SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0004
         (717 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X04098-1|CAA27723.1|  375|Homo sapiens gamma-actin protein.           298   1e-80
X00351-1|CAA25099.1|  375|Homo sapiens protein ( Human mRNA for ...   298   1e-80
M19283-1|AAA51579.1|  375|Homo sapiens ACTG1 protein.                 298   1e-80
M10277-1|AAA51567.1|  375|Homo sapiens protein ( Human cytoplasm...   298   1e-80
DQ471327-1|ABF01018.1|  375|Homo sapiens PS1TP5-binding protein ...   298   1e-80
BT019856-1|AAV38659.1|  375|Homo sapiens actin, gamma 1 protein.      298   1e-80
BC053572-1|AAH53572.1|  375|Homo sapiens actin, gamma 1 protein.      298   1e-80
BC023548-1|AAH23548.1|  263|Homo sapiens ACTG1 protein protein.       298   1e-80
BC018774-1|AAH18774.1|  375|Homo sapiens ACTG1 protein protein.       298   1e-80
BC017450-1|AAH17450.1|  363|Homo sapiens Unknown (protein for IM...   298   1e-80
BC016045-1|AAH16045.1|  375|Homo sapiens actin, beta protein.         298   1e-80
BC015779-1|AAH15779.1|  375|Homo sapiens ACTG1 protein protein.       298   1e-80
BC015695-1|AAH15695.1|  375|Homo sapiens actin, gamma 1 protein.      298   1e-80
BC015005-1|AAH15005.1|  375|Homo sapiens ACTG1 protein protein.       298   1e-80
BC014861-1|AAH14861.1|  375|Homo sapiens actin, beta protein.         298   1e-80
BC013380-1|AAH13380.1|  375|Homo sapiens actin, beta protein.         298   1e-80
BC012854-1|AAH12854.1|  360|Homo sapiens ACTB protein protein.        298   1e-80
BC012050-1|AAH12050.1|  375|Homo sapiens actin, gamma 1 protein.      298   1e-80
BC010999-1|AAH10999.1|  375|Homo sapiens actin, gamma 1 protein.      298   1e-80
BC010417-1|AAH10417.2|  165|Homo sapiens ACTG1 protein protein.       298   1e-80
BC009848-1|AAH09848.1|  375|Homo sapiens actin, gamma 1 protein.      298   1e-80
BC009544-1|AAH09544.1|  159|Homo sapiens Unknown (protein for IM...   298   1e-80
BC008633-1|AAH08633.1|  368|Homo sapiens actin, beta protein.         298   1e-80
BC007442-1|AAH07442.1|  375|Homo sapiens actin, gamma 1 protein.      298   1e-80
BC004251-1|AAH04251.1|  375|Homo sapiens actin, beta protein.         298   1e-80
BC002409-1|AAH02409.1|  375|Homo sapiens actin, beta protein.         298   1e-80
BC001920-1|AAH01920.1|  375|Homo sapiens ACTG1 protein protein.       298   1e-80
BC001301-1|AAH01301.1|  375|Homo sapiens actin, beta protein.         298   1e-80
BC000292-1|AAH00292.1|  375|Homo sapiens actin, gamma 1 protein.      298   1e-80
AY582799-1|AAS79319.1|  375|Homo sapiens actin, beta protein.         298   1e-80
AC006483-1|AAP22343.1|  375|Homo sapiens unknown protein.             298   1e-80
AK222925-1|BAD96645.1|  375|Homo sapiens beta actin variant prot...   297   2e-80
AK223032-1|BAD96752.1|  375|Homo sapiens beta actin variant prot...   296   4e-80
X63432-1|CAA45026.1|  375|Homo sapiens mutant beta-actin  (beta'...   295   8e-80
AK223055-1|BAD96775.1|  375|Homo sapiens beta actin variant prot...   295   1e-79
M16247-1|AAA51580.1|  232|Homo sapiens ACTG1 protein.                 294   2e-79
X13839-1|CAA32064.1|  377|Homo sapiens protein ( Human mRNA for ...   290   4e-78
J05192-1|AAA51577.1|  377|Homo sapiens ACTA3 protein.                 290   4e-78
J00073-1|AAB59619.1|  377|Homo sapiens alpha-cardiac actin protein.   290   4e-78
CR541795-1|CAG46594.1|  377|Homo sapiens ACTC protein.                290   4e-78
CR536518-1|CAG38756.1|  377|Homo sapiens ACTA2 protein.               290   4e-78
BC093052-1|AAH93052.1|  377|Homo sapiens actin, alpha 2, smooth ...   290   4e-78
BC017554-1|AAH17554.1|  377|Homo sapiens actin, alpha 2, smooth ...   290   4e-78
BC009978-1|AAH09978.1|  377|Homo sapiens actin, alpha, cardiac m...   290   4e-78
AY692464-1|AAW29811.1|  377|Homo sapiens growth-inhibiting gene ...   290   4e-78
AL157394-6|CAI13864.1|  377|Homo sapiens actin, alpha 2, smooth ...   290   4e-78
M20543-1|AAA60296.1|  377|Homo sapiens ACTA1 protein.                 288   2e-77
J00068-1|AAB59376.1|  377|Homo sapiens ACTA1 protein.                 288   2e-77
CR541796-1|CAG46595.1|  377|Homo sapiens ACTA1 protein.               288   2e-77
CR536516-1|CAG38754.1|  377|Homo sapiens ACTA1 protein.               288   2e-77
BC012597-1|AAH12597.1|  377|Homo sapiens actin, alpha 1, skeleta...   288   2e-77
AL160004-6|CAI19050.1|  377|Homo sapiens actin, alpha 1, skeleta...   288   2e-77
AL160004-5|CAI19052.1|  342|Homo sapiens actin, alpha 1, skeleta...   288   2e-77
AL160004-4|CAI19051.1|  287|Homo sapiens actin, alpha 1, skeleta...   288   2e-77
AF182035-1|AAF02694.1|  377|Homo sapiens skeletal muscle alpha-a...   288   2e-77
X16940-1|CAA34814.1|  376|Homo sapiens protein ( Human mRNA for ...   287   2e-77
D00654-1|BAA00546.1|  376|Homo sapiens enteric smooth muscle gam...   287   2e-77
CR541794-1|CAG46593.1|  376|Homo sapiens ACTG2 protein.               287   2e-77
CR536515-1|CAG38753.1|  376|Homo sapiens ACTG2 protein.               287   2e-77
BC094877-1|AAH94877.1|  376|Homo sapiens ACTG2 protein protein.       287   2e-77
BC012617-1|AAH12617.1|  376|Homo sapiens actin, gamma 2, smooth ...   287   2e-77
AC073046-2|AAX88909.1|  376|Homo sapiens unknown protein.             287   2e-77
EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin prot...   276   5e-74
V00478-1|CAA23745.1|  124|Homo sapiens protein ( Human mRNA frag...   265   9e-71
DQ407611-1|ABD66582.1|  151|Homo sapiens beta-actin protein.          264   3e-70
BC092424-1|AAH92424.1|  219|Homo sapiens Unknown (protein for MG...   251   2e-66
EF036500-1|ABO65086.1|  132|Homo sapiens beta-actin protein.          218   2e-56
AY280960-1|AAP37280.1|  254|Homo sapiens actin alpha 1 skeletal ...   196   9e-50
K01747-1|AAA51586.1|  330|Homo sapiens ACTA2 protein.                 188   1e-47
BC007289-1|AAH07289.1|  372|Homo sapiens actin related protein M...   175   2e-43
AB049117-1|BAB39481.1|  372|Homo sapiens actin related protein p...   175   2e-43
AK055346-1|BAB70906.1|  372|Homo sapiens protein ( Homo sapiens ...   170   5e-42
X82207-1|CAA57691.1|  376|Homo sapiens beta-centracetin protein.      168   1e-41
BC010090-1|AAH10090.1|  376|Homo sapiens ARP1 actin-related prot...   168   1e-41
BC006372-1|AAH06372.1|  376|Homo sapiens ARP1 actin-related prot...   168   1e-41
BC004374-1|AAH04374.1|  376|Homo sapiens ARP1 actin-related prot...   168   1e-41
AC017099-2|AAY24280.1|  376|Homo sapiens unknown protein.             168   1e-41
Z14978-1|CAA78701.1|  376|Homo sapiens actin-related protein pro...   167   3e-41
X82206-1|CAA57690.1|  376|Homo sapiens alpha-centractin protein.      167   3e-41
BC026016-1|AAH26016.1|  376|Homo sapiens ARP1 actin-related prot...   167   3e-41
BC000693-1|AAH00693.1|  376|Homo sapiens ARP1 actin-related prot...   167   3e-41
AL121928-12|CAC08404.1|  376|Homo sapiens ARP1 actin-related pro...   167   3e-41
Z74696-1|CAI42428.1|  376|Homo sapiens actin-related protein T1 ...   153   6e-37
BC014597-1|AAH14597.1|  376|Homo sapiens actin-related protein T...   153   6e-37
AF440739-1|AAM00432.1|  376|Homo sapiens actin-related protein T...   153   6e-37
M28424-1|AAB16906.1|   71|Homo sapiens beta-actin protein.            149   7e-36
BC029499-1|AAH29499.1|  376|Homo sapiens actin-related protein T...   149   7e-36
AL356984-1|CAH72587.1|  377|Homo sapiens actin-related protein M...   149   7e-36
AF440740-1|AAM00433.1|  377|Homo sapiens actin-related protein T...   149   7e-36
AB057364-1|BAB85862.1|  377|Homo sapiens actin-related protein h...   149   7e-36
X82208-1|CAA57692.1|  329|Homo sapiens beta-centractin protein.       144   4e-34
BC033789-1|AAH33789.1|  415|Homo sapiens actin-like 7B protein.       143   6e-34
AL359692-3|CAI40570.1|  415|Homo sapiens actin-like 7B protein.       143   6e-34
AF113527-1|AAD44110.1|  415|Homo sapiens actin-like-7-beta protein.   143   6e-34
AB284521-1|BAF41972.1|  415|Homo sapiens t-actin 1 protein.           143   6e-34
BC020944-1|AAH20944.1|  426|Homo sapiens actin-like 6B protein.       140   5e-33
AF041475-1|AAD54678.1|  426|Homo sapiens BAF53b protein.              140   5e-33
AC099394-1|AAP21874.1|  426|Homo sapiens unknown protein.             140   5e-33
AB015906-1|BAA74576.1|  426|Homo sapiens actin-related protein h...   140   5e-33
CR533529-1|CAG38560.1|  429|Homo sapiens BAF53A protein.              135   1e-31
BC036371-1|AAH36371.1|  429|Homo sapiens actin-like 6A protein.       135   2e-31
BC001391-1|AAH01391.1|  429|Homo sapiens actin-like 6A protein.       135   2e-31
BC000949-1|AAH00949.1|  387|Homo sapiens actin-like 6A protein.       135   2e-31
AK223212-1|BAD96932.1|  429|Homo sapiens actin-like 6A isoform 1...   135   2e-31
AF041474-1|AAC94991.1|  429|Homo sapiens BAF53a protein.              135   2e-31
AB061315-1|BAB87848.1|  387|Homo sapiens hArpNbeta-s protein.         135   2e-31
AB060168-1|BAB87844.1|  387|Homo sapiens hArpNbeta-s protein.         135   2e-31
AB015907-1|BAA74577.1|  429|Homo sapiens actin-related protein h...   135   2e-31
BC014610-1|AAH14610.1|  435|Homo sapiens actin-like 7A protein.       134   4e-31
AL359692-4|CAI40571.1|  435|Homo sapiens actin-like 7A protein.       134   4e-31
AF113526-1|AAD44109.1|  435|Homo sapiens actin-like-7-alpha prot...   134   4e-31
AB284520-1|BAF41971.1|  435|Homo sapiens human t-actin 2 protein.     134   4e-31
BC045752-1|AAH45752.1|  416|Homo sapiens hypothetical protein MG...   132   2e-30
BC024028-1|AAH24028.1|  416|Homo sapiens hypothetical protein MG...   132   2e-30
AK127229-1|BAC86893.1|  214|Homo sapiens protein ( Homo sapiens ...   128   1e-29
BC014546-1|AAH14546.1|  394|Homo sapiens ARP2 actin-related prot...   126   6e-29
AF006082-1|AAB64187.1|  394|Homo sapiens Arp2 protein.                126   6e-29
BC036253-1|AAH36253.1|  339|Homo sapiens ACTR2 protein protein.       126   1e-28
BC020234-1|AAH20234.1|  195|Homo sapiens Unknown (protein for MG...   107   4e-23
M33216-1|AAA60560.1|   47|Homo sapiens smooth muscle alpha-actin...   103   5e-22
AL121906-3|CAI22126.1|  245|Homo sapiens chromosome 20 open read...   102   1e-21
AF053356-5|AAC78795.1|  475|Homo sapiens actin like gene protein.      99   8e-21
BC015107-1|AAH15107.1|  396|Homo sapiens ARP6 actin-related prot...    98   3e-20
AK222959-1|BAD96679.1|  396|Homo sapiens ARP6 actin-related prot...    98   3e-20
AK023684-1|BAB14640.1|  288|Homo sapiens protein ( Homo sapiens ...    98   3e-20
AK023495-1|BAB14588.1|  396|Homo sapiens protein ( Homo sapiens ...    98   3e-20
AF212251-1|AAK14934.1|  396|Homo sapiens CDA12 protein.                98   3e-20
AB038229-1|BAB20762.1|  396|Homo sapiens hARPX protein.                98   3e-20
BC028909-1|AAH28909.1|  366|Homo sapiens actin-like 8 protein.         89   1e-17
AL136529-1|CAC15940.1|  366|Homo sapiens actin-like 8 protein.         89   1e-17
AK057339-1|BAB71434.1|  366|Homo sapiens protein ( Homo sapiens ...    89   1e-17
BC008682-1|AAH08682.1|  418|Homo sapiens ARP3 actin-related prot...    87   8e-17
AF023453-1|AAC98904.1|  418|Homo sapiens actin-related protein 3...    87   8e-17
AB209174-1|BAD92411.1|  282|Homo sapiens actin-related protein 3...    87   8e-17
BC044590-1|AAH44590.1|  418|Homo sapiens ARP3 actin-related prot...    86   1e-16
BC001324-1|AAH01324.1|  415|Homo sapiens ACTR5 protein protein.        86   1e-16
AL133519-2|CAD37358.1|  607|Homo sapiens ARP5 actin-related prot...    86   1e-16
AK022847-1|BAB14270.1|  607|Homo sapiens protein ( Homo sapiens ...    86   1e-16
AF127773-1|AAD51904.1|  418|Homo sapiens unknown protein.              86   1e-16
AF006083-1|AAB64188.1|  418|Homo sapiens Arp3 protein.                 86   1e-16
AC110769-1|AAX93226.1|  418|Homo sapiens unknown protein.              86   1e-16
AB209353-1|BAD92590.1|  369|Homo sapiens ARP3 actin-related prot...    86   1e-16
BC038402-1|AAH38402.1|  607|Homo sapiens ARP5 actin-related prot...    86   1e-16
BC006162-1|AAH06162.1|  342|Homo sapiens ACTR5 protein protein.        86   1e-16
AK058153-1|BAB71690.1|  328|Homo sapiens protein ( Homo sapiens ...    81   4e-15
U20582-1|AAA62476.1|  302|Homo sapiens protein ( Human actin-lik...    68   4e-11
AF086920-1|AAP97150.1|  402|Homo sapiens actin related protein A...    58   2e-08
BC011997-1|AAH11997.1|  417|Homo sapiens actin-related protein 1...    58   4e-08
AK222702-1|BAD96422.1|  417|Homo sapiens uncharacterized hypotha...    58   4e-08
AK022534-1|BAB14083.1|  417|Homo sapiens protein ( Homo sapiens ...    58   4e-08
AK000544-1|BAA91243.1|  417|Homo sapiens protein ( Homo sapiens ...    58   4e-08
AF220190-1|AAF67655.1|  417|Homo sapiens uncharacterized hypotha...    58   4e-08
AK222624-1|BAD96344.1|  417|Homo sapiens uncharacterized hypotha...    57   5e-08
BC032744-1|AAH32744.1|  329|Homo sapiens ACTR8 protein protein.        47   8e-05
AK026232-1|BAB15402.1|  374|Homo sapiens protein ( Homo sapiens ...    47   8e-05
AK022996-1|BAB14352.1|  624|Homo sapiens protein ( Homo sapiens ...    47   8e-05
BC005208-1|AAH05208.1|  339|Homo sapiens Unknown (protein for IM...    46   1e-04
AB039791-1|BAB21501.1|  210|Homo sapiens actin-related protein A...    38   0.036
BC015207-1|AAH15207.1|  348|Homo sapiens ARP3 actin-related prot...    37   0.083
BC057819-1|AAH57819.1|  156|Homo sapiens chromosome 1 open readi...    35   0.33 
AL929472-10|CAH70085.1|  156|Homo sapiens chromosome 1 open read...    35   0.33 
AK127381-1|BAC86950.1|  156|Homo sapiens protein ( Homo sapiens ...    35   0.33 
U48959-1|AAC18423.2| 1914|Homo sapiens myosin light chain kinase...    30   9.5  
AF069603-1|AAD15923.1| 1793|Homo sapiens myosin light chain kina...    30   9.5  
AF069602-1|AAD15922.1| 1862|Homo sapiens myosin light chain kina...    30   9.5  
AF069601-1|AAD15921.2| 1845|Homo sapiens myosin light chain kina...    30   9.5  

>X04098-1|CAA27723.1|  375|Homo sapiens gamma-actin protein.
          Length = 375

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>X00351-1|CAA25099.1|  375|Homo sapiens protein ( Human mRNA for
           beta-actin. ).
          Length = 375

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>M19283-1|AAA51579.1|  375|Homo sapiens ACTG1 protein.
          Length = 375

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>M10277-1|AAA51567.1|  375|Homo sapiens protein ( Human cytoplasmic
           beta-actin gene, complete cds. ).
          Length = 375

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>DQ471327-1|ABF01018.1|  375|Homo sapiens PS1TP5-binding protein 1
           protein.
          Length = 375

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>BT019856-1|AAV38659.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>BC053572-1|AAH53572.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>BC023548-1|AAH23548.1|  263|Homo sapiens ACTG1 protein protein.
          Length = 263

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 124 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 183

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 184 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 243

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 244 WISKQEYDESGPSIVHRKCF 263


>BC018774-1|AAH18774.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>BC017450-1|AAH17450.1|  363|Homo sapiens Unknown (protein for
           IMAGE:3538275) protein.
          Length = 363

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 224 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 283

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 284 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 343

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 344 WISKQEYDESGPSIVHRKCF 363


>BC016045-1|AAH16045.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>BC015779-1|AAH15779.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>BC015695-1|AAH15695.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>BC015005-1|AAH15005.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>BC014861-1|AAH14861.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>BC013380-1|AAH13380.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>BC012854-1|AAH12854.1|  360|Homo sapiens ACTB protein protein.
          Length = 360

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 221 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 280

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 281 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 340

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 341 WISKQEYDESGPSIVHRKCF 360


>BC012050-1|AAH12050.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>BC010999-1|AAH10999.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>BC010417-1|AAH10417.2|  165|Homo sapiens ACTG1 protein protein.
          Length = 165

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 26  LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 85

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 86  NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 145

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 146 WISKQEYDESGPSIVHRKCF 165


>BC009848-1|AAH09848.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>BC009544-1|AAH09544.1|  159|Homo sapiens Unknown (protein for
           IMAGE:3897065) protein.
          Length = 159

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 20  LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 79

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 80  NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 139

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 140 WISKQEYDESGPSIVHRKCF 159


>BC008633-1|AAH08633.1|  368|Homo sapiens actin, beta protein.
          Length = 368

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 229 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 288

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 289 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 348

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 349 WISKQEYDESGPSIVHRKCF 368


>BC007442-1|AAH07442.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>BC004251-1|AAH04251.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>BC002409-1|AAH02409.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>BC001920-1|AAH01920.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>BC001301-1|AAH01301.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>BC000292-1|AAH00292.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>AY582799-1|AAS79319.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>AC006483-1|AAP22343.1|  375|Homo sapiens unknown protein.
          Length = 375

 Score =  298 bits (731), Expect = 1e-80
 Identities = 138/140 (98%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>AK222925-1|BAD96645.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  297 bits (730), Expect = 2e-80
 Identities = 137/140 (97%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGS+LASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSVLASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>AK223032-1|BAD96752.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  296 bits (727), Expect = 4e-80
 Identities = 137/140 (97%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRM+KEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMRKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>X63432-1|CAA45026.1|  375|Homo sapiens mutant beta-actin
           (beta'-actin) protein.
          Length = 375

 Score =  295 bits (725), Expect = 8e-80
 Identities = 137/140 (97%), Positives = 139/140 (99%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLY 
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYD 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>AK223055-1|BAD96775.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  295 bits (724), Expect = 1e-79
 Identities = 137/140 (97%), Positives = 139/140 (99%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSI ASLSTFQQM
Sbjct: 296 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSIPASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>M16247-1|AAA51580.1|  232|Homo sapiens ACTG1 protein.
          Length = 232

 Score =  294 bits (721), Expect = 2e-79
 Identities = 136/140 (97%), Positives = 139/140 (99%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 93  LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 152

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQK+ITALAPSTMKIKIIAPPERKYSVWIGG ILASLSTFQQM
Sbjct: 153 NTVLSGGTTMYPGIADRMQKKITALAPSTMKIKIIAPPERKYSVWIGGFILASLSTFQQM 212

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 213 WISKQEYDESGPSIVHRKCF 232


>X13839-1|CAA32064.1|  377|Homo sapiens protein ( Human mRNA for
           vascular smooth muscle alpha-actin. ).
          Length = 377

 Score =  290 bits (711), Expect = 4e-78
 Identities = 133/140 (95%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 238 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDE+GPSIVHRKCF
Sbjct: 358 WISKQEYDEAGPSIVHRKCF 377


>J05192-1|AAA51577.1|  377|Homo sapiens ACTA3 protein.
          Length = 377

 Score =  290 bits (711), Expect = 4e-78
 Identities = 133/140 (95%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 238 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDE+GPSIVHRKCF
Sbjct: 358 WISKQEYDEAGPSIVHRKCF 377


>J00073-1|AAB59619.1|  377|Homo sapiens alpha-cardiac actin protein.
          Length = 377

 Score =  290 bits (711), Expect = 4e-78
 Identities = 133/140 (95%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 238 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDE+GPSIVHRKCF
Sbjct: 358 WISKQEYDEAGPSIVHRKCF 377


>CR541795-1|CAG46594.1|  377|Homo sapiens ACTC protein.
          Length = 377

 Score =  290 bits (711), Expect = 4e-78
 Identities = 133/140 (95%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 238 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDE+GPSIVHRKCF
Sbjct: 358 WISKQEYDEAGPSIVHRKCF 377


>CR536518-1|CAG38756.1|  377|Homo sapiens ACTA2 protein.
          Length = 377

 Score =  290 bits (711), Expect = 4e-78
 Identities = 133/140 (95%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 238 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDE+GPSIVHRKCF
Sbjct: 358 WISKQEYDEAGPSIVHRKCF 377


>BC093052-1|AAH93052.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  290 bits (711), Expect = 4e-78
 Identities = 133/140 (95%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 238 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDE+GPSIVHRKCF
Sbjct: 358 WISKQEYDEAGPSIVHRKCF 377


>BC017554-1|AAH17554.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  290 bits (711), Expect = 4e-78
 Identities = 133/140 (95%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 238 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDE+GPSIVHRKCF
Sbjct: 358 WISKQEYDEAGPSIVHRKCF 377


>BC009978-1|AAH09978.1|  377|Homo sapiens actin, alpha, cardiac
           muscle 1 protein.
          Length = 377

 Score =  290 bits (711), Expect = 4e-78
 Identities = 133/140 (95%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 238 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDE+GPSIVHRKCF
Sbjct: 358 WISKQEYDEAGPSIVHRKCF 377


>AY692464-1|AAW29811.1|  377|Homo sapiens growth-inhibiting gene 46
           protein.
          Length = 377

 Score =  290 bits (711), Expect = 4e-78
 Identities = 133/140 (95%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 238 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDE+GPSIVHRKCF
Sbjct: 358 WISKQEYDEAGPSIVHRKCF 377


>AL157394-6|CAI13864.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  290 bits (711), Expect = 4e-78
 Identities = 133/140 (95%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 238 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDE+GPSIVHRKCF
Sbjct: 358 WISKQEYDEAGPSIVHRKCF 377


>M20543-1|AAA60296.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  288 bits (706), Expect = 2e-77
 Identities = 131/140 (93%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 238 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N V+SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WI+KQEYDE+GPSIVHRKCF
Sbjct: 358 WITKQEYDEAGPSIVHRKCF 377


>J00068-1|AAB59376.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  288 bits (706), Expect = 2e-77
 Identities = 131/140 (93%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 238 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N V+SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WI+KQEYDE+GPSIVHRKCF
Sbjct: 358 WITKQEYDEAGPSIVHRKCF 377


>CR541796-1|CAG46595.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  288 bits (706), Expect = 2e-77
 Identities = 131/140 (93%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 238 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N V+SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WI+KQEYDE+GPSIVHRKCF
Sbjct: 358 WITKQEYDEAGPSIVHRKCF 377


>CR536516-1|CAG38754.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  288 bits (706), Expect = 2e-77
 Identities = 131/140 (93%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 238 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N V+SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WI+KQEYDE+GPSIVHRKCF
Sbjct: 358 WITKQEYDEAGPSIVHRKCF 377


>BC012597-1|AAH12597.1|  377|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 377

 Score =  288 bits (706), Expect = 2e-77
 Identities = 131/140 (93%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 238 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N V+SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WI+KQEYDE+GPSIVHRKCF
Sbjct: 358 WITKQEYDEAGPSIVHRKCF 377


>AL160004-6|CAI19050.1|  377|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 377

 Score =  288 bits (706), Expect = 2e-77
 Identities = 131/140 (93%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 238 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N V+SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WI+KQEYDE+GPSIVHRKCF
Sbjct: 358 WITKQEYDEAGPSIVHRKCF 377


>AL160004-5|CAI19052.1|  342|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 342

 Score =  288 bits (706), Expect = 2e-77
 Identities = 131/140 (93%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 203 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 262

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N V+SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 263 NNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 322

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WI+KQEYDE+GPSIVHRKCF
Sbjct: 323 WITKQEYDEAGPSIVHRKCF 342


>AL160004-4|CAI19051.1|  287|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 287

 Score =  288 bits (706), Expect = 2e-77
 Identities = 131/140 (93%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 148 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 207

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N V+SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 208 NNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 267

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WI+KQEYDE+GPSIVHRKCF
Sbjct: 268 WITKQEYDEAGPSIVHRKCF 287


>AF182035-1|AAF02694.1|  377|Homo sapiens skeletal muscle
           alpha-actin precursor protein.
          Length = 377

 Score =  288 bits (706), Expect = 2e-77
 Identities = 131/140 (93%), Positives = 137/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 238 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N V+SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 298 NNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WI+KQEYDE+GPSIVHRKCF
Sbjct: 358 WITKQEYDEAGPSIVHRKCF 377


>X16940-1|CAA34814.1|  376|Homo sapiens protein ( Human mRNA for
           enteric smooth muscle gamma-actin. ).
          Length = 376

 Score =  287 bits (705), Expect = 2e-77
 Identities = 132/140 (94%), Positives = 136/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISK EYDE+GPSIVHRKCF
Sbjct: 357 WISKPEYDEAGPSIVHRKCF 376


>D00654-1|BAA00546.1|  376|Homo sapiens enteric smooth muscle
           gamma-actin protein.
          Length = 376

 Score =  287 bits (705), Expect = 2e-77
 Identities = 132/140 (94%), Positives = 136/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISK EYDE+GPSIVHRKCF
Sbjct: 357 WISKPEYDEAGPSIVHRKCF 376


>CR541794-1|CAG46593.1|  376|Homo sapiens ACTG2 protein.
          Length = 376

 Score =  287 bits (705), Expect = 2e-77
 Identities = 132/140 (94%), Positives = 136/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISK EYDE+GPSIVHRKCF
Sbjct: 357 WISKPEYDEAGPSIVHRKCF 376


>CR536515-1|CAG38753.1|  376|Homo sapiens ACTG2 protein.
          Length = 376

 Score =  287 bits (705), Expect = 2e-77
 Identities = 132/140 (94%), Positives = 136/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISK EYDE+GPSIVHRKCF
Sbjct: 357 WISKPEYDEAGPSIVHRKCF 376


>BC094877-1|AAH94877.1|  376|Homo sapiens ACTG2 protein protein.
          Length = 376

 Score =  287 bits (705), Expect = 2e-77
 Identities = 132/140 (94%), Positives = 136/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISK EYDE+GPSIVHRKCF
Sbjct: 357 WISKPEYDEAGPSIVHRKCF 376


>BC012617-1|AAH12617.1|  376|Homo sapiens actin, gamma 2, smooth
           muscle, enteric protein.
          Length = 376

 Score =  287 bits (705), Expect = 2e-77
 Identities = 132/140 (94%), Positives = 136/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISK EYDE+GPSIVHRKCF
Sbjct: 357 WISKPEYDEAGPSIVHRKCF 376


>AC073046-2|AAX88909.1|  376|Homo sapiens unknown protein.
          Length = 376

 Score =  287 bits (705), Expect = 2e-77
 Identities = 132/140 (94%), Positives = 136/140 (97%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISK EYDE+GPSIVHRKCF
Sbjct: 357 WISKPEYDEAGPSIVHRKCF 376


>EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin protein.
          Length = 1075

 Score =  276 bits (677), Expect = 5e-74
 Identities = 127/139 (91%), Positives = 133/139 (95%)
 Frame = -3

Query: 706  LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
            LEKSYELPDGQVITIGNERFRCPEALFQP FLGME+CGIHETT+NSIMK DVDIRKDLY 
Sbjct: 936  LEKSYELPDGQVITIGNERFRCPEALFQPCFLGMESCGIHETTFNSIMKSDVDIRKDLYT 995

Query: 526  NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
            NTVLSGGTTMYPG+A RMQKEI ALAPS MKI+IIAPP+RKYSVW+GGSILASLSTFQQM
Sbjct: 996  NTVLSGGTTMYPGMAHRMQKEIAALAPSMMKIRIIAPPKRKYSVWVGGSILASLSTFQQM 1055

Query: 346  WISKQEYDESGPSIVHRKC 290
            WISKQEYDESGPSIVHRKC
Sbjct: 1056 WISKQEYDESGPSIVHRKC 1074


>V00478-1|CAA23745.1|  124|Homo sapiens protein ( Human mRNA
           fragment encoding cytoplasmic actin. (isolated from
           cultured epidermal cells grown from human foreskin).  ).
          Length = 124

 Score =  265 bits (650), Expect = 9e-71
 Identities = 122/124 (98%), Positives = 124/124 (100%)
 Frame = -3

Query: 658 NERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIAD 479
           NERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYANTVLSGGTTMYPGIAD
Sbjct: 1   NERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIAD 60

Query: 478 RMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 299
           RMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH
Sbjct: 61  RMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 120

Query: 298 RKCF 287
           RKCF
Sbjct: 121 RKCF 124


>DQ407611-1|ABD66582.1|  151|Homo sapiens beta-actin protein.
          Length = 151

 Score =  264 bits (646), Expect = 3e-70
 Identities = 123/125 (98%), Positives = 125/125 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 27  LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 86

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 87  NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 146

Query: 346 WISKQ 332
           WISKQ
Sbjct: 147 WISKQ 151


>BC092424-1|AAH92424.1|  219|Homo sapiens Unknown (protein for
           MGC:102982) protein.
          Length = 219

 Score =  251 bits (614), Expect = 2e-66
 Identities = 119/140 (85%), Positives = 126/140 (90%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSY+LP+GQVITI N+ F CPEALFQ SF+GME+CGIHETT+NSIMK DVDI KDLYA
Sbjct: 80  LEKSYKLPNGQVITISNKWFCCPEALFQTSFVGMESCGIHETTFNSIMKSDVDIYKDLYA 139

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSG TTMYP I +RMQKEITALAPS MKIKIIAPPE KYSVWI GSILASLSTFQQM
Sbjct: 140 NTVLSGSTTMYPSITNRMQKEITALAPSAMKIKIIAPPECKYSVWIRGSILASLSTFQQM 199

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEY ES PSIVHRKCF
Sbjct: 200 WISKQEYSESSPSIVHRKCF 219


>EF036500-1|ABO65086.1|  132|Homo sapiens beta-actin protein.
          Length = 132

 Score =  218 bits (532), Expect = 2e-56
 Identities = 101/103 (98%), Positives = 103/103 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYA
Sbjct: 30  LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYA 89

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYS 398
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYS
Sbjct: 90  NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYS 132


>AY280960-1|AAP37280.1|  254|Homo sapiens actin alpha 1 skeletal
           muscle protein protein.
          Length = 254

 Score =  196 bits (477), Expect = 9e-50
 Identities = 90/103 (87%), Positives = 97/103 (94%)
 Frame = -3

Query: 595 GIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAP 416
           GI   + + +MKCD+DIRKDLYAN V+SGGTTMYPGIADRMQKEITALAPSTMKIKIIAP
Sbjct: 152 GIVLDSGDGVMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAP 211

Query: 415 PERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 287
           PERKYSVWIGGSILASLSTFQQMWI+KQEYDE+GPSIVHRKCF
Sbjct: 212 PERKYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 254


>K01747-1|AAA51586.1|  330|Homo sapiens ACTA2 protein.
          Length = 330

 Score =  188 bits (459), Expect = 1e-47
 Identities = 86/93 (92%), Positives = 89/93 (95%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+ GIHETTYNSIMKCD+DIRKDLYA
Sbjct: 238 LEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYA 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIK 428
           N VLSGGTTMYPGI DRMQKEITALAPSTMKIK
Sbjct: 298 NNVLSGGTTMYPGIVDRMQKEITALAPSTMKIK 330


>BC007289-1|AAH07289.1|  372|Homo sapiens actin related protein M1
           protein.
          Length = 372

 Score =  175 bits (425), Expect = 2e-43
 Identities = 74/140 (52%), Positives = 105/140 (75%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEK Y+LPDG+VI + ++ F CPEALF P  + +EA GI +  ++SIMKCD  +R   ++
Sbjct: 233 LEKVYQLPDGKVIQLHDQLFSCPEALFSPCHMNLEAPGIDKICFSSIMKCDTGLRNSFFS 292

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N +L+GG+T +PG+  R+ K+I  +AP+   +++IAPPERK SVW+GGSILASLS FQ M
Sbjct: 293 NIILAGGSTSFPGLDKRLVKDIAKVAPANTAVQVIAPPERKISVWMGGSILASLSAFQDM 352

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WI+  E+ E GP+IVH++CF
Sbjct: 353 WITAAEFKEVGPNIVHQRCF 372


>AB049117-1|BAB39481.1|  372|Homo sapiens actin related protein
           protein.
          Length = 372

 Score =  175 bits (425), Expect = 2e-43
 Identities = 74/140 (52%), Positives = 105/140 (75%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEK Y+LPDG+VI + ++ F CPEALF P  + +EA GI +  ++SIMKCD  +R   ++
Sbjct: 233 LEKVYQLPDGKVIQLHDQLFSCPEALFSPCHMNLEAPGIDKICFSSIMKCDTGLRNSFFS 292

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N +L+GG+T +PG+  R+ K+I  +AP+   +++IAPPERK SVW+GGSILASLS FQ M
Sbjct: 293 NIILAGGSTSFPGLDKRLVKDIAKVAPANTAVQVIAPPERKISVWMGGSILASLSAFQDM 352

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WI+  E+ E GP+IVH++CF
Sbjct: 353 WITAAEFKEVGPNIVHQRCF 372


>AK055346-1|BAB70906.1|  372|Homo sapiens protein ( Homo sapiens
           cDNA FLJ30784 fis, clone FEBRA2000881, moderately
           similar to ACTIN 6. ).
          Length = 372

 Score =  170 bits (413), Expect = 5e-42
 Identities = 73/140 (52%), Positives = 104/140 (74%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEK Y+LPDG+VI + ++ F CPEALF P  + +EA GI +  ++SIMK D  +R   ++
Sbjct: 233 LEKVYQLPDGKVIQLHDQLFSCPEALFSPCHMNLEAPGIDKICFSSIMKRDTGLRNSFFS 292

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N +L+GG+T +PG+  R+ K+I  +AP+   +++IAPPERK SVW+GGSILASLS FQ M
Sbjct: 293 NIILAGGSTSFPGLDKRLVKDIAKVAPANTAVQVIAPPERKISVWMGGSILASLSAFQDM 352

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WI+  E+ E GP+IVH++CF
Sbjct: 353 WITAAEFKEVGPNIVHQRCF 372


>X82207-1|CAA57691.1|  376|Homo sapiens beta-centracetin protein.
          Length = 376

 Score =  168 bits (409), Expect = 1e-41
 Identities = 75/136 (55%), Positives = 97/136 (71%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           Y LPDG  + +G  RFR PE LFQP  +G E+ G+HE    +I K D+D+R+ L+AN VL
Sbjct: 241 YTLPDGSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHKSDMDLRRTLFANIVL 300

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK 335
           SGG+T++ G  DR+  E+  LAP  +KIKI AP ER YS WIGGSILASL TF++MW+SK
Sbjct: 301 SGGSTLFKGFGDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILASLDTFKKMWVSK 360

Query: 334 QEYDESGPSIVHRKCF 287
           +EY+E G   +HRK F
Sbjct: 361 KEYEEDGSRAIHRKTF 376


>BC010090-1|AAH10090.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score =  168 bits (409), Expect = 1e-41
 Identities = 75/136 (55%), Positives = 97/136 (71%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           Y LPDG  + +G  RFR PE LFQP  +G E+ G+HE    +I K D+D+R+ L+AN VL
Sbjct: 241 YTLPDGSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHKSDMDLRRTLFANIVL 300

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK 335
           SGG+T++ G  DR+  E+  LAP  +KIKI AP ER YS WIGGSILASL TF++MW+SK
Sbjct: 301 SGGSTLFKGFGDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILASLDTFKKMWVSK 360

Query: 334 QEYDESGPSIVHRKCF 287
           +EY+E G   +HRK F
Sbjct: 361 KEYEEDGSRAIHRKTF 376


>BC006372-1|AAH06372.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score =  168 bits (409), Expect = 1e-41
 Identities = 75/136 (55%), Positives = 97/136 (71%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           Y LPDG  + +G  RFR PE LFQP  +G E+ G+HE    +I K D+D+R+ L+AN VL
Sbjct: 241 YTLPDGSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHKSDMDLRRTLFANIVL 300

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK 335
           SGG+T++ G  DR+  E+  LAP  +KIKI AP ER YS WIGGSILASL TF++MW+SK
Sbjct: 301 SGGSTLFKGFGDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILASLDTFKKMWVSK 360

Query: 334 QEYDESGPSIVHRKCF 287
           +EY+E G   +HRK F
Sbjct: 361 KEYEEDGSRAIHRKTF 376


>BC004374-1|AAH04374.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score =  168 bits (409), Expect = 1e-41
 Identities = 75/136 (55%), Positives = 97/136 (71%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           Y LPDG  + +G  RFR PE LFQP  +G E+ G+HE    +I K D+D+R+ L+AN VL
Sbjct: 241 YTLPDGSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHKSDMDLRRTLFANIVL 300

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK 335
           SGG+T++ G  DR+  E+  LAP  +KIKI AP ER YS WIGGSILASL TF++MW+SK
Sbjct: 301 SGGSTLFKGFGDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILASLDTFKKMWVSK 360

Query: 334 QEYDESGPSIVHRKCF 287
           +EY+E G   +HRK F
Sbjct: 361 KEYEEDGSRAIHRKTF 376


>AC017099-2|AAY24280.1|  376|Homo sapiens unknown protein.
          Length = 376

 Score =  168 bits (409), Expect = 1e-41
 Identities = 75/136 (55%), Positives = 97/136 (71%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           Y LPDG  + +G  RFR PE LFQP  +G E+ G+HE    +I K D+D+R+ L+AN VL
Sbjct: 241 YTLPDGSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHKSDMDLRRTLFANIVL 300

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK 335
           SGG+T++ G  DR+  E+  LAP  +KIKI AP ER YS WIGGSILASL TF++MW+SK
Sbjct: 301 SGGSTLFKGFGDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILASLDTFKKMWVSK 360

Query: 334 QEYDESGPSIVHRKCF 287
           +EY+E G   +HRK F
Sbjct: 361 KEYEEDGSRAIHRKTF 376


>Z14978-1|CAA78701.1|  376|Homo sapiens actin-related protein
           protein.
          Length = 376

 Score =  167 bits (407), Expect = 3e-41
 Identities = 75/136 (55%), Positives = 97/136 (71%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           Y LPDG  I IG  RFR PE LF+P  +G E+ GIHE    +I K D+D+R+ L++N VL
Sbjct: 241 YYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVL 300

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK 335
           SGG+T++ G  DR+  E+  LAP  +KI+I AP ER YS WIGGSILASL TF++MW+SK
Sbjct: 301 SGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSK 360

Query: 334 QEYDESGPSIVHRKCF 287
           +EY+E G   +HRK F
Sbjct: 361 KEYEEDGARSIHRKTF 376


>X82206-1|CAA57690.1|  376|Homo sapiens alpha-centractin protein.
          Length = 376

 Score =  167 bits (407), Expect = 3e-41
 Identities = 75/136 (55%), Positives = 97/136 (71%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           Y LPDG  I IG  RFR PE LF+P  +G E+ GIHE    +I K D+D+R+ L++N VL
Sbjct: 241 YYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVL 300

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK 335
           SGG+T++ G  DR+  E+  LAP  +KI+I AP ER YS WIGGSILASL TF++MW+SK
Sbjct: 301 SGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSK 360

Query: 334 QEYDESGPSIVHRKCF 287
           +EY+E G   +HRK F
Sbjct: 361 KEYEEDGARSIHRKTF 376


>BC026016-1|AAH26016.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score =  167 bits (407), Expect = 3e-41
 Identities = 75/136 (55%), Positives = 97/136 (71%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           Y LPDG  I IG  RFR PE LF+P  +G E+ GIHE    +I K D+D+R+ L++N VL
Sbjct: 241 YYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVL 300

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK 335
           SGG+T++ G  DR+  E+  LAP  +KI+I AP ER YS WIGGSILASL TF++MW+SK
Sbjct: 301 SGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSK 360

Query: 334 QEYDESGPSIVHRKCF 287
           +EY+E G   +HRK F
Sbjct: 361 KEYEEDGARSIHRKTF 376


>BC000693-1|AAH00693.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score =  167 bits (407), Expect = 3e-41
 Identities = 75/136 (55%), Positives = 97/136 (71%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           Y LPDG  I IG  RFR PE LF+P  +G E+ GIHE    +I K D+D+R+ L++N VL
Sbjct: 241 YYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVL 300

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK 335
           SGG+T++ G  DR+  E+  LAP  +KI+I AP ER YS WIGGSILASL TF++MW+SK
Sbjct: 301 SGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSK 360

Query: 334 QEYDESGPSIVHRKCF 287
           +EY+E G   +HRK F
Sbjct: 361 KEYEEDGARSIHRKTF 376


>AL121928-12|CAC08404.1|  376|Homo sapiens ARP1 actin-related
           protein 1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score =  167 bits (407), Expect = 3e-41
 Identities = 75/136 (55%), Positives = 97/136 (71%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           Y LPDG  I IG  RFR PE LF+P  +G E+ GIHE    +I K D+D+R+ L++N VL
Sbjct: 241 YYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVL 300

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK 335
           SGG+T++ G  DR+  E+  LAP  +KI+I AP ER YS WIGGSILASL TF++MW+SK
Sbjct: 301 SGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSK 360

Query: 334 QEYDESGPSIVHRKCF 287
           +EY+E G   +HRK F
Sbjct: 361 KEYEEDGARSIHRKTF 376


>Z74696-1|CAI42428.1|  376|Homo sapiens actin-related protein T1
           (ACTRT1) protein.
          Length = 376

 Score =  153 bits (371), Expect = 6e-37
 Identities = 67/137 (48%), Positives = 95/137 (69%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTV 518
           +Y LPDG VI  G+E ++ PE LF P  LG+ + G+ +   +SIMKCD DI+  LYA+ V
Sbjct: 240 AYRLPDGHVIHFGDELYQVPEVLFAPDQLGIHSPGLSKMVSSSIMKCDTDIQNKLYADIV 299

Query: 517 LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 338
           LSGGTT+ PG+ +R+ KE+  LA     IKI A P+R +S WIG SI+ S+S+F+QMW++
Sbjct: 300 LSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDRCFSAWIGASIMTSMSSFKQMWVT 359

Query: 337 KQEYDESGPSIVHRKCF 287
             ++ E G S+V R+CF
Sbjct: 360 SADFKEYGTSVVQRRCF 376


>BC014597-1|AAH14597.1|  376|Homo sapiens actin-related protein T1
           protein.
          Length = 376

 Score =  153 bits (371), Expect = 6e-37
 Identities = 67/137 (48%), Positives = 95/137 (69%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTV 518
           +Y LPDG VI  G+E ++ PE LF P  LG+ + G+ +   +SIMKCD DI+  LYA+ V
Sbjct: 240 AYRLPDGHVIHFGDELYQVPEVLFAPDQLGIHSPGLSKMVSSSIMKCDTDIQNKLYADIV 299

Query: 517 LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 338
           LSGGTT+ PG+ +R+ KE+  LA     IKI A P+R +S WIG SI+ S+S+F+QMW++
Sbjct: 300 LSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDRCFSAWIGASIMTSMSSFKQMWVT 359

Query: 337 KQEYDESGPSIVHRKCF 287
             ++ E G S+V R+CF
Sbjct: 360 SADFKEYGTSVVQRRCF 376


>AF440739-1|AAM00432.1|  376|Homo sapiens actin-related protein T1
           protein.
          Length = 376

 Score =  153 bits (371), Expect = 6e-37
 Identities = 67/137 (48%), Positives = 95/137 (69%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTV 518
           +Y LPDG VI  G+E ++ PE LF P  LG+ + G+ +   +SIMKCD DI+  LYA+ V
Sbjct: 240 AYRLPDGHVIHFGDELYQVPEVLFAPDQLGIRSPGLSKMVSSSIMKCDTDIQNKLYADIV 299

Query: 517 LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 338
           LSGGTT+ PG+ +R+ KE+  LA     IKI A P+R +S WIG SI+ S+S+F+QMW++
Sbjct: 300 LSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDRCFSAWIGASIMTSMSSFKQMWVT 359

Query: 337 KQEYDESGPSIVHRKCF 287
             ++ E G S+V R+CF
Sbjct: 360 SADFKEYGTSVVQRRCF 376


>M28424-1|AAB16906.1|   71|Homo sapiens beta-actin protein.
          Length = 71

 Score =  149 bits (362), Expect = 7e-36
 Identities = 69/71 (97%), Positives = 71/71 (100%)
 Frame = -3

Query: 628 FQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA 449
           FQPSFLGME+CGIHETT+NSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA
Sbjct: 1   FQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA 60

Query: 448 PSTMKIKIIAP 416
           PSTMKIKIIAP
Sbjct: 61  PSTMKIKIIAP 71


>BC029499-1|AAH29499.1|  376|Homo sapiens actin-related protein T2
           protein.
          Length = 376

 Score =  149 bits (362), Expect = 7e-36
 Identities = 66/138 (47%), Positives = 95/138 (68%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 521
           + Y+LPDG +I++G+   + PEALF P  LG ++ G+     +SI KCD DI+K L+   
Sbjct: 239 REYKLPDGNIISLGDPLHQAPEALFVPQQLGSQSPGLSNMVSSSITKCDTDIQKILFGEI 298

Query: 520 VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 341
           VLSGGTT++ G+ DR+ KE+  LA     IKI APP+R +S WIG SI+ SLS+F+QMW+
Sbjct: 299 VLSGGTTLFHGLDDRLLKELEQLASKDTPIKITAPPDRWFSTWIGASIVTSLSSFKQMWV 358

Query: 340 SKQEYDESGPSIVHRKCF 287
           +  ++ E G S+V R+CF
Sbjct: 359 TAADFKEFGTSVVQRRCF 376


>AL356984-1|CAH72587.1|  377|Homo sapiens actin-related protein M2
           (ARPM2) protein.
          Length = 377

 Score =  149 bits (362), Expect = 7e-36
 Identities = 66/138 (47%), Positives = 95/138 (68%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 521
           + Y+LPDG +I++G+   + PEALF P  LG ++ G+     +SI KCD DI+K L+   
Sbjct: 240 REYKLPDGNIISLGDPLHQAPEALFVPQQLGSQSPGLSNMVSSSITKCDTDIQKILFGEI 299

Query: 520 VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 341
           VLSGGTT++ G+ DR+ KE+  LA     IKI APP+R +S WIG SI+ SLS+F+QMW+
Sbjct: 300 VLSGGTTLFHGLDDRLLKELEQLASKDTPIKITAPPDRWFSTWIGASIVTSLSSFKQMWV 359

Query: 340 SKQEYDESGPSIVHRKCF 287
           +  ++ E G S+V R+CF
Sbjct: 360 TAADFKEFGTSVVQRRCF 377


>AF440740-1|AAM00433.1|  377|Homo sapiens actin-related protein T2
           protein.
          Length = 377

 Score =  149 bits (362), Expect = 7e-36
 Identities = 66/138 (47%), Positives = 95/138 (68%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 521
           + Y+LPDG +I++G+   + PEALF P  LG ++ G+     +SI KCD DI+K L+   
Sbjct: 240 REYKLPDGNIISLGDPLHQAPEALFVPQQLGSQSPGLSNMVSSSITKCDTDIQKILFGEI 299

Query: 520 VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 341
           VLSGGTT++ G+ DR+ KE+  LA     IKI APP+R +S WIG SI+ SLS+F+QMW+
Sbjct: 300 VLSGGTTLFHGLDDRLLKELEQLASKDTPIKITAPPDRWFSTWIGASIVTSLSSFKQMWV 359

Query: 340 SKQEYDESGPSIVHRKCF 287
           +  ++ E G S+V R+CF
Sbjct: 360 TAADFKEFGTSVVQRRCF 377


>AB057364-1|BAB85862.1|  377|Homo sapiens actin-related protein
           hArpM2 protein.
          Length = 377

 Score =  149 bits (362), Expect = 7e-36
 Identities = 66/138 (47%), Positives = 95/138 (68%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 521
           + Y+LPDG +I++G+   + PEALF P  LG ++ G+     +SI KCD DI+K L+   
Sbjct: 240 REYKLPDGNIISLGDPLHQAPEALFVPQQLGSQSPGLSNMVSSSITKCDTDIQKILFGEI 299

Query: 520 VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 341
           VLSGGTT++ G+ DR+ KE+  LA     IKI APP+R +S WIG SI+ SLS+F+QMW+
Sbjct: 300 VLSGGTTLFHGLDDRLLKELEQLASKDTPIKITAPPDRWFSTWIGASIVTSLSSFKQMWV 359

Query: 340 SKQEYDESGPSIVHRKCF 287
           +  ++ E G S+V R+CF
Sbjct: 360 TAADFKEFGTSVVQRRCF 377


>X82208-1|CAA57692.1|  329|Homo sapiens beta-centractin protein.
          Length = 329

 Score =  144 bits (348), Expect = 4e-34
 Identities = 65/117 (55%), Positives = 83/117 (70%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           Y LPDG  + +G  RFR PE LFQP  +G E+ G+HE    +I K D+D+R+ L+AN VL
Sbjct: 211 YTLPDGSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHKSDMDLRRTLFANIVL 270

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMW 344
           SGG+T++ G  DR+  E+  LAP  +KIKI AP ER YS WIGGSILASL TF++MW
Sbjct: 271 SGGSTLFKGFGDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILASLDTFKKMW 327


>BC033789-1|AAH33789.1|  415|Homo sapiens actin-like 7B protein.
          Length = 415

 Score =  143 bits (346), Expect = 6e-34
 Identities = 68/140 (48%), Positives = 90/140 (64%), Gaps = 1/140 (0%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC-DVDIRKDLY 530
           L   YELPDG++ITIG ERFRC E LFQPS  G    G+ E T   + +C D   ++++ 
Sbjct: 277 LRVDYELPDGKLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMA 336

Query: 529 ANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQ 350
           AN +L GG TM  G  +R Q+E++ L P      + A PERK SVW GGSILASL  FQQ
Sbjct: 337 ANVLLCGGCTMLDGFPERFQRELSLLCPGDSPA-VAAAPERKTSVWTGGSILASLQAFQQ 395

Query: 349 MWISKQEYDESGPSIVHRKC 290
           +W+SK+E++E G   ++ KC
Sbjct: 396 LWVSKEEFEERGSVAIYSKC 415


>AL359692-3|CAI40570.1|  415|Homo sapiens actin-like 7B protein.
          Length = 415

 Score =  143 bits (346), Expect = 6e-34
 Identities = 68/140 (48%), Positives = 90/140 (64%), Gaps = 1/140 (0%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC-DVDIRKDLY 530
           L   YELPDG++ITIG ERFRC E LFQPS  G    G+ E T   + +C D   ++++ 
Sbjct: 277 LRVDYELPDGKLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMA 336

Query: 529 ANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQ 350
           AN +L GG TM  G  +R Q+E++ L P      + A PERK SVW GGSILASL  FQQ
Sbjct: 337 ANVLLCGGCTMLDGFPERFQRELSLLCPGDSPA-VAAAPERKTSVWTGGSILASLQAFQQ 395

Query: 349 MWISKQEYDESGPSIVHRKC 290
           +W+SK+E++E G   ++ KC
Sbjct: 396 LWVSKEEFEERGSVAIYSKC 415


>AF113527-1|AAD44110.1|  415|Homo sapiens actin-like-7-beta protein.
          Length = 415

 Score =  143 bits (346), Expect = 6e-34
 Identities = 68/140 (48%), Positives = 90/140 (64%), Gaps = 1/140 (0%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC-DVDIRKDLY 530
           L   YELPDG++ITIG ERFRC E LFQPS  G    G+ E T   + +C D   ++++ 
Sbjct: 277 LRVDYELPDGKLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMA 336

Query: 529 ANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQ 350
           AN +L GG TM  G  +R Q+E++ L P      + A PERK SVW GGSILASL  FQQ
Sbjct: 337 ANVLLCGGCTMLDGFPERFQRELSLLCPGDSPA-VAAAPERKTSVWTGGSILASLQAFQQ 395

Query: 349 MWISKQEYDESGPSIVHRKC 290
           +W+SK+E++E G   ++ KC
Sbjct: 396 LWVSKEEFEERGSVAIYSKC 415


>AB284521-1|BAF41972.1|  415|Homo sapiens t-actin 1 protein.
          Length = 415

 Score =  143 bits (346), Expect = 6e-34
 Identities = 68/140 (48%), Positives = 90/140 (64%), Gaps = 1/140 (0%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC-DVDIRKDLY 530
           L   YELPDG++ITIG ERFRC E LFQPS  G    G+ E T   + +C D   ++++ 
Sbjct: 277 LRVDYELPDGKLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMA 336

Query: 529 ANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQ 350
           AN +L GG TM  G  +R Q+E++ L P      + A PERK SVW GGSILASL  FQQ
Sbjct: 337 ANVLLCGGCTMLDGFPERFQRELSLLCPGDSPA-VAAAPERKTSVWTGGSILASLQAFQQ 395

Query: 349 MWISKQEYDESGPSIVHRKC 290
           +W+SK+E++E G   ++ KC
Sbjct: 396 LWVSKEEFEERGSVAIYSKC 415


>BC020944-1|AAH20944.1|  426|Homo sapiens actin-like 6B protein.
          Length = 426

 Score =  140 bits (339), Expect = 5e-33
 Identities = 69/142 (48%), Positives = 89/142 (62%), Gaps = 7/142 (4%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFL----GMEACGIHETTYNSIMKCDVDIRKDLYA 527
           YE+P+G     G ER R PE LF PS +    G    G+      SI  CD+DIR  LY 
Sbjct: 284 YEMPNGYNTDYGAERLRIPEGLFDPSNVKGLSGNTMLGVGHVVTTSIGMCDIDIRPGLYG 343

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP---ERKYSVWIGGSILASLSTF 356
           + +++GG T+  G  DR+ +E++   P +M++K+IA     ERK+S WIGGSILASL TF
Sbjct: 344 SVIVTGGNTLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERKFSPWIGGSILASLGTF 403

Query: 355 QQMWISKQEYDESGPSIVHRKC 290
           QQMWISKQEY+E G   V RKC
Sbjct: 404 QQMWISKQEYEEGGKQCVERKC 425


>AF041475-1|AAD54678.1|  426|Homo sapiens BAF53b protein.
          Length = 426

 Score =  140 bits (339), Expect = 5e-33
 Identities = 69/142 (48%), Positives = 89/142 (62%), Gaps = 7/142 (4%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFL----GMEACGIHETTYNSIMKCDVDIRKDLYA 527
           YE+P+G     G ER R PE LF PS +    G    G+      SI  CD+DIR  LY 
Sbjct: 284 YEMPNGYNTDYGAERLRIPEGLFDPSNVKGLSGNTMLGVGHVVTTSIGMCDIDIRPGLYG 343

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP---ERKYSVWIGGSILASLSTF 356
           + +++GG T+  G  DR+ +E++   P +M++K+IA     ERK+S WIGGSILASL TF
Sbjct: 344 SVIVTGGNTLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERKFSPWIGGSILASLGTF 403

Query: 355 QQMWISKQEYDESGPSIVHRKC 290
           QQMWISKQEY+E G   V RKC
Sbjct: 404 QQMWISKQEYEEGGKQCVERKC 425


>AC099394-1|AAP21874.1|  426|Homo sapiens unknown protein.
          Length = 426

 Score =  140 bits (339), Expect = 5e-33
 Identities = 69/142 (48%), Positives = 89/142 (62%), Gaps = 7/142 (4%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFL----GMEACGIHETTYNSIMKCDVDIRKDLYA 527
           YE+P+G     G ER R PE LF PS +    G    G+      SI  CD+DIR  LY 
Sbjct: 284 YEMPNGYNTDYGAERLRIPEGLFDPSNVKGLSGNTMLGVGHVVTTSIGMCDIDIRPGLYG 343

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP---ERKYSVWIGGSILASLSTF 356
           + +++GG T+  G  DR+ +E++   P +M++K+IA     ERK+S WIGGSILASL TF
Sbjct: 344 SVIVTGGNTLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERKFSPWIGGSILASLGTF 403

Query: 355 QQMWISKQEYDESGPSIVHRKC 290
           QQMWISKQEY+E G   V RKC
Sbjct: 404 QQMWISKQEYEEGGKQCVERKC 425


>AB015906-1|BAA74576.1|  426|Homo sapiens actin-related protein
           hArpN alpha protein.
          Length = 426

 Score =  140 bits (339), Expect = 5e-33
 Identities = 69/142 (48%), Positives = 89/142 (62%), Gaps = 7/142 (4%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFL----GMEACGIHETTYNSIMKCDVDIRKDLYA 527
           YE+P+G     G ER R PE LF PS +    G    G+      SI  CD+DIR  LY 
Sbjct: 284 YEMPNGYNTDYGAERLRIPEGLFDPSNVKGLSGNTMLGVGHVVTTSIGMCDIDIRPGLYG 343

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP---ERKYSVWIGGSILASLSTF 356
           + +++GG T+  G  DR+ +E++   P +M++K+IA     ERK+S WIGGSILASL TF
Sbjct: 344 SVIVTGGNTLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERKFSPWIGGSILASLGTF 403

Query: 355 QQMWISKQEYDESGPSIVHRKC 290
           QQMWISKQEY+E G   V RKC
Sbjct: 404 QQMWISKQEYEEGGKQCVERKC 425


>CR533529-1|CAG38560.1|  429|Homo sapiens BAF53A protein.
          Length = 429

 Score =  135 bits (327), Expect = 1e-31
 Identities = 65/142 (45%), Positives = 87/142 (61%), Gaps = 7/142 (4%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFL----GMEACGIHETTYNSIMKCDVDIRKDLYA 527
           YE P+G     G ER + PE LF PS +    G    G+      S+  CD+DIR  LY 
Sbjct: 287 YEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGKTMLGVSHVVTTSVGMCDIDIRPGLYG 346

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA---PPERKYSVWIGGSILASLSTF 356
           + +++GG T+     DR+ +E++   P +M++K+IA     ER++S WIGGSILASL TF
Sbjct: 347 SVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTF 406

Query: 355 QQMWISKQEYDESGPSIVHRKC 290
           QQMWISKQEY+E G   V RKC
Sbjct: 407 QQMWISKQEYEEGGKQCVERKC 428


>BC036371-1|AAH36371.1|  429|Homo sapiens actin-like 6A protein.
          Length = 429

 Score =  135 bits (326), Expect = 2e-31
 Identities = 65/142 (45%), Positives = 87/142 (61%), Gaps = 7/142 (4%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFL----GMEACGIHETTYNSIMKCDVDIRKDLYA 527
           YE P+G     G ER + PE LF PS +    G    G+      S+  CD+DIR  LY 
Sbjct: 287 YEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYG 346

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA---PPERKYSVWIGGSILASLSTF 356
           + +++GG T+     DR+ +E++   P +M++K+IA     ER++S WIGGSILASL TF
Sbjct: 347 SVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTF 406

Query: 355 QQMWISKQEYDESGPSIVHRKC 290
           QQMWISKQEY+E G   V RKC
Sbjct: 407 QQMWISKQEYEEGGKQCVERKC 428


>BC001391-1|AAH01391.1|  429|Homo sapiens actin-like 6A protein.
          Length = 429

 Score =  135 bits (326), Expect = 2e-31
 Identities = 65/142 (45%), Positives = 87/142 (61%), Gaps = 7/142 (4%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFL----GMEACGIHETTYNSIMKCDVDIRKDLYA 527
           YE P+G     G ER + PE LF PS +    G    G+      S+  CD+DIR  LY 
Sbjct: 287 YEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYG 346

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA---PPERKYSVWIGGSILASLSTF 356
           + +++GG T+     DR+ +E++   P +M++K+IA     ER++S WIGGSILASL TF
Sbjct: 347 SVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTF 406

Query: 355 QQMWISKQEYDESGPSIVHRKC 290
           QQMWISKQEY+E G   V RKC
Sbjct: 407 QQMWISKQEYEEGGKQCVERKC 428


>BC000949-1|AAH00949.1|  387|Homo sapiens actin-like 6A protein.
          Length = 387

 Score =  135 bits (326), Expect = 2e-31
 Identities = 65/142 (45%), Positives = 87/142 (61%), Gaps = 7/142 (4%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFL----GMEACGIHETTYNSIMKCDVDIRKDLYA 527
           YE P+G     G ER + PE LF PS +    G    G+      S+  CD+DIR  LY 
Sbjct: 245 YEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYG 304

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA---PPERKYSVWIGGSILASLSTF 356
           + +++GG T+     DR+ +E++   P +M++K+IA     ER++S WIGGSILASL TF
Sbjct: 305 SVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTF 364

Query: 355 QQMWISKQEYDESGPSIVHRKC 290
           QQMWISKQEY+E G   V RKC
Sbjct: 365 QQMWISKQEYEEGGKQCVERKC 386


>AK223212-1|BAD96932.1|  429|Homo sapiens actin-like 6A isoform 1
           variant protein.
          Length = 429

 Score =  135 bits (326), Expect = 2e-31
 Identities = 65/142 (45%), Positives = 87/142 (61%), Gaps = 7/142 (4%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFL----GMEACGIHETTYNSIMKCDVDIRKDLYA 527
           YE P+G     G ER + PE LF PS +    G    G+      S+  CD+DIR  LY 
Sbjct: 287 YEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYG 346

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA---PPERKYSVWIGGSILASLSTF 356
           + +++GG T+     DR+ +E++   P +M++K+IA     ER++S WIGGSILASL TF
Sbjct: 347 SVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTF 406

Query: 355 QQMWISKQEYDESGPSIVHRKC 290
           QQMWISKQEY+E G   V RKC
Sbjct: 407 QQMWISKQEYEEGGKQCVERKC 428


>AF041474-1|AAC94991.1|  429|Homo sapiens BAF53a protein.
          Length = 429

 Score =  135 bits (326), Expect = 2e-31
 Identities = 65/142 (45%), Positives = 87/142 (61%), Gaps = 7/142 (4%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFL----GMEACGIHETTYNSIMKCDVDIRKDLYA 527
           YE P+G     G ER + PE LF PS +    G    G+      S+  CD+DIR  LY 
Sbjct: 287 YEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYG 346

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA---PPERKYSVWIGGSILASLSTF 356
           + +++GG T+     DR+ +E++   P +M++K+IA     ER++S WIGGSILASL TF
Sbjct: 347 SVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTF 406

Query: 355 QQMWISKQEYDESGPSIVHRKC 290
           QQMWISKQEY+E G   V RKC
Sbjct: 407 QQMWISKQEYEEGGKQCVERKC 428


>AB061315-1|BAB87848.1|  387|Homo sapiens hArpNbeta-s protein.
          Length = 387

 Score =  135 bits (326), Expect = 2e-31
 Identities = 65/142 (45%), Positives = 87/142 (61%), Gaps = 7/142 (4%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFL----GMEACGIHETTYNSIMKCDVDIRKDLYA 527
           YE P+G     G ER + PE LF PS +    G    G+      S+  CD+DIR  LY 
Sbjct: 245 YEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYG 304

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA---PPERKYSVWIGGSILASLSTF 356
           + +++GG T+     DR+ +E++   P +M++K+IA     ER++S WIGGSILASL TF
Sbjct: 305 SVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTF 364

Query: 355 QQMWISKQEYDESGPSIVHRKC 290
           QQMWISKQEY+E G   V RKC
Sbjct: 365 QQMWISKQEYEEGGKQCVERKC 386


>AB060168-1|BAB87844.1|  387|Homo sapiens hArpNbeta-s protein.
          Length = 387

 Score =  135 bits (326), Expect = 2e-31
 Identities = 65/142 (45%), Positives = 87/142 (61%), Gaps = 7/142 (4%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFL----GMEACGIHETTYNSIMKCDVDIRKDLYA 527
           YE P+G     G ER + PE LF PS +    G    G+      S+  CD+DIR  LY 
Sbjct: 245 YEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYG 304

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA---PPERKYSVWIGGSILASLSTF 356
           + +++GG T+     DR+ +E++   P +M++K+IA     ER++S WIGGSILASL TF
Sbjct: 305 SVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTF 364

Query: 355 QQMWISKQEYDESGPSIVHRKC 290
           QQMWISKQEY+E G   V RKC
Sbjct: 365 QQMWISKQEYEEGGKQCVERKC 386


>AB015907-1|BAA74577.1|  429|Homo sapiens actin-related protein
           hArpN beta protein.
          Length = 429

 Score =  135 bits (326), Expect = 2e-31
 Identities = 65/142 (45%), Positives = 87/142 (61%), Gaps = 7/142 (4%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFL----GMEACGIHETTYNSIMKCDVDIRKDLYA 527
           YE P+G     G ER + PE LF PS +    G    G+      S+  CD+DIR  LY 
Sbjct: 287 YEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYG 346

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA---PPERKYSVWIGGSILASLSTF 356
           + +++GG T+     DR+ +E++   P +M++K+IA     ER++S WIGGSILASL TF
Sbjct: 347 SVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTF 406

Query: 355 QQMWISKQEYDESGPSIVHRKC 290
           QQMWISKQEY+E G   V RKC
Sbjct: 407 QQMWISKQEYEEGGKQCVERKC 428


>BC014610-1|AAH14610.1|  435|Homo sapiens actin-like 7A protein.
          Length = 435

 Score =  134 bits (323), Expect = 4e-31
 Identities = 59/137 (43%), Positives = 91/137 (66%), Gaps = 1/137 (0%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           Y LPDG+ I +  ERF C E  F+PS +     G+H  T + + KCD+ +++DL  N +L
Sbjct: 301 YVLPDGKEIQLCQERFLCSEMFFKPSLIKSMQLGLHTQTVSCLNKCDIALKRDLMGNILL 360

Query: 514 SGGTTMYPGIADRMQKEITALAPS-TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 338
            GG+TM  G  +R+QKE++++ P+ T ++ ++  PER  +VW GGSILASL  FQ +W+ 
Sbjct: 361 CGGSTMLSGFPNRLQKELSSMCPNDTPQVNVL--PERDSAVWTGGSILASLQGFQPLWVH 418

Query: 337 KQEYDESGPSIVHRKCF 287
           + EY+E GP  ++R+CF
Sbjct: 419 RFEYEEHGPFFLYRRCF 435


>AL359692-4|CAI40571.1|  435|Homo sapiens actin-like 7A protein.
          Length = 435

 Score =  134 bits (323), Expect = 4e-31
 Identities = 59/137 (43%), Positives = 91/137 (66%), Gaps = 1/137 (0%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           Y LPDG+ I +  ERF C E  F+PS +     G+H  T + + KCD+ +++DL  N +L
Sbjct: 301 YVLPDGKEIQLCQERFLCSEMFFKPSLIKSMQLGLHTQTVSCLNKCDIALKRDLMGNILL 360

Query: 514 SGGTTMYPGIADRMQKEITALAPS-TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 338
            GG+TM  G  +R+QKE++++ P+ T ++ ++  PER  +VW GGSILASL  FQ +W+ 
Sbjct: 361 CGGSTMLSGFPNRLQKELSSMCPNDTPQVNVL--PERDSAVWTGGSILASLQGFQPLWVH 418

Query: 337 KQEYDESGPSIVHRKCF 287
           + EY+E GP  ++R+CF
Sbjct: 419 RFEYEEHGPFFLYRRCF 435


>AF113526-1|AAD44109.1|  435|Homo sapiens actin-like-7-alpha
           protein.
          Length = 435

 Score =  134 bits (323), Expect = 4e-31
 Identities = 59/137 (43%), Positives = 91/137 (66%), Gaps = 1/137 (0%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           Y LPDG+ I +  ERF C E  F+PS +     G+H  T + + KCD+ +++DL  N +L
Sbjct: 301 YVLPDGKEIQLCQERFLCSEMFFKPSLIKSMQLGLHTQTVSCLNKCDIALKRDLMGNILL 360

Query: 514 SGGTTMYPGIADRMQKEITALAPS-TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 338
            GG+TM  G  +R+QKE++++ P+ T ++ ++  PER  +VW GGSILASL  FQ +W+ 
Sbjct: 361 CGGSTMLSGFPNRLQKELSSMCPNDTPQVNVL--PERDSAVWTGGSILASLQGFQPLWVH 418

Query: 337 KQEYDESGPSIVHRKCF 287
           + EY+E GP  ++R+CF
Sbjct: 419 RFEYEEHGPFFLYRRCF 435


>AB284520-1|BAF41971.1|  435|Homo sapiens human t-actin 2 protein.
          Length = 435

 Score =  134 bits (323), Expect = 4e-31
 Identities = 59/137 (43%), Positives = 91/137 (66%), Gaps = 1/137 (0%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           Y LPDG+ I +  ERF C E  F+PS +     G+H  T + + KCD+ +++DL  N +L
Sbjct: 301 YVLPDGKEIQLCQERFLCSEMFFKPSLIKSMQLGLHTQTVSCLNKCDIALKRDLMGNILL 360

Query: 514 SGGTTMYPGIADRMQKEITALAPS-TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 338
            GG+TM  G  +R+QKE++++ P+ T ++ ++  PER  +VW GGSILASL  FQ +W+ 
Sbjct: 361 CGGSTMLSGFPNRLQKELSSMCPNDTPQVNVL--PERDSAVWTGGSILASLQGFQPLWVH 418

Query: 337 KQEYDESGPSIVHRKCF 287
           + EY+E GP  ++R+CF
Sbjct: 419 RFEYEEHGPFFLYRRCF 435


>BC045752-1|AAH45752.1|  416|Homo sapiens hypothetical protein
           MGC33407 protein.
          Length = 416

 Score =  132 bits (318), Expect = 2e-30
 Identities = 56/140 (40%), Positives = 89/140 (63%), Gaps = 1/140 (0%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQPSFL-GMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +++ +LPDG+ +T+G E F+CPE LF P  + G+   G+      S+ K  +++R DL  
Sbjct: 277 KRTLKLPDGRTVTLGKELFQCPELLFNPPEVPGLSPVGLSTMAKQSLRKLSLEMRADLAQ 336

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N +L GG++++ G   R + E+    P+   + + A P R +SVWIGGSILASL  FQ  
Sbjct: 337 NVLLCGGSSLFTGFEGRFRAELLRALPAETHVVVAAQPTRNFSVWIGGSILASLRAFQSC 396

Query: 346 WISKQEYDESGPSIVHRKCF 287
           W+ +++Y+E GP IV+RKC+
Sbjct: 397 WVLREQYEEQGPYIVYRKCY 416


>BC024028-1|AAH24028.1|  416|Homo sapiens hypothetical protein
           MGC33407 protein.
          Length = 416

 Score =  132 bits (318), Expect = 2e-30
 Identities = 56/140 (40%), Positives = 89/140 (63%), Gaps = 1/140 (0%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQPSFL-GMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +++ +LPDG+ +T+G E F+CPE LF P  + G+   G+      S+ K  +++R DL  
Sbjct: 277 KRTLKLPDGRTVTLGKELFQCPELLFNPPEVPGLSPVGLSTMAKQSLRKLSLEMRADLAQ 336

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N +L GG++++ G   R + E+    P+   + + A P R +SVWIGGSILASL  FQ  
Sbjct: 337 NVLLCGGSSLFTGFEGRFRAELLRALPAETHVVVAAQPTRNFSVWIGGSILASLRAFQSC 396

Query: 346 WISKQEYDESGPSIVHRKCF 287
           W+ +++Y+E GP IV+RKC+
Sbjct: 397 WVLREQYEEQGPYIVYRKCY 416


>AK127229-1|BAC86893.1|  214|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45296 fis, clone BRHIP3003340, moderately
           similar to Actin, alpha skeletal muscle 2. ).
          Length = 214

 Score =  128 bits (310), Expect = 1e-29
 Identities = 59/65 (90%), Positives = 62/65 (95%)
 Frame = -3

Query: 619 SFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPST 440
           SF GME+ GIHETTYNSIMKCD+DIRKDLYAN VLSGGTTMYPGIADRMQKEITALAPST
Sbjct: 121 SFPGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPST 180

Query: 439 MKIKI 425
           MKIK+
Sbjct: 181 MKIKV 185


>BC014546-1|AAH14546.1|  394|Homo sapiens ARP2 actin-related protein
           2 homolog (yeast) protein.
          Length = 394

 Score =  126 bits (305), Expect = 6e-29
 Identities = 60/149 (40%), Positives = 91/149 (61%), Gaps = 12/149 (8%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           L +SY LPDG++I +G ERF  PEALFQP  + +E  G+ E  +N+I   D+D R + Y 
Sbjct: 240 LVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYK 299

Query: 526 NTVLSGGTTMYPGIADRMQKEITAL-----------APSTMKIKIIAPPERKYSVWIGGS 380
           + VLSGG+TMYPG+  R+++E+  L             S  KI+I  PP RK+ V++GG+
Sbjct: 300 HIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGA 359

Query: 379 ILAS-LSTFQQMWISKQEYDESGPSIVHR 296
           +LA  +      W+++QEY E G  ++ +
Sbjct: 360 VLADIMKDKDNFWMTRQEYQEKGVRVLEK 388


>AF006082-1|AAB64187.1|  394|Homo sapiens Arp2 protein.
          Length = 394

 Score =  126 bits (305), Expect = 6e-29
 Identities = 60/149 (40%), Positives = 91/149 (61%), Gaps = 12/149 (8%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           L +SY LPDG++I +G ERF  PEALFQP  + +E  G+ E  +N+I   D+D R + Y 
Sbjct: 240 LVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYK 299

Query: 526 NTVLSGGTTMYPGIADRMQKEITAL-----------APSTMKIKIIAPPERKYSVWIGGS 380
           + VLSGG+TMYPG+  R+++E+  L             S  KI+I  PP RK+ V++GG+
Sbjct: 300 HIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGA 359

Query: 379 ILAS-LSTFQQMWISKQEYDESGPSIVHR 296
           +LA  +      W+++QEY E G  ++ +
Sbjct: 360 VLADIMKDKDNFWMTRQEYQEKGVRVLEK 388


>BC036253-1|AAH36253.1|  339|Homo sapiens ACTR2 protein protein.
          Length = 339

 Score =  126 bits (303), Expect = 1e-28
 Identities = 60/149 (40%), Positives = 90/149 (60%), Gaps = 12/149 (8%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           L +SY LPDG++I +G ERF  PEALFQP  + +E  G+ E  +N+I   D+D R + Y 
Sbjct: 185 LVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYK 244

Query: 526 NTVLSGGTTMYPGIADRMQKEITAL-----------APSTMKIKIIAPPERKYSVWIGGS 380
           + VLSGG+TMYPG+  R+++E+  L             S  KI I  PP RK+ V++GG+
Sbjct: 245 HIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKISIEDPPRRKHMVFLGGA 304

Query: 379 ILAS-LSTFQQMWISKQEYDESGPSIVHR 296
           +LA  +      W+++QEY E G  ++ +
Sbjct: 305 VLADIMKDKDNFWMTRQEYQEKGVRVLEK 333


>BC020234-1|AAH20234.1|  195|Homo sapiens Unknown (protein for
           MGC:31938) protein.
          Length = 195

 Score =  107 bits (257), Expect = 4e-23
 Identities = 52/78 (66%), Positives = 56/78 (71%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSY+L    V+TI NE F CPEAL QPSFLGME+C I ET   SIMKCDVDI KDLY 
Sbjct: 118 LEKSYKLSHSLVVTISNEWFWCPEALSQPSFLGMESCCIQETILTSIMKCDVDICKDLYT 177

Query: 526 NTVLSGGTTMYPGIADRM 473
           N VLSG   M+P I  RM
Sbjct: 178 NVVLSGSIAMHPSITHRM 195


>M33216-1|AAA60560.1|   47|Homo sapiens smooth muscle alpha-actin
           protein.
          Length = 47

 Score =  103 bits (248), Expect = 5e-22
 Identities = 46/47 (97%), Positives = 47/47 (100%)
 Frame = -3

Query: 427 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 287
           IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE+GPSIVHRKCF
Sbjct: 1   IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 47


>AL121906-3|CAI22126.1|  245|Homo sapiens chromosome 20 open reading
           frame 134 protein.
          Length = 245

 Score =  102 bits (244), Expect = 1e-21
 Identities = 47/137 (34%), Positives = 81/137 (59%), Gaps = 4/137 (2%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTV 518
           S+ + +G  + + +ERFRCPE +FQP  LG    G+    + ++ K    +R  L    V
Sbjct: 105 SFSVGNGCCVCLSSERFRCPEPIFQPGLLGQAEQGLPALAFRALQKMPKTLRTRLADTVV 164

Query: 517 LSGGTTMYPGIADRMQKEITALAP----STMKIKIIAPPERKYSVWIGGSILASLSTFQQ 350
           L+GG+T++PG A+R+ KE+ A       + ++  ++A   R  +VW GGS++ASL +FQ+
Sbjct: 165 LAGGSTLFPGFAERLDKELEAQCRRHGYAALRPHLVAKHGRGMAVWTGGSMVASLHSFQR 224

Query: 349 MWISKQEYDESGPSIVH 299
            WI++  Y E G  +++
Sbjct: 225 RWITRAMYQECGSRLLY 241


>AF053356-5|AAC78795.1|  475|Homo sapiens actin like gene protein.
          Length = 475

 Score =   99 bits (238), Expect = 8e-21
 Identities = 51/117 (43%), Positives = 70/117 (59%), Gaps = 7/117 (5%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFL----GMEACGIHETTYNSIMKCDVDIRKDLYA 527
           YE+P+G     G ER R PE LF PS +    G    G+      SI  CD+DIR  LY 
Sbjct: 284 YEMPNGYNTDYGAERLRIPEGLFDPSNVKGLSGNTMLGVGHVVTTSIGMCDIDIRPGLYG 343

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA---PPERKYSVWIGGSILASL 365
           + +++GG T+  G  DR+ +E++   P +M++K+IA     ERK+S WIGGSILASL
Sbjct: 344 SVIVTGGNTLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERKFSPWIGGSILASL 400


>BC015107-1|AAH15107.1|  396|Homo sapiens ARP6 actin-related protein
           6 homolog (yeast) protein.
          Length = 396

 Score = 97.9 bits (233), Expect = 3e-20
 Identities = 40/128 (31%), Positives = 72/128 (56%)
 Frame = -3

Query: 676 QVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTM 497
           Q++ + NERF  PE LF PS +G++  GI E    SI     +++   + N VL+GG ++
Sbjct: 266 QILRLANERFAVPEILFNPSDIGIQEMGIPEAIVYSIQNLPEEMQPHFFKNIVLTGGNSL 325

Query: 496 YPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDES 317
           +PG  DR+  E+  L P+   + ++ P       W GG +++    F+ M +++++Y+E+
Sbjct: 326 FPGFRDRVYSEVRCLTPTDYDVSVVLPENPITYAWEGGKLISENDDFEDMVVTREDYEEN 385

Query: 316 GPSIVHRK 293
           G S+   K
Sbjct: 386 GHSVCEEK 393


>AK222959-1|BAD96679.1|  396|Homo sapiens ARP6 actin-related protein
           6 homolog protein.
          Length = 396

 Score = 97.9 bits (233), Expect = 3e-20
 Identities = 40/128 (31%), Positives = 72/128 (56%)
 Frame = -3

Query: 676 QVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTM 497
           Q++ + NERF  PE LF PS +G++  GI E    SI     +++   + N VL+GG ++
Sbjct: 266 QILRLANERFAVPEILFNPSDIGIQEMGIPEAIVYSIQNLPEEMQPHFFKNIVLTGGNSL 325

Query: 496 YPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDES 317
           +PG  DR+  E+  L P+   + ++ P       W GG +++    F+ M +++++Y+E+
Sbjct: 326 FPGFRDRVYSEVRCLTPTDYDVSVVLPENPITYAWEGGKLISENDDFEDMVVTREDYEEN 385

Query: 316 GPSIVHRK 293
           G S+   K
Sbjct: 386 GHSVCEEK 393


>AK023684-1|BAB14640.1|  288|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13622 fis, clone PLACE1010960, weakly similar to
           ACTIN-LIKE PROTEIN 13E. ).
          Length = 288

 Score = 97.9 bits (233), Expect = 3e-20
 Identities = 40/128 (31%), Positives = 72/128 (56%)
 Frame = -3

Query: 676 QVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTM 497
           Q++ + NERF  PE LF PS +G++  GI E    SI     +++   + N VL+GG ++
Sbjct: 158 QILRLANERFAVPEILFNPSDIGIQEMGIPEAIVYSIQNLPEEMQPHFFKNIVLTGGNSL 217

Query: 496 YPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDES 317
           +PG  DR+  E+  L P+   + ++ P       W GG +++    F+ M +++++Y+E+
Sbjct: 218 FPGFRDRVYSEVRCLTPTDYDVSVVLPENPITYAWEGGKLISENDDFEDMVVTREDYEEN 277

Query: 316 GPSIVHRK 293
           G S+   K
Sbjct: 278 GHSVCEEK 285


>AK023495-1|BAB14588.1|  396|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13433 fis, clone PLACE1002571, weakly similar to
           ACTIN-LIKE PROTEIN 13E. ).
          Length = 396

 Score = 97.9 bits (233), Expect = 3e-20
 Identities = 40/128 (31%), Positives = 72/128 (56%)
 Frame = -3

Query: 676 QVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTM 497
           Q++ + NERF  PE LF PS +G++  GI E    SI     +++   + N VL+GG ++
Sbjct: 266 QILRLANERFAVPEILFNPSDIGIQEMGIPEAIVYSIQNLPEEMQPHFFKNIVLTGGNSL 325

Query: 496 YPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDES 317
           +PG  DR+  E+  L P+   + ++ P       W GG +++    F+ M +++++Y+E+
Sbjct: 326 FPGFRDRVYSEVRCLTPTDYDVSVVLPENPITYAWEGGKLISENDDFEDMVVTREDYEEN 385

Query: 316 GPSIVHRK 293
           G S+   K
Sbjct: 386 GHSVCEEK 393


>AF212251-1|AAK14934.1|  396|Homo sapiens CDA12 protein.
          Length = 396

 Score = 97.9 bits (233), Expect = 3e-20
 Identities = 40/128 (31%), Positives = 72/128 (56%)
 Frame = -3

Query: 676 QVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTM 497
           Q++ + NERF  PE LF PS +G++  GI E    SI     +++   + N VL+GG ++
Sbjct: 266 QILRLANERFAVPEILFNPSDIGIQEMGIPEAIVYSIQNLPEEMQPHFFKNIVLTGGNSL 325

Query: 496 YPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDES 317
           +PG  DR+  E+  L P+   + ++ P       W GG +++    F+ M +++++Y+E+
Sbjct: 326 FPGFRDRVYSEVRCLTPTDYDVSVVLPENPITYAWEGGKLISENDDFEDMVVTREDYEEN 385

Query: 316 GPSIVHRK 293
           G S+   K
Sbjct: 386 GHSVCEEK 393


>AB038229-1|BAB20762.1|  396|Homo sapiens hARPX protein.
          Length = 396

 Score = 97.9 bits (233), Expect = 3e-20
 Identities = 40/128 (31%), Positives = 72/128 (56%)
 Frame = -3

Query: 676 QVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTM 497
           Q++ + NERF  PE LF PS +G++  GI E    SI     +++   + N VL+GG ++
Sbjct: 266 QILRLANERFAVPEILFNPSDIGIQEMGIPEAIVYSIQNLPEEMQPHFFKNIVLTGGNSL 325

Query: 496 YPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDES 317
           +PG  DR+  E+  L P+   + ++ P       W GG +++    F+ M +++++Y+E+
Sbjct: 326 FPGFRDRVYSEVRCLTPTDYDVSVVLPENPITYAWEGGKLISENDDFEDMVVTREDYEEN 385

Query: 316 GPSIVHRK 293
           G S+   K
Sbjct: 386 GHSVCEEK 393


>BC028909-1|AAH28909.1|  366|Homo sapiens actin-like 8 protein.
          Length = 366

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 40/126 (31%), Positives = 66/126 (52%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTV 518
           +Y+LPDG  + +   +   PE  F P         I      S+  C++ +R  L ++ +
Sbjct: 237 TYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVM 296

Query: 517 LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 338
             GG T+YPG   R+ +E+     S+ K  +     R +SVW+G S++A LST+Q  W+S
Sbjct: 297 ACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMS 356

Query: 337 KQEYDE 320
           ++EY E
Sbjct: 357 REEYGE 362


>AL136529-1|CAC15940.1|  366|Homo sapiens actin-like 8 protein.
          Length = 366

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 40/126 (31%), Positives = 66/126 (52%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTV 518
           +Y+LPDG  + +   +   PE  F P         I      S+  C++ +R  L ++ +
Sbjct: 237 TYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVM 296

Query: 517 LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 338
             GG T+YPG   R+ +E+     S+ K  +     R +SVW+G S++A LST+Q  W+S
Sbjct: 297 ACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMS 356

Query: 337 KQEYDE 320
           ++EY E
Sbjct: 357 REEYGE 362


>AK057339-1|BAB71434.1|  366|Homo sapiens protein ( Homo sapiens
           cDNA FLJ32777 fis, clone TESTI2002057, highly similar to
           Human actin-like peptide mRNA. ).
          Length = 366

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 40/126 (31%), Positives = 66/126 (52%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTV 518
           +Y+LPDG  + +   +   PE  F P         I      S+  C++ +R  L ++ +
Sbjct: 237 TYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVM 296

Query: 517 LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 338
             GG T+YPG   R+ +E+     S+ K  +     R +SVW+G S++A LST+Q  W+S
Sbjct: 297 ACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMS 356

Query: 337 KQEYDE 320
           ++EY E
Sbjct: 357 REEYGE 362


>BC008682-1|AAH08682.1|  418|Homo sapiens ARP3 actin-related protein
           3 homolog B (yeast) protein.
          Length = 418

 Score = 86.6 bits (205), Expect = 8e-17
 Identities = 47/140 (33%), Positives = 75/140 (53%), Gaps = 17/140 (12%)
 Frame = -3

Query: 673 VITIGNERFRCPEALFQPSFLGMEAC-GIHETTYNSIMKCDVDIRKDLYANTVLSGGTTM 497
           VI +G ERF  PE  F P F   +    I +     I  C +D+R+ LY N VLSGG+TM
Sbjct: 268 VIDVGYERFLGPEIFFHPEFANPDFMESISDVVDEVIQNCPIDVRRPLYKNVVLSGGSTM 327

Query: 496 YPGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASL 365
           +     R+Q+++                  + P  ++++++    ++Y+VW GGS+LAS 
Sbjct: 328 FRDFGRRLQRDLKRVVDARLRLSEELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLAST 387

Query: 364 STFQQMWISKQEYDESGPSI 305
             F Q+  +K++Y+E GPSI
Sbjct: 388 PEFFQVCHTKKDYEEYGPSI 407


>AF023453-1|AAC98904.1|  418|Homo sapiens actin-related protein
           3-beta protein.
          Length = 418

 Score = 86.6 bits (205), Expect = 8e-17
 Identities = 47/140 (33%), Positives = 75/140 (53%), Gaps = 17/140 (12%)
 Frame = -3

Query: 673 VITIGNERFRCPEALFQPSFLGMEAC-GIHETTYNSIMKCDVDIRKDLYANTVLSGGTTM 497
           VI +G ERF  PE  F P F   +    I +     I  C +D+R+ LY N VLSGG+TM
Sbjct: 268 VIDVGYERFLGPEIFFHPEFANPDFMESISDVVDEVIQNCPIDVRRPLYKNVVLSGGSTM 327

Query: 496 YPGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASL 365
           +     R+Q+++                  + P  ++++++    ++Y+VW GGS+LAS 
Sbjct: 328 FRDFGRRLQRDLKRVVDARLRLSEELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLAST 387

Query: 364 STFQQMWISKQEYDESGPSI 305
             F Q+  +K++Y+E GPSI
Sbjct: 388 PEFFQVCHTKKDYEEYGPSI 407


>AB209174-1|BAD92411.1|  282|Homo sapiens actin-related protein
           3-beta variant protein.
          Length = 282

 Score = 86.6 bits (205), Expect = 8e-17
 Identities = 47/140 (33%), Positives = 75/140 (53%), Gaps = 17/140 (12%)
 Frame = -3

Query: 673 VITIGNERFRCPEALFQPSFLGMEAC-GIHETTYNSIMKCDVDIRKDLYANTVLSGGTTM 497
           VI +G ERF  PE  F P F   +    I +     I  C +D+R+ LY N VLSGG+TM
Sbjct: 132 VIDVGYERFLGPEIFFHPEFANPDFMESISDVVDEVIQNCPIDVRRPLYKNVVLSGGSTM 191

Query: 496 YPGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASL 365
           +     R+Q+++                  + P  ++++++    ++Y+VW GGS+LAS 
Sbjct: 192 FRDFGRRLQRDLKRVVDARLRLSEELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLAST 251

Query: 364 STFQQMWISKQEYDESGPSI 305
             F Q+  +K++Y+E GPSI
Sbjct: 252 PEFFQVCHTKKDYEEYGPSI 271


>BC044590-1|AAH44590.1|  418|Homo sapiens ARP3 actin-related protein
           3 homolog (yeast) protein.
          Length = 418

 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 49/139 (35%), Positives = 73/139 (52%), Gaps = 17/139 (12%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGMEACG-IHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY 494
           I +G ERF  PE  F P F   +    I E     I  C +D+R+ LY N VLSGG+TM+
Sbjct: 269 IDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMF 328

Query: 493 PGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLS 362
                R+Q+++                  L P  + +++I    ++Y+VW GGS+LAS  
Sbjct: 329 RDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTP 388

Query: 361 TFQQMWISKQEYDESGPSI 305
            F Q+  +K++Y+E GPSI
Sbjct: 389 EFYQVCHTKKDYEEIGPSI 407


>BC001324-1|AAH01324.1|  415|Homo sapiens ACTR5 protein protein.
          Length = 415

 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 43/126 (34%), Positives = 65/126 (51%), Gaps = 1/126 (0%)
 Frame = -3

Query: 664 IGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGI 485
           +G ER R PE +FQPS +G E  GI ET    + +   DI++ L  N  L+GG TMYPG+
Sbjct: 252 VGTERIRAPEIIFQPSLIGEEQAGIAETLQYILDRYPKDIQEMLVQNVFLTGGNTMYPGM 311

Query: 484 ADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILA-SLSTFQQMWISKQEYDESGPS 308
             RM+KE+  + P     ++          W G    A +     ++WI+++EY+E G  
Sbjct: 312 KARMEKELLEMRPFRSSFQVQLASNPVLDAWYGARDWALNHLDDNEVWITRKEYEEKGGE 371

Query: 307 IVHRKC 290
            +   C
Sbjct: 372 YLKEHC 377


>AL133519-2|CAD37358.1|  607|Homo sapiens ARP5 actin-related protein
           5 homolog (yeast) protein.
          Length = 607

 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 43/126 (34%), Positives = 65/126 (51%), Gaps = 1/126 (0%)
 Frame = -3

Query: 664 IGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGI 485
           +G ER R PE +FQPS +G E  GI ET    + +   DI++ L  N  L+GG TMYPG+
Sbjct: 444 VGTERIRAPEIIFQPSLIGEEQAGIAETLQYILDRYPKDIQEMLVQNVFLTGGNTMYPGM 503

Query: 484 ADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILA-SLSTFQQMWISKQEYDESGPS 308
             RM+KE+  + P     ++          W G    A +     ++WI+++EY+E G  
Sbjct: 504 KARMEKELLEMRPFRSSFQVQLASNPVLDAWYGARDWALNHLDDNEVWITRKEYEEKGGE 563

Query: 307 IVHRKC 290
            +   C
Sbjct: 564 YLKEHC 569


>AK022847-1|BAB14270.1|  607|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12785 fis, clone NT2RP2001900, weakly similar to
           ACTIN-LIKE PROTEIN ARP5. ).
          Length = 607

 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 43/126 (34%), Positives = 65/126 (51%), Gaps = 1/126 (0%)
 Frame = -3

Query: 664 IGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGI 485
           +G ER R PE +FQPS +G E  GI ET    + +   DI++ L  N  L+GG TMYPG+
Sbjct: 444 VGTERIRAPEIIFQPSLIGEEQAGIAETLQYILDRYPEDIQEMLVQNVFLTGGNTMYPGM 503

Query: 484 ADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILA-SLSTFQQMWISKQEYDESGPS 308
             RM+KE+  + P     ++          W G    A +     ++WI+++EY+E G  
Sbjct: 504 KARMEKELLEMRPFRSSFQVQLASNPVLDAWYGARDWALNHLDDNEVWITRKEYEEKGGE 563

Query: 307 IVHRKC 290
            +   C
Sbjct: 564 YLKEHC 569


>AF127773-1|AAD51904.1|  418|Homo sapiens unknown protein.
          Length = 418

 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 49/139 (35%), Positives = 73/139 (52%), Gaps = 17/139 (12%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGMEACG-IHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY 494
           I +G ERF  PE  F P F   +    I E     I  C +D+R+ LY N VLSGG+TM+
Sbjct: 269 IDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMF 328

Query: 493 PGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLS 362
                R+Q+++                  L P  + +++I    ++Y+VW GGS+LAS  
Sbjct: 329 RDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTP 388

Query: 361 TFQQMWISKQEYDESGPSI 305
            F Q+  +K++Y+E GPSI
Sbjct: 389 EFYQVCHTKKDYEEIGPSI 407


>AF006083-1|AAB64188.1|  418|Homo sapiens Arp3 protein.
          Length = 418

 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 49/139 (35%), Positives = 73/139 (52%), Gaps = 17/139 (12%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGMEACG-IHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY 494
           I +G ERF  PE  F P F   +    I E     I  C +D+R+ LY N VLSGG+TM+
Sbjct: 269 IDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMF 328

Query: 493 PGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLS 362
                R+Q+++                  L P  + +++I    ++Y+VW GGS+LAS  
Sbjct: 329 RDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTP 388

Query: 361 TFQQMWISKQEYDESGPSI 305
            F Q+  +K++Y+E GPSI
Sbjct: 389 EFYQVCHTKKDYEEIGPSI 407


>AC110769-1|AAX93226.1|  418|Homo sapiens unknown protein.
          Length = 418

 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 49/139 (35%), Positives = 73/139 (52%), Gaps = 17/139 (12%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGMEACG-IHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY 494
           I +G ERF  PE  F P F   +    I E     I  C +D+R+ LY N VLSGG+TM+
Sbjct: 269 IDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMF 328

Query: 493 PGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLS 362
                R+Q+++                  L P  + +++I    ++Y+VW GGS+LAS  
Sbjct: 329 RDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTP 388

Query: 361 TFQQMWISKQEYDESGPSI 305
            F Q+  +K++Y+E GPSI
Sbjct: 389 EFYQVCHTKKDYEEIGPSI 407


>AB209353-1|BAD92590.1|  369|Homo sapiens ARP3 actin-related protein
           3 homolog variant protein.
          Length = 369

 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 49/139 (35%), Positives = 73/139 (52%), Gaps = 17/139 (12%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGMEACG-IHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY 494
           I +G ERF  PE  F P F   +    I E     I  C +D+R+ LY N VLSGG+TM+
Sbjct: 220 IDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMF 279

Query: 493 PGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLS 362
                R+Q+++                  L P  + +++I    ++Y+VW GGS+LAS  
Sbjct: 280 RDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTP 339

Query: 361 TFQQMWISKQEYDESGPSI 305
            F Q+  +K++Y+E GPSI
Sbjct: 340 EFYQVCHTKKDYEEIGPSI 358


>BC038402-1|AAH38402.1|  607|Homo sapiens ARP5 actin-related protein
           5 homolog (yeast) protein.
          Length = 607

 Score = 85.8 bits (203), Expect = 1e-16
 Identities = 42/126 (33%), Positives = 65/126 (51%), Gaps = 1/126 (0%)
 Frame = -3

Query: 664 IGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGI 485
           +G ER R PE +FQPS +G E  GI ET    + +   D+++ L  N  L+GG TMYPG+
Sbjct: 444 VGTERIRAPEIIFQPSLIGEEQAGIAETLQYILDRYPKDVQEMLVQNVFLTGGNTMYPGM 503

Query: 484 ADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILA-SLSTFQQMWISKQEYDESGPS 308
             RM+KE+  + P     ++          W G    A +     ++WI+++EY+E G  
Sbjct: 504 KARMEKELLEMRPFRSSFQVQLASNPVLDAWYGARDWALNHLDDNEVWITRKEYEEKGGE 563

Query: 307 IVHRKC 290
            +   C
Sbjct: 564 YLKEHC 569


>BC006162-1|AAH06162.1|  342|Homo sapiens ACTR5 protein protein.
          Length = 342

 Score = 85.8 bits (203), Expect = 1e-16
 Identities = 42/126 (33%), Positives = 65/126 (51%), Gaps = 1/126 (0%)
 Frame = -3

Query: 664 IGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGI 485
           +G ER R PE +FQPS +G E  GI ET    + +   D+++ L  N  L+GG TMYPG+
Sbjct: 179 VGTERIRAPEIIFQPSLIGEEQAGIAETLQYILDRYPKDVQEMLVQNVFLTGGNTMYPGM 238

Query: 484 ADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILA-SLSTFQQMWISKQEYDESGPS 308
             RM+KE+  + P     ++          W G    A +     ++WI+++EY+E G  
Sbjct: 239 KARMEKELLEMRPFRSSFQVQLASNPVLDAWYGARDWALNHLDDNEVWITRKEYEEKGGE 298

Query: 307 IVHRKC 290
            +   C
Sbjct: 299 YLKEHC 304


>AK058153-1|BAB71690.1|  328|Homo sapiens protein ( Homo sapiens
           cDNA FLJ25424 fis, clone TST04169. ).
          Length = 328

 Score = 81.0 bits (191), Expect = 4e-15
 Identities = 35/76 (46%), Positives = 52/76 (68%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 521
           + Y+LPDG +I++G+   + PEALF P  LG ++ G+     +SI KCD DI+K L+   
Sbjct: 240 REYKLPDGNIISLGDPLHQAPEALFVPQQLGSQSPGLSNMVSSSITKCDTDIQKILFGEI 299

Query: 520 VLSGGTTMYPGIADRM 473
           VLSGGTT++ G+ DR+
Sbjct: 300 VLSGGTTLFHGLDDRL 315


>U20582-1|AAA62476.1|  302|Homo sapiens protein ( Human actin-like
           peptide mRNA, partial cds. ).
          Length = 302

 Score = 67.7 bits (158), Expect = 4e-11
 Identities = 34/115 (29%), Positives = 56/115 (48%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTV 518
           +Y+LPDG  + +   +   PE  F P         I      S+  C++ +R  L ++ +
Sbjct: 187 TYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVM 246

Query: 517 LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQ 353
             GG T+YPG   R+ +E+     S+ K  +     R +SVW+G S+  S ST+Q
Sbjct: 247 ACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGXSV-CSPSTYQ 300


>AF086920-1|AAP97150.1|  402|Homo sapiens actin related protein ARP4
           protein.
          Length = 402

 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 1/82 (1%)
 Frame = -3

Query: 673 VITIGNERFRCPEALFQPSFLGMEAC-GIHETTYNSIMKCDVDIRKDLYANTVLSGGTTM 497
           VI +G ERF  PE  F P F   +    I +     I  C +D+R+  Y N VLSGG+TM
Sbjct: 250 VIDVGYERFLGPEIFFHPEFANPDFMESISDVVDEVIQNCPIDVRRPSYKNVVLSGGSTM 309

Query: 496 YPGIADRMQKEITALAPSTMKI 431
           +     R+Q+++  +  + +++
Sbjct: 310 FRDFGRRLQRDLKRVVDARLRL 331


>BC011997-1|AAH11997.1|  417|Homo sapiens actin-related protein 10
           homolog (S. cerevisiae) protein.
          Length = 417

 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 44/144 (30%), Positives = 68/144 (47%), Gaps = 11/144 (7%)
 Frame = -3

Query: 712 PPLEKSYELPDGQVITI-GNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKD 536
           PP    Y L   +++ I G+ R    E LF+      E   +     +S+++C +D RK 
Sbjct: 242 PPPNVDYPLDGEKILHILGSIRDSVVEILFEQD---NEEQSVATLILDSLIQCPIDTRKQ 298

Query: 535 LYANTVLSGGTTMYPGIADRMQKEITAL--------APSTMKIKIIAPPERKYSV-WIGG 383
           L  N V+ GGT+M PG   R+  EI  L        A  T   +I  PP +   V W+GG
Sbjct: 299 LAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKALGTKTFRIHTPPAKANCVAWLGG 358

Query: 382 SILASL-STFQQMWISKQEYDESG 314
           +I  +L        +SK+ Y+++G
Sbjct: 359 AIFGALQDILGSRSVSKEYYNQTG 382


>AK222702-1|BAD96422.1|  417|Homo sapiens uncharacterized
           hypothalamus protein HARP11 variant protein.
          Length = 417

 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 44/144 (30%), Positives = 68/144 (47%), Gaps = 11/144 (7%)
 Frame = -3

Query: 712 PPLEKSYELPDGQVITI-GNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKD 536
           PP    Y L   +++ I G+ R    E LF+      E   +     +S+++C +D RK 
Sbjct: 242 PPPNVDYPLDGEKILHILGSIRDSVVEILFEQD---NEEQSVATLILDSLIQCPIDTRKQ 298

Query: 535 LYANTVLSGGTTMYPGIADRMQKEITAL--------APSTMKIKIIAPPERKYSV-WIGG 383
           L  N V+ GGT+M PG   R+  EI  L        A  T   +I  PP +   V W+GG
Sbjct: 299 LAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKALGTKTFRIHTPPAKANCVAWLGG 358

Query: 382 SILASL-STFQQMWISKQEYDESG 314
           +I  +L        +SK+ Y+++G
Sbjct: 359 AIFGALQDILGSRSVSKEYYNQTG 382


>AK022534-1|BAB14083.1|  417|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12472 fis, clone NT2RM1000898, weakly similar to
           ACTIN, CYTOPLASMIC. ).
          Length = 417

 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 44/144 (30%), Positives = 68/144 (47%), Gaps = 11/144 (7%)
 Frame = -3

Query: 712 PPLEKSYELPDGQVITI-GNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKD 536
           PP    Y L   +++ I G+ R    E LF+      E   +     +S+++C +D RK 
Sbjct: 242 PPPNVDYPLDGEKILHILGSIRDSVVEILFEQD---NEEQSVATLILDSLIQCPIDTRKQ 298

Query: 535 LYANTVLSGGTTMYPGIADRMQKEITAL--------APSTMKIKIIAPPERKYSV-WIGG 383
           L  N V+ GGT+M PG   R+  EI  L        A  T   +I  PP +   V W+GG
Sbjct: 299 LAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKALGTKTFRIHTPPAKANCVAWLGG 358

Query: 382 SILASL-STFQQMWISKQEYDESG 314
           +I  +L        +SK+ Y+++G
Sbjct: 359 AIFGALQDILGSRSVSKEYYNQTG 382


>AK000544-1|BAA91243.1|  417|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20537 fis, clone KAT11250. ).
          Length = 417

 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 44/144 (30%), Positives = 68/144 (47%), Gaps = 11/144 (7%)
 Frame = -3

Query: 712 PPLEKSYELPDGQVITI-GNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKD 536
           PP    Y L   +++ I G+ R    E LF+      E   +     +S+++C +D RK 
Sbjct: 242 PPPNVDYPLDGEKILHILGSIRDSVVEILFEQD---NEEQSVATLILDSLIQCPIDTRKQ 298

Query: 535 LYANTVLSGGTTMYPGIADRMQKEITAL--------APSTMKIKIIAPPERKYSV-WIGG 383
           L  N V+ GGT+M PG   R+  EI  L        A  T   +I  PP +   V W+GG
Sbjct: 299 LAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKALGTKTFRIHTPPAKANCVAWLGG 358

Query: 382 SILASL-STFQQMWISKQEYDESG 314
           +I  +L        +SK+ Y+++G
Sbjct: 359 AIFGALQDILGSRSVSKEYYNQTG 382


>AF220190-1|AAF67655.1|  417|Homo sapiens uncharacterized
           hypothalamus protein HARP11 protein.
          Length = 417

 Score = 57.6 bits (133), Expect = 4e-08
 Identities = 44/144 (30%), Positives = 68/144 (47%), Gaps = 11/144 (7%)
 Frame = -3

Query: 712 PPLEKSYELPDGQVITI-GNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKD 536
           PP    Y L   +++ I G+ R    E LF+      E   +     +S+++C +D RK 
Sbjct: 242 PPPNVDYPLDGEKILHILGSIRDSVVEILFEQD---NEEQSVATLILDSLIQCPIDTRKQ 298

Query: 535 LYANTVLSGGTTMYPGIADRMQKEITAL--------APSTMKIKIIAPPERKYSV-WIGG 383
           L  N V+ GGT+M PG   R+  EI  L        A  T   +I  PP +   V W+GG
Sbjct: 299 LAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKALGTKTFRIHTPPAKANCVAWLGG 358

Query: 382 SILASL-STFQQMWISKQEYDESG 314
           +I  +L        +SK+ Y+++G
Sbjct: 359 AIFGALQDILGSRSVSKEYYNQTG 382


>AK222624-1|BAD96344.1|  417|Homo sapiens uncharacterized
           hypothalamus protein HARP11 variant protein.
          Length = 417

 Score = 57.2 bits (132), Expect = 5e-08
 Identities = 44/144 (30%), Positives = 68/144 (47%), Gaps = 11/144 (7%)
 Frame = -3

Query: 712 PPLEKSYELPDGQVITI-GNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKD 536
           PP    Y L   +++ I G+ R    E LF+      E   +     +S+++C +D RK 
Sbjct: 242 PPPNVDYPLDGEKILHILGSIRDSVVEILFEQD---NEEQSVATLILDSLIQCPIDTRKQ 298

Query: 535 LYANTVLSGGTTMYPGIADRMQKEITAL--------APSTMKIKIIAPPERKYSV-WIGG 383
           L  N V+ GGT+M PG   R+  EI  L        A  T   +I  PP +   V W+GG
Sbjct: 299 LAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKALGTKTFQIHTPPAKANCVAWLGG 358

Query: 382 SILASL-STFQQMWISKQEYDESG 314
           +I  +L        +SK+ Y+++G
Sbjct: 359 AIFGALQDILGSRSVSKEYYNQTG 382


>BC032744-1|AAH32744.1|  329|Homo sapiens ACTR8 protein protein.
          Length = 329

 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 28/113 (24%), Positives = 57/113 (50%), Gaps = 9/113 (7%)
 Frame = -3

Query: 604 EACGIHETTYNSIMKCDVD-IRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK-- 434
           +A G+ +   +SI  C  D  +K +Y++ ++ GG  M+    + +Q  I    P + +  
Sbjct: 212 KALGLDKAILHSIDCCSSDDTKKKMYSSILVVGGGLMFHKAQEFLQHRILNKMPPSFRRI 271

Query: 433 ---IKIIAPP---ERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK 293
              + +I  P   + +   W GG++LA L T Q++WI ++E+   G  ++  +
Sbjct: 272 IENVDVITRPKDMDPRLIAWKGGAVLACLDTTQELWIYQREWQRFGVRMLRER 324


>AK026232-1|BAB15402.1|  374|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ22579 fis, clone HSI02562. ).
          Length = 374

 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 28/113 (24%), Positives = 57/113 (50%), Gaps = 9/113 (7%)
 Frame = -3

Query: 604 EACGIHETTYNSIMKCDVD-IRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK-- 434
           +A G+ +   +SI  C  D  +K +Y++ ++ GG  M+    + +Q  I    P + +  
Sbjct: 257 KALGLDKAILHSIDCCSSDDTKKKMYSSILVVGGGLMFHKAQEFLQHRILNKMPPSFRRI 316

Query: 433 ---IKIIAPP---ERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK 293
              + +I  P   + +   W GG++LA L T Q++WI ++E+   G  ++  +
Sbjct: 317 IENVDVITRPKDMDPRLIAWKGGAVLACLDTTQELWIYQREWQRFGVRMLRER 369


>AK022996-1|BAB14352.1|  624|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12934 fis, clone NT2RP2004978, weakly similar to
           ACTIN-LIKE PROTEIN ARP8. ).
          Length = 624

 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 28/113 (24%), Positives = 57/113 (50%), Gaps = 9/113 (7%)
 Frame = -3

Query: 604 EACGIHETTYNSIMKCDVD-IRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK-- 434
           +A G+ +   +SI  C  D  +K +Y++ ++ GG  M+    + +Q  I    P + +  
Sbjct: 507 KALGLDKAILHSIDCCSSDDTKKKMYSSILVVGGGLMFHKAQEFLQHRILNKMPPSFRRI 566

Query: 433 ---IKIIAPP---ERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK 293
              + +I  P   + +   W GG++LA L T Q++WI ++E+   G  ++  +
Sbjct: 567 IENVDVITRPKDMDPRLIAWKGGAVLACLGTTQELWIYQREWQRFGVRMLRER 619


>BC005208-1|AAH05208.1|  339|Homo sapiens Unknown (protein for
           IMAGE:3950510) protein.
          Length = 339

 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 31/96 (32%), Positives = 45/96 (46%), Gaps = 1/96 (1%)
 Frame = -3

Query: 712 PPLEKSYELPDGQVITI-GNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKD 536
           PP    Y L   +++ I G+ R    E LF+      E   +     +S+++C +D RK 
Sbjct: 242 PPPNVDYPLDGEKILHILGSIRDSVVEILFEQD---NEEQSVATLILDSLIQCPIDTRKQ 298

Query: 535 LYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIK 428
           L  N V+ GGT+M PG   R+  EI  L     K K
Sbjct: 299 LAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKKKK 334


>AB039791-1|BAB21501.1|  210|Homo sapiens actin-related protein
           Arp11 protein.
          Length = 210

 Score = 37.9 bits (84), Expect = 0.036
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = -3

Query: 673 VITIGNERFRCPEALFQPSFLGMEAC-GIHETTYNSIMKCDVDIRKDLY 530
           VI +G ERF  PE  F P F   ++   I +     I  C +D+R+ LY
Sbjct: 139 VIDVGYERFLGPEIFFHPEFANPDSMESISDVVDEVIQNCPIDVRRPLY 187


>BC015207-1|AAH15207.1|  348|Homo sapiens ARP3 actin-related protein
           3 homolog B (yeast) protein.
          Length = 348

 Score = 36.7 bits (81), Expect = 0.083
 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 1/49 (2%)
 Frame = -3

Query: 673 VITIGNERFRCPEALFQPSFLGMEAC-GIHETTYNSIMKCDVDIRKDLY 530
           VI +G ERF  PE  F P F   +    I +     I  C +D+R+ LY
Sbjct: 268 VIDVGYERFLGPEIFFHPEFANPDFMESISDVVDEVIQNCPIDVRRPLY 316


>BC057819-1|AAH57819.1|  156|Homo sapiens chromosome 1 open reading
           frame 122 protein.
          Length = 156

 Score = 34.7 bits (76), Expect = 0.33
 Identities = 17/50 (34%), Positives = 20/50 (40%), Gaps = 2/50 (4%)
 Frame = +1

Query: 499 WWYHRTIRCWRTSPYGC--PRRTS*WSYMWSRGCRKLPYPRTRVGREPLG 642
           WW  R  + W   P GC   RR S   + WS G   +P   T     P G
Sbjct: 75  WWRERLSQTWSAPPAGCLRERRLSKGCWRWSCGALTIPEQNTLTSLPPQG 124


>AL929472-10|CAH70085.1|  156|Homo sapiens chromosome 1 open reading
           frame 122 protein.
          Length = 156

 Score = 34.7 bits (76), Expect = 0.33
 Identities = 17/50 (34%), Positives = 20/50 (40%), Gaps = 2/50 (4%)
 Frame = +1

Query: 499 WWYHRTIRCWRTSPYGC--PRRTS*WSYMWSRGCRKLPYPRTRVGREPLG 642
           WW  R  + W   P GC   RR S   + WS G   +P   T     P G
Sbjct: 75  WWRERLSQTWSAPPAGCLRQRRLSKGCWRWSCGALTIPEQNTLTSLPPQG 124


>AK127381-1|BAC86950.1|  156|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45459 fis, clone BRSTN2010416. ).
          Length = 156

 Score = 34.7 bits (76), Expect = 0.33
 Identities = 17/50 (34%), Positives = 20/50 (40%), Gaps = 2/50 (4%)
 Frame = +1

Query: 499 WWYHRTIRCWRTSPYGC--PRRTS*WSYMWSRGCRKLPYPRTRVGREPLG 642
           WW  R  + W   P GC   RR S   + WS G   +P   T     P G
Sbjct: 75  WWRERLSQTWSAPPAGCLRQRRLSKGCWRWSCGALTIPEQNTLTSLPPQG 124


>U48959-1|AAC18423.2| 1914|Homo sapiens myosin light chain kinase
           protein.
          Length = 1914

 Score = 29.9 bits (64), Expect = 9.5
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = +2

Query: 560 LHDGVICGLVDAASFHTQERGLEESLWATESFVSDSDDLT 679
           LH+G    + ++  FH ++RG + SLW  E F  D+   T
Sbjct: 657 LHNGN--EIQESEDFHFEQRGTQHSLWIQEVFPEDTGTYT 694


>AF069603-1|AAD15923.1| 1793|Homo sapiens myosin light chain kinase
           isoform 3B protein.
          Length = 1793

 Score = 29.9 bits (64), Expect = 9.5
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = +2

Query: 560 LHDGVICGLVDAASFHTQERGLEESLWATESFVSDSDDLT 679
           LH+G    + ++  FH ++RG + SLW  E F  D+   T
Sbjct: 588 LHNGN--EIQESEDFHFEQRGTQHSLWIQEVFPEDTGTYT 625


>AF069602-1|AAD15922.1| 1862|Homo sapiens myosin light chain kinase
           isoform 3A protein.
          Length = 1862

 Score = 29.9 bits (64), Expect = 9.5
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = +2

Query: 560 LHDGVICGLVDAASFHTQERGLEESLWATESFVSDSDDLT 679
           LH+G    + ++  FH ++RG + SLW  E F  D+   T
Sbjct: 657 LHNGN--EIQESEDFHFEQRGTQHSLWIQEVFPEDTGTYT 694


>AF069601-1|AAD15921.2| 1845|Homo sapiens myosin light chain kinase
           isoform 2 protein.
          Length = 1845

 Score = 29.9 bits (64), Expect = 9.5
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = +2

Query: 560 LHDGVICGLVDAASFHTQERGLEESLWATESFVSDSDDLT 679
           LH+G    + ++  FH ++RG + SLW  E F  D+   T
Sbjct: 588 LHNGN--EIQESEDFHFEQRGTQHSLWIQEVFPEDTGTYT 625


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 108,276,897
Number of Sequences: 237096
Number of extensions: 2381504
Number of successful extensions: 6662
Number of sequences better than 10.0: 166
Number of HSP's better than 10.0 without gapping: 6206
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6603
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8399192100
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).