDAIVNQSIGEANFRYNGARLCS--MYD 717
           +T  PG F+T      ++    +  +   + LV+ I  Q+    NF Y GARLC+   + 
Sbjct: 169 LTEQPGSFETEIEQFAETLNGCVTTDDALQELVELIYQQATSIPNFSYMGARLCNYLSHH 228

Query: 718 SVAQPEESVFRECLLERCSVE---ENKIISGLETSEENMRGFAMFLAEIILSFE 870
               P+   F + LL+RC  E   +++   G E + +    F +FL E+ L+ E
Sbjct: 229 LTISPQSGNFCQLLLQRCRTEYEVKDQAAKGDEVTRKRFHAFVLFLGELYLNLE 282



 Score = 29.1 bits (62), Expect(2) = 2e-10
 Identities = 16/47 (34%), Positives = 22/47 (46%)
 Frame = +1

Query: 304 SKLSADAKEWYPANYTSQALPAYNTEPAPYRPSRPSVQGRLRQAQDQ 444
           SKLS +A E+YP+ Y+S    +Y      Y      VQ  L    +Q
Sbjct: 126 SKLSVNAPEFYPSGYSSSYTESYEDGCEDYPTLSEYVQDFLNHLTEQ 172


>M83566-1|AAA35629.1| 2181|Homo sapiens calcium channel alpha-1
            subunit protein.
          Length = 2181

 Score = 31.1 bits (67), Expect = 6.0
 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 2/43 (4%)
 Frame = +1

Query: 109  IYQSRLWNCIKAAL*NC--CRGLIVKMNNGDISAPKGRGRGWQ 231
            +++ + + C   A  N   CRGL +   +GD+ +P  R R WQ
Sbjct: 1056 LFKGKFYRCTDEAKSNPEECRGLFILYKDGDVDSPVVRERIWQ 1098


>M76558-1|AAA58402.1| 2161|Homo sapiens calcium channel alpha-1D
            subunit protein.
          Length = 2161

 Score = 31.1 bits (67), Expect = 6.0
 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 2/43 (4%)
 Frame = +1

Query: 109  IYQSRLWNCIKAAL*NC--CRGLIVKMNNGDISAPKGRGRGWQ 231
            +++ + + C   A  N   CRGL +   +GD+ +P  R R WQ
Sbjct: 1036 LFKGKFYRCTDEAKSNPEECRGLFILYKDGDVDSPVVRERIWQ 1078


>D43747-1|BAA07804.1| 2170|Homo sapiens voltage-dependent calcium
            channel alpha1 subunit, CACN4 protein.
          Length = 2170

 Score = 31.1 bits (67), Expect = 6.0
 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 2/43 (4%)
 Frame = +1

Query: 109  IYQSRLWNCIKAAL*NC--CRGLIVKMNNGDISAPKGRGRGWQ 231
            +++ + + C   A  N   CRGL +   +GD+ +P  R R WQ
Sbjct: 1047 LFKGKFYRCTDEAKSNPEECRGLFILYKDGDVDSPVVRERIWQ 1089


>AK097139-1|BAC04960.1|  138|Homo sapiens protein ( Homo sapiens
           cDNA FLJ39820 fis, clone SPLEN2010625. ).
          Length = 138

 Score = 31.1 bits (67), Expect = 6.0
 Identities = 14/28 (50%), Positives = 17/28 (60%)
 Frame = +2

Query: 338 LQITLLKPYPLTTLNLPHIDHLAPLYKV 421
           L +TLL P+ L TL LPH     PL +V
Sbjct: 65  LSLTLLSPFSLPTLFLPHFPPRVPLLRV 92


>AB209171-1|BAD92408.1| 1854|Homo sapiens calcium channel,
           voltage-dependent, L type, alpha 1D subunit variant
           protein.
          Length = 1854

 Score = 31.1 bits (67), Expect = 6.0
 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 2/43 (4%)
 Frame = +1

Query: 109 IYQSRLWNCIKAAL*NC--CRGLIVKMNNGDISAPKGRGRGWQ 231
           +++ + + C   A  N   CRGL +   +GD+ +P  R R WQ
Sbjct: 729 LFKGKFYRCTDEAKSNPEECRGLFILYKDGDVDSPVVRERIWQ 771


>X95808-1|CAA65075.1| 1358|Homo sapiens DXS6673E protein.
          Length = 1358

 Score = 30.7 bits (66), Expect = 8.0
 Identities = 21/58 (36%), Positives = 25/58 (43%), Gaps = 4/58 (6%)
 Frame = -3

Query: 607 LKQMNPPRDHTRCQTCP--GQRLSHT*QLSSL--LCSPVDPCFQLLQVNKTCHPNCMD 446
           + Q   P D TRC  C   G+ L      S +  LCS  D CF   + NK    NC D
Sbjct: 397 IPQSGDPADATRCSICQKTGEVLHEVSNGSVVHRLCS--DSCFSKFRANKGLKTNCCD 452


>BT007095-1|AAP35759.1|  495|Homo sapiens zinc finger protein 261
           protein.
          Length = 495

 Score = 30.7 bits (66), Expect = 8.0
 Identities = 21/58 (36%), Positives = 25/58 (43%), Gaps = 4/58 (6%)
 Frame = -3

Query: 607 LKQMNPPRDHTRCQTCP--GQRLSHT*QLSSL--LCSPVDPCFQLLQVNKTCHPNCMD 446
           + Q   P D TRC  C   G+ L      S +  LCS  D CF   + NK    NC D
Sbjct: 397 IPQSGDPADATRCSICQKTGEVLHEVSNGSVVHRLCS--DSCFSKFRANKGLKTNCCD 452


>BC069057-1|AAH69057.1| 1370|Homo sapiens zinc finger, MYM-type 3
           protein.
          Length = 1370

 Score = 30.7 bits (66), Expect = 8.0
 Identities = 21/58 (36%), Positives = 25/58 (43%), Gaps = 4/58 (6%)
 Frame = -3

Query: 607 LKQMNPPRDHTRCQTCP--GQRLSHT*QLSSL--LCSPVDPCFQLLQVNKTCHPNCMD 446
           + Q   P D TRC  C   G+ L      S +  LCS  D CF   + NK    NC D
Sbjct: 397 IPQSGDPADATRCSICQKTGEVLHEVSNGSVVHRLCS--DSCFSKFRANKGLKTNCCD 452


>BC013009-1|AAH13009.1|  495|Homo sapiens ZMYM3 protein protein.
          Length = 495

 Score = 30.7 bits (66), Expect = 8.0
 Identities = 21/58 (36%), Positives = 25/58 (43%), Gaps = 4/58 (6%)
 Frame = -3

Query: 607 LKQMNPPRDHTRCQTCP--GQRLSHT*QLSSL--LCSPVDPCFQLLQVNKTCHPNCMD 446
           + Q   P D TRC  C   G+ L      S +  LCS  D CF   + NK    NC D
Sbjct: 397 IPQSGDPADATRCSICQKTGEVLHEVSNGSVVHRLCS--DSCFSKFRANKGLKTNCCD 452


>AL133380-4|CAI23046.1| 1036|Homo sapiens mixed lineage kinase 4
           (KIAA1804) protein.
          Length = 1036

 Score = 30.7 bits (66), Expect = 8.0
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = +1

Query: 334 YPANYTSQALPAYNTEPAPYRPSRP 408
           +PANY +   PA +  P P RPS P
Sbjct: 92  FPANYVAPCRPAASPAPPPSRPSSP 116


>AL133380-3|CAI23045.1|  570|Homo sapiens mixed lineage kinase 4
           (KIAA1804) protein.
          Length = 570

 Score = 30.7 bits (66), Expect = 8.0
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = +1

Query: 334 YPANYTSQALPAYNTEPAPYRPSRP 408
           +PANY +   PA +  P P RPS P
Sbjct: 92  FPANYVAPCRPAASPAPPPSRPSSP 116


>AJ311798-1|CAC84640.1| 1036|Homo sapiens mixed lineage kinase 4beta
           protein.
          Length = 1036

 Score = 30.7 bits (66), Expect = 8.0
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = +1

Query: 334 YPANYTSQALPAYNTEPAPYRPSRP 408
           +PANY +   PA +  P P RPS P
Sbjct: 92  FPANYVAPCRPAASPAPPPSRPSSP 116


>AJ311797-1|CAC84639.1|  570|Homo sapiens mixed lineage kinase
           4alpha protein.
          Length = 570

 Score = 30.7 bits (66), Expect = 8.0
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = +1

Query: 334 YPANYTSQALPAYNTEPAPYRPSRP 408
           +PANY +   PA +  P P RPS P
Sbjct: 92  FPANYVAPCRPAASPAPPPSRPSSP 116


>AB002383-1|BAA20839.2| 1380|Homo sapiens KIAA0385 protein.
          Length = 1380

 Score = 30.7 bits (66), Expect = 8.0
 Identities = 21/58 (36%), Positives = 25/58 (43%), Gaps = 4/58 (6%)
 Frame = -3

Query: 607 LKQMNPPRDHTRCQTCP--GQRLSHT*QLSSL--LCSPVDPCFQLLQVNKTCHPNCMD 446
           + Q   P D TRC  C   G+ L      S +  LCS  D CF   + NK    NC D
Sbjct: 407 IPQSGDPADATRCSICQKTGEVLHEVSNGSVVHRLCS--DSCFSKFRANKGLKTNCCD 462


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 144,034,533
Number of Sequences: 237096
Number of extensions: 3374779
Number of successful extensions: 8058
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 7532
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8034
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 12325533684
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).