SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0009
         (585 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC046248-1|AAH46248.1|  503|Homo sapiens similar to CG32656-PA p...    36   0.11 
BC015621-1|AAH15621.1|  245|Homo sapiens C14orf32 protein protein.     33   0.74 
AB075820-1|BAB85526.1|  821|Homo sapiens KIAA1940 protein protein.     33   0.98 
BC064584-1|AAH64584.1|  598|Homo sapiens XRRA1 protein protein.        32   1.3  
BC033209-1|AAH33209.1|  566|Homo sapiens C15orf42 protein protein.     32   1.3  
AK093006-1|BAC04016.1|  177|Homo sapiens protein ( Homo sapiens ...    32   1.3  
AK074727-1|BAC11165.1|  653|Homo sapiens protein ( Homo sapiens ...    32   1.3  
AF089090-1|AAG17968.1|  544|Homo sapiens calpain-like protease C...    32   1.3  
AK128780-1|BAC87609.1|  259|Homo sapiens protein ( Homo sapiens ...    32   1.7  
BC112202-1|AAI12203.1|  511|Homo sapiens FBXO41 protein protein.       31   3.0  
BX000476-1|CAI41974.1|  384|Homo sapiens protein phosphatase 2 (...    31   4.0  
BC089042-1|AAH89042.1| 1636|Homo sapiens protein tyrosine phosph...    31   4.0  
BC027711-1|AAH27711.2| 1320|Homo sapiens PTPN23 protein protein.       31   4.0  
AL954664-1|CAI41961.1|  384|Homo sapiens protein phosphatase 2 (...    31   4.0  
AL732314-1|CAI41583.1|  384|Homo sapiens protein phosphatase 2 (...    31   4.0  
AL672037-2|CAI16194.1|  630|Homo sapiens eukaryotic translation ...    31   4.0  
AL627311-1|CAI14552.1|  630|Homo sapiens eukaryotic translation ...    31   4.0  
AL358392-1|CAI12154.1|  630|Homo sapiens eukaryotic translation ...    31   4.0  
AL110210-1|CAB53676.1|  990|Homo sapiens hypothetical protein pr...    31   4.0  
AF290614-1|AAK28025.1| 1636|Homo sapiens protein tyrosine phosph...    31   4.0  
AB209119-1|BAD92356.1| 1780|Homo sapiens eukaryotic translation ...    31   4.0  
AB040904-1|BAA95995.2| 1421|Homo sapiens KIAA1471 protein protein.     31   4.0  
AB025194-1|BAB19280.1| 1636|Homo sapiens protein tyrosine phosph...    31   4.0  
BC032691-1|AAH32691.1|  672|Homo sapiens Bardet-Biedl syndrome 7...    30   5.2  
AK001577-1|BAA91767.1|  672|Homo sapiens protein ( Homo sapiens ...    30   5.2  
AF521644-1|AAO16026.1|  715|Homo sapiens BBS7 long isoform protein.    30   5.2  
AF521643-1|AAO16025.1|  672|Homo sapiens BBS7 short isoform prot...    30   5.2  
AC079341-4|AAY40970.1|  715|Homo sapiens unknown protein.              30   5.2  
M95610-1|AAA80977.1|  675|Homo sapiens alpha-2 IX collagen protein.    30   6.9  
BX641102-1|CAE46047.1|  685|Homo sapiens hypothetical protein pr...    30   6.9  
AL050341-6|CAB81611.1|  689|Homo sapiens collagen type IX alpha ...    30   6.9  
AK096760-1|BAC04858.1|  627|Homo sapiens protein ( Homo sapiens ...    30   6.9  
AF019406-1|AAC33512.1|  689|Homo sapiens collagen type IX alpha ...    30   6.9  
U43573-1|AAC50513.1|  743|Homo sapiens alpha-N-acetylglucosamini...    29   9.1  
U43572-1|AAC50512.1|  743|Homo sapiens alpha-N-acetylglucosamini...    29   9.1  
U40846-1|AAB06188.1|  743|Homo sapiens alpha-N-acetylglucosamini...    29   9.1  
L78465-1|AAB36605.1|  639|Homo sapiens alpha-N-acetylglucosamini...    29   9.1  
L78464-1|AAB36604.1|  743|Homo sapiens alpha-N-acetylglucosamini...    29   9.1  
BC060807-1|AAH60807.1|  354|Homo sapiens CREB/ATF bZIP transcrip...    29   9.1  
BC053991-1|AAH53991.1|  743|Homo sapiens N-acetylglucosaminidase...    29   9.1  

>BC046248-1|AAH46248.1|  503|Homo sapiens similar to CG32656-PA
           protein.
          Length = 503

 Score = 35.9 bits (79), Expect = 0.11
 Identities = 19/40 (47%), Positives = 22/40 (55%)
 Frame = -2

Query: 140 SSVGSPTRRASR*GPRPAELGGCRNSGPVLCPRGENQAPG 21
           +SV  P RR     P PA  G  R+S PV  PRG + APG
Sbjct: 272 ASVPGPARRGCDSAPGPARRG--RDSAPVSAPRGRDSAPG 309


>BC015621-1|AAH15621.1|  245|Homo sapiens C14orf32 protein protein.
          Length = 245

 Score = 33.1 bits (72), Expect = 0.74
 Identities = 24/56 (42%), Positives = 29/56 (51%), Gaps = 2/56 (3%)
 Frame = +1

Query: 271 GATVPLNY*GTVRPGY--PPSPYPGHTGNGAHPGCDLAPTTEGRLGAL*ETPSRPS 432
           GA  P+ + GTV PG   PP+PYP  TG+   PG  L PT         + PS PS
Sbjct: 184 GAAPPVPW-GTVPPGAWGPPAPYPAPTGSYPTPG--LYPTPSNPF----QVPSGPS 232


>AB075820-1|BAB85526.1|  821|Homo sapiens KIAA1940 protein protein.
          Length = 821

 Score = 32.7 bits (71), Expect = 0.98
 Identities = 24/71 (33%), Positives = 32/71 (45%)
 Frame = -2

Query: 266 ERTHPTRRAGVARRSECAWVRRGRPQSSRPYRHLLTAACPLLSSVGSPTRRASR*GPRPA 87
           ERT P R +G+ R++   W R       RP RH        +S VGS T  +   GP  A
Sbjct: 398 ERTQPPRSSGLRRQAIQNWQR-------RPRRHSTEGEEGDVSDVGSRTTESEAEGPLDA 450

Query: 86  ELGGCRNSGPV 54
              G   +GP+
Sbjct: 451 PRPGPAMAGPL 461


>BC064584-1|AAH64584.1|  598|Homo sapiens XRRA1 protein protein.
          Length = 598

 Score = 32.3 bits (70), Expect = 1.3
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 5/57 (8%)
 Frame = +2

Query: 287 LTIEALYDLGT-PHLPILVTLGMGLT----RVATSPLRPKVDWELFKRRLVDLPAIQ 442
           LT+EA+ DLG  PHL +L+  G GLT     +A +     V     KR ++  PA++
Sbjct: 175 LTVEAICDLGILPHLRVLLLTGNGLTSLPPNLAVAEQEASVTSLTSKRYILRFPALE 231


>BC033209-1|AAH33209.1|  566|Homo sapiens C15orf42 protein protein.
          Length = 566

 Score = 32.3 bits (70), Expect = 1.3
 Identities = 14/29 (48%), Positives = 17/29 (58%)
 Frame = +1

Query: 310 PGYPPSPYPGHTGNGAHPGCDLAPTTEGR 396
           PG PPSP     G+   P CD+  TT+GR
Sbjct: 160 PGIPPSPPSCGPGSPLMPSCDVHCTTDGR 188


>AK093006-1|BAC04016.1|  177|Homo sapiens protein ( Homo sapiens
           cDNA FLJ35687 fis, clone SPLEN2019349. ).
          Length = 177

 Score = 32.3 bits (70), Expect = 1.3
 Identities = 20/55 (36%), Positives = 23/55 (41%)
 Frame = -2

Query: 257 HPTRRAGVARRSECAWVRRGRPQSSRPYRHLLTAACPLLSSVGSPTRRASR*GPR 93
           H   R   A  + C  V    P+   PY   L AACPLL  +G    R  R  PR
Sbjct: 14  HLCTRLTTASLAHCCSVSPAGPRPRLPYPSELGAACPLLLCLGLSPLRQCRTPPR 68


>AK074727-1|BAC11165.1|  653|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90246 fis, clone NT2RM2001818, weakly similar to
           SIALIDASE (EC 3.2.1.18). ).
          Length = 653

 Score = 32.3 bits (70), Expect = 1.3
 Identities = 14/29 (48%), Positives = 17/29 (58%)
 Frame = +1

Query: 310 PGYPPSPYPGHTGNGAHPGCDLAPTTEGR 396
           PG PPSP     G+   P CD+  TT+GR
Sbjct: 247 PGIPPSPPSCGPGSPLMPSCDVHCTTDGR 275


>AF089090-1|AAG17968.1|  544|Homo sapiens calpain-like protease
           CAPN10b protein.
          Length = 544

 Score = 32.3 bits (70), Expect = 1.3
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
 Frame = -1

Query: 231 AAVGMCVGSSGPTTE*SPLSASSNSRLPTAEFSR-EPHATC 112
           A+  +C+ ++GP T  S  SAS +SR    E +R  PH  C
Sbjct: 500 ASASLCISTAGPVTPSSTPSASISSRSQRVEGARTHPHCCC 540


>AK128780-1|BAC87609.1|  259|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45445 fis, clone BRSSN2013696. ).
          Length = 259

 Score = 31.9 bits (69), Expect = 1.7
 Identities = 13/40 (32%), Positives = 23/40 (57%)
 Frame = -1

Query: 315 PRSYSASIVKGHRSPL*THTSNTSGWSCAAVGMCVGSSGP 196
           PR++S+  ++ H  P     S+++GW  A+ G  + S GP
Sbjct: 55  PRTFSSQALRAHLLPPGGLYSSSTGWRTASAGPALASQGP 94


>BC112202-1|AAI12203.1|  511|Homo sapiens FBXO41 protein protein.
          Length = 511

 Score = 31.1 bits (67), Expect = 3.0
 Identities = 23/71 (32%), Positives = 32/71 (45%)
 Frame = -2

Query: 266 ERTHPTRRAGVARRSECAWVRRGRPQSSRPYRHLLTAACPLLSSVGSPTRRASR*GPRPA 87
           ER+ P R +G+ R++   W RR       P RH        +S VGS T  +   GP  A
Sbjct: 88  ERSQPPRSSGLRRQAIQNWQRR-------PRRHSTEGEEGDVSDVGSRTTESEAEGPLDA 140

Query: 86  ELGGCRNSGPV 54
              G   +GP+
Sbjct: 141 PRPGPAMAGPL 151


>BX000476-1|CAI41974.1|  384|Homo sapiens protein phosphatase 2
           (formerly 2A), regulatory subunit B'', beta protein.
          Length = 384

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 21/54 (38%), Positives = 27/54 (50%)
 Frame = -2

Query: 206 RRGRPQSSRPYRHLLTAACPLLSSVGSPTRRASR*GPRPAELGGCRNSGPVLCP 45
           R   P+SSR    +  AA P  + + SP  R+ R GP+P   GG R SG    P
Sbjct: 101 RPASPRSSRGAGPVPCAAPPQRAVLASP--RSVRGGPKPPGRGGARASGGAAGP 152


>BC089042-1|AAH89042.1| 1636|Homo sapiens protein tyrosine
           phosphatase, non-receptor type 23 protein.
          Length = 1636

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%)
 Frame = +1

Query: 271 GATVPLNY*GTVRP-GYPPSPYPGHTGNGAH 360
           G  +P  + G+  P  +PPSP+P  TG G H
Sbjct: 755 GPRLPDTFLGSATPLHFPPSPFPSSTGPGPH 785


>BC027711-1|AAH27711.2| 1320|Homo sapiens PTPN23 protein protein.
          Length = 1320

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%)
 Frame = +1

Query: 271 GATVPLNY*GTVRP-GYPPSPYPGHTGNGAH 360
           G  +P  + G+  P  +PPSP+P  TG G H
Sbjct: 439 GPRLPDTFLGSATPLHFPPSPFPSSTGPGPH 469


>AL954664-1|CAI41961.1|  384|Homo sapiens protein phosphatase 2
           (formerly 2A), regulatory subunit B'', beta protein.
          Length = 384

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 21/54 (38%), Positives = 27/54 (50%)
 Frame = -2

Query: 206 RRGRPQSSRPYRHLLTAACPLLSSVGSPTRRASR*GPRPAELGGCRNSGPVLCP 45
           R   P+SSR    +  AA P  + + SP  R+ R GP+P   GG R SG    P
Sbjct: 101 RPASPRSSRGAGPVPCAAPPQRAVLASP--RSVRGGPKPPGRGGARASGGAAGP 152


>AL732314-1|CAI41583.1|  384|Homo sapiens protein phosphatase 2
           (formerly 2A), regulatory subunit B'', beta protein.
          Length = 384

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 21/54 (38%), Positives = 27/54 (50%)
 Frame = -2

Query: 206 RRGRPQSSRPYRHLLTAACPLLSSVGSPTRRASR*GPRPAELGGCRNSGPVLCP 45
           R   P+SSR    +  AA P  + + SP  R+ R GP+P   GG R SG    P
Sbjct: 101 RPASPRSSRGAGPVPCAAPPQRAVLASP--RSVRGGPKPPGRGGARASGGAAGP 152


>AL672037-2|CAI16194.1|  630|Homo sapiens eukaryotic translation
           initiation factor 4 gamma,udogene 1 protein.
          Length = 630

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 16/46 (34%), Positives = 20/46 (43%), Gaps = 1/46 (2%)
 Frame = +1

Query: 307 RPGYP-PSPYPGHTGNGAHPGCDLAPTTEGRLGAL*ETPSRPSRNS 441
           +PG P PSPY  H  N  HP     P        L +TP    +N+
Sbjct: 57  QPGTPTPSPYSAHEINKGHPNLAATPPGHASSPGLSQTPYPSGQNA 102


>AL627311-1|CAI14552.1|  630|Homo sapiens eukaryotic translation
           initiation factor 4 gamma,-Asp/His) box polypeptide 11 (
           protein.
          Length = 630

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 16/46 (34%), Positives = 20/46 (43%), Gaps = 1/46 (2%)
 Frame = +1

Query: 307 RPGYP-PSPYPGHTGNGAHPGCDLAPTTEGRLGAL*ETPSRPSRNS 441
           +PG P PSPY  H  N  HP     P        L +TP    +N+
Sbjct: 57  QPGTPTPSPYSAHEINKGHPNLAATPPGHASSPGLSQTPYPSGQNA 102


>AL358392-1|CAI12154.1|  630|Homo sapiens eukaryotic translation
           initiation factor 4 gamma,e protein.
          Length = 630

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 16/46 (34%), Positives = 20/46 (43%), Gaps = 1/46 (2%)
 Frame = +1

Query: 307 RPGYP-PSPYPGHTGNGAHPGCDLAPTTEGRLGAL*ETPSRPSRNS 441
           +PG P PSPY  H  N  HP     P        L +TP    +N+
Sbjct: 57  QPGTPTPSPYSAHEINKGHPNLAATPPGHASSPGLSQTPYPSGQNA 102


>AL110210-1|CAB53676.1|  990|Homo sapiens hypothetical protein
           protein.
          Length = 990

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%)
 Frame = +1

Query: 271 GATVPLNY*GTVRP-GYPPSPYPGHTGNGAH 360
           G  +P  + G+  P  +PPSP+P  TG G H
Sbjct: 109 GPRLPDTFLGSATPLHFPPSPFPSSTGPGPH 139


>AF290614-1|AAK28025.1| 1636|Homo sapiens protein tyrosine
           phosphatase TD14 protein.
          Length = 1636

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%)
 Frame = +1

Query: 271 GATVPLNY*GTVRP-GYPPSPYPGHTGNGAH 360
           G  +P  + G+  P  +PPSP+P  TG G H
Sbjct: 755 GPRLPDTFLGSATPLHFPPSPFPSSTGPGPH 785


>AB209119-1|BAD92356.1| 1780|Homo sapiens eukaryotic translation
           initiation factor 4 gamma, 3 variant protein.
          Length = 1780

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 16/46 (34%), Positives = 20/46 (43%), Gaps = 1/46 (2%)
 Frame = +1

Query: 307 RPGYP-PSPYPGHTGNGAHPGCDLAPTTEGRLGAL*ETPSRPSRNS 441
           +PG P PSPY  H  N  HP     P        L +TP    +N+
Sbjct: 131 QPGTPTPSPYSAHEINKGHPNLAATPPGHASSPGLSQTPYPSGQNA 176


>AB040904-1|BAA95995.2| 1421|Homo sapiens KIAA1471 protein protein.
          Length = 1421

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%)
 Frame = +1

Query: 271 GATVPLNY*GTVRP-GYPPSPYPGHTGNGAH 360
           G  +P  + G+  P  +PPSP+P  TG G H
Sbjct: 793 GPRLPDTFLGSATPLHFPPSPFPSSTGPGPH 823


>AB025194-1|BAB19280.1| 1636|Homo sapiens protein tyrosine
           phosphatase HD-PTP protein.
          Length = 1636

 Score = 30.7 bits (66), Expect = 4.0
 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%)
 Frame = +1

Query: 271 GATVPLNY*GTVRP-GYPPSPYPGHTGNGAH 360
           G  +P  + G+  P  +PPSP+P  TG G H
Sbjct: 755 GPRLPDTFLGSATPLHFPPSPFPSSTGPGPH 785


>BC032691-1|AAH32691.1|  672|Homo sapiens Bardet-Biedl syndrome 7
           protein.
          Length = 672

 Score = 30.3 bits (65), Expect = 5.2
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = +1

Query: 310 PGYPPSPYPGHTGNGAHPGCDLA-PTTEGRLGAL*ETPSRPSR 435
           PG PP+    H GNG   G DL   T++G+L  +  T S+P R
Sbjct: 187 PG-PPTVLALHNGNGGDSGEDLLFGTSDGKLALIQITTSKPVR 228


>AK001577-1|BAA91767.1|  672|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10715 fis, clone NT2RP3001004. ).
          Length = 672

 Score = 30.3 bits (65), Expect = 5.2
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = +1

Query: 310 PGYPPSPYPGHTGNGAHPGCDLA-PTTEGRLGAL*ETPSRPSR 435
           PG PP+    H GNG   G DL   T++G+L  +  T S+P R
Sbjct: 187 PG-PPTVLALHNGNGGDSGEDLLFGTSDGKLALIQITTSKPVR 228


>AF521644-1|AAO16026.1|  715|Homo sapiens BBS7 long isoform protein.
          Length = 715

 Score = 30.3 bits (65), Expect = 5.2
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = +1

Query: 310 PGYPPSPYPGHTGNGAHPGCDLA-PTTEGRLGAL*ETPSRPSR 435
           PG PP+    H GNG   G DL   T++G+L  +  T S+P R
Sbjct: 187 PG-PPTVLALHNGNGGDSGEDLLFGTSDGKLALIQITTSKPVR 228


>AF521643-1|AAO16025.1|  672|Homo sapiens BBS7 short isoform
           protein.
          Length = 672

 Score = 30.3 bits (65), Expect = 5.2
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = +1

Query: 310 PGYPPSPYPGHTGNGAHPGCDLA-PTTEGRLGAL*ETPSRPSR 435
           PG PP+    H GNG   G DL   T++G+L  +  T S+P R
Sbjct: 187 PG-PPTVLALHNGNGGDSGEDLLFGTSDGKLALIQITTSKPVR 228


>AC079341-4|AAY40970.1|  715|Homo sapiens unknown protein.
          Length = 715

 Score = 30.3 bits (65), Expect = 5.2
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = +1

Query: 310 PGYPPSPYPGHTGNGAHPGCDLA-PTTEGRLGAL*ETPSRPSR 435
           PG PP+    H GNG   G DL   T++G+L  +  T S+P R
Sbjct: 187 PG-PPTVLALHNGNGGDSGEDLLFGTSDGKLALIQITTSKPVR 228


>M95610-1|AAA80977.1|  675|Homo sapiens alpha-2 IX collagen protein.
          Length = 675

 Score = 29.9 bits (64), Expect = 6.9
 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 2/48 (4%)
 Frame = +1

Query: 298 GTVRPGYPPSP--YPGHTGNGAHPGCDLAPTTEGRLGAL*ETPSRPSR 435
           G + P  PP P  YPG  G   HPG    P   G +G +  T  +  R
Sbjct: 539 GMMGPPGPPGPPGYPGKQGPHGHPGPRGVPGIVGAVGQIGNTGPKGKR 586


>BX641102-1|CAE46047.1|  685|Homo sapiens hypothetical protein
           protein.
          Length = 685

 Score = 29.9 bits (64), Expect = 6.9
 Identities = 16/49 (32%), Positives = 25/49 (51%)
 Frame = +1

Query: 4   YSAYMTPGA*FSPRGHKTGPELRQPPSSAGRGPQREARRVGLPTELSSG 150
           + ++  PG   +P      P +RQP SS+   P + +  V  PT +SSG
Sbjct: 347 HPSHSRPGPMVTPHNKAKSPGVRQPGSSSSSAPGQPSTGVARPT-VSSG 394


>AL050341-6|CAB81611.1|  689|Homo sapiens collagen type IX alpha 2
           protein.
          Length = 689

 Score = 29.9 bits (64), Expect = 6.9
 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 2/48 (4%)
 Frame = +1

Query: 298 GTVRPGYPPSP--YPGHTGNGAHPGCDLAPTTEGRLGAL*ETPSRPSR 435
           G + P  PP P  YPG  G   HPG    P   G +G +  T  +  R
Sbjct: 553 GMMGPPGPPGPPGYPGKQGPHGHPGPRGVPGIVGAVGQIGNTGPKGKR 600


>AK096760-1|BAC04858.1|  627|Homo sapiens protein ( Homo sapiens
           cDNA FLJ39441 fis, clone PROST2005793. ).
          Length = 627

 Score = 29.9 bits (64), Expect = 6.9
 Identities = 16/49 (32%), Positives = 25/49 (51%)
 Frame = +1

Query: 4   YSAYMTPGA*FSPRGHKTGPELRQPPSSAGRGPQREARRVGLPTELSSG 150
           + ++  PG   +P      P +RQP SS+   P + +  V  PT +SSG
Sbjct: 347 HPSHSRPGPMVTPHNKAKSPGVRQPGSSSSSAPGQPSTGVARPT-VSSG 394


>AF019406-1|AAC33512.1|  689|Homo sapiens collagen type IX alpha 2
           chain protein.
          Length = 689

 Score = 29.9 bits (64), Expect = 6.9
 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 2/48 (4%)
 Frame = +1

Query: 298 GTVRPGYPPSP--YPGHTGNGAHPGCDLAPTTEGRLGAL*ETPSRPSR 435
           G + P  PP P  YPG  G   HPG    P   G +G +  T  +  R
Sbjct: 553 GMMGPPGPPGPPGYPGKQGPHGHPGPRGVPGIVGAVGQIGNTGPKGKR 600


>U43573-1|AAC50513.1|  743|Homo sapiens
           alpha-N-acetylglucosaminidase protein.
          Length = 743

 Score = 29.5 bits (63), Expect = 9.1
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = -1

Query: 387 GRRGEVATRVSPIPSVTRIGRWG-VPRSYSASIVKGHRSPL 268
           G   E  TRV P  +VT++G WG    SYS S +     P+
Sbjct: 247 GHVPEAVTRVFPQVNVTKMGSWGHFNCSYSCSFLLAPEDPI 287


>U43572-1|AAC50512.1|  743|Homo sapiens
           alpha-N-acetylglucosaminidase protein.
          Length = 743

 Score = 29.5 bits (63), Expect = 9.1
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = -1

Query: 387 GRRGEVATRVSPIPSVTRIGRWG-VPRSYSASIVKGHRSPL 268
           G   E  TRV P  +VT++G WG    SYS S +     P+
Sbjct: 247 GHVPEAVTRVFPQVNVTKMGSWGHFNCSYSCSFLLAPEDPI 287


>U40846-1|AAB06188.1|  743|Homo sapiens
           alpha-N-acetylglucosaminidase protein.
          Length = 743

 Score = 29.5 bits (63), Expect = 9.1
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = -1

Query: 387 GRRGEVATRVSPIPSVTRIGRWG-VPRSYSASIVKGHRSPL 268
           G   E  TRV P  +VT++G WG    SYS S +     P+
Sbjct: 247 GHVPEAVTRVFPQVNVTKMGSWGHFNCSYSCSFLLAPEDPI 287


>L78465-1|AAB36605.1|  639|Homo sapiens
           alpha-N-acetylglucosaminidase protein.
          Length = 639

 Score = 29.5 bits (63), Expect = 9.1
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = -1

Query: 387 GRRGEVATRVSPIPSVTRIGRWG-VPRSYSASIVKGHRSPL 268
           G   E  TRV P  +VT++G WG    SYS S +     P+
Sbjct: 143 GHVPEAVTRVFPQVNVTKMGSWGHFNCSYSCSFLLAPEDPI 183


>L78464-1|AAB36604.1|  743|Homo sapiens
           alpha-N-acetylglucosaminidase protein.
          Length = 743

 Score = 29.5 bits (63), Expect = 9.1
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = -1

Query: 387 GRRGEVATRVSPIPSVTRIGRWG-VPRSYSASIVKGHRSPL 268
           G   E  TRV P  +VT++G WG    SYS S +     P+
Sbjct: 247 GHVPEAVTRVFPQVNVTKMGSWGHFNCSYSCSFLLAPEDPI 287


>BC060807-1|AAH60807.1|  354|Homo sapiens CREB/ATF bZIP
           transcription factor protein.
          Length = 354

 Score = 29.5 bits (63), Expect = 9.1
 Identities = 20/48 (41%), Positives = 24/48 (50%)
 Frame = -1

Query: 177 LSASSNSRLPTAEFSREPHATCFALRSPTSRAGRLSQFRTRLMSPG*K 34
           L A+S S  PT   S EP ATC +L S  +RA    +      SPG K
Sbjct: 8   LLAASGSNFPTRSESPEPAATC-SLPSDLTRAAAGEEETAAAGSPGRK 54


>BC053991-1|AAH53991.1|  743|Homo sapiens N-acetylglucosaminidase,
           alpha- (Sanfilippo disease IIIB) protein.
          Length = 743

 Score = 29.5 bits (63), Expect = 9.1
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = -1

Query: 387 GRRGEVATRVSPIPSVTRIGRWG-VPRSYSASIVKGHRSPL 268
           G   E  TRV P  +VT++G WG    SYS S +     P+
Sbjct: 247 GHVPEAVTRVFPQVNVTKMGSWGHFNCSYSCSFLLAPEDPI 287


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 106,938,000
Number of Sequences: 237096
Number of extensions: 2785864
Number of successful extensions: 13353
Number of sequences better than 10.0: 40
Number of HSP's better than 10.0 without gapping: 12088
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13331
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 6098631048
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).