SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0001
         (944 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M32405-1|AAA36568.1|  145|Homo sapiens protein ( Human homologue...   107   4e-23
J02984-1|AAA36036.1|  145|Homo sapiens protein ( Human insulinom...   107   4e-23
BC141832-1|AAI41833.1|  145|Homo sapiens ribosomal protein S15 p...   107   4e-23
BC105810-1|AAI05811.1|  145|Homo sapiens ribosomal protein S15 p...   107   4e-23
BC064908-1|AAH64908.1|  145|Homo sapiens ribosomal protein S15 p...   107   4e-23
AF145025-1|AAP97277.1|  145|Homo sapiens insulinoma protein prot...   107   4e-23

>M32405-1|AAA36568.1|  145|Homo sapiens protein ( Human homologue of
           rat insulinoma gene (rig), exons 1-4. ).
          Length = 145

 Score =  107 bits (258), Expect = 4e-23
 Identities = 50/75 (66%), Positives = 61/75 (81%)
 Frame = +2

Query: 458 EQLMELMHXXXXXXXXXGLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEMV 637
           EQLM+L           GL+RK  +L+K+LR+AKKEAPP EKPE+VKTHLR+MII+PEMV
Sbjct: 31  EQLMQLYSARQRRRLNRGLRRKQHSLLKRLRKAKKEAPPMEKPEVVKTHLRDMIILPEMV 90

Query: 638 GSIVGIYNGKTFNQV 682
           GS+VG+YNGKTFNQV
Sbjct: 91  GSMVGVYNGKTFNQV 105



 Score = 47.6 bits (108), Expect = 7e-05
 Identities = 21/22 (95%), Positives = 21/22 (95%)
 Frame = +3

Query: 174 KKKRIFRKFTYRGVDLDQLLDM 239
           KKKR FRKFTYRGVDLDQLLDM
Sbjct: 7   KKKRTFRKFTYRGVDLDQLLDM 28


>J02984-1|AAA36036.1|  145|Homo sapiens protein ( Human insulinoma
           rig-analog mRNA encoding DNA-binding protein, complete
           cds. ).
          Length = 145

 Score =  107 bits (258), Expect = 4e-23
 Identities = 50/75 (66%), Positives = 61/75 (81%)
 Frame = +2

Query: 458 EQLMELMHXXXXXXXXXGLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEMV 637
           EQLM+L           GL+RK  +L+K+LR+AKKEAPP EKPE+VKTHLR+MII+PEMV
Sbjct: 31  EQLMQLYSARQRRRLNRGLRRKQHSLLKRLRKAKKEAPPMEKPEVVKTHLRDMIILPEMV 90

Query: 638 GSIVGIYNGKTFNQV 682
           GS+VG+YNGKTFNQV
Sbjct: 91  GSMVGVYNGKTFNQV 105



 Score = 47.6 bits (108), Expect = 7e-05
 Identities = 21/22 (95%), Positives = 21/22 (95%)
 Frame = +3

Query: 174 KKKRIFRKFTYRGVDLDQLLDM 239
           KKKR FRKFTYRGVDLDQLLDM
Sbjct: 7   KKKRTFRKFTYRGVDLDQLLDM 28


>BC141832-1|AAI41833.1|  145|Homo sapiens ribosomal protein S15
           protein.
          Length = 145

 Score =  107 bits (258), Expect = 4e-23
 Identities = 50/75 (66%), Positives = 61/75 (81%)
 Frame = +2

Query: 458 EQLMELMHXXXXXXXXXGLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEMV 637
           EQLM+L           GL+RK  +L+K+LR+AKKEAPP EKPE+VKTHLR+MII+PEMV
Sbjct: 31  EQLMQLYSARQRRRLNRGLRRKQHSLLKRLRKAKKEAPPMEKPEVVKTHLRDMIILPEMV 90

Query: 638 GSIVGIYNGKTFNQV 682
           GS+VG+YNGKTFNQV
Sbjct: 91  GSMVGVYNGKTFNQV 105



 Score = 47.6 bits (108), Expect = 7e-05
 Identities = 21/22 (95%), Positives = 21/22 (95%)
 Frame = +3

Query: 174 KKKRIFRKFTYRGVDLDQLLDM 239
           KKKR FRKFTYRGVDLDQLLDM
Sbjct: 7   KKKRTFRKFTYRGVDLDQLLDM 28


>BC105810-1|AAI05811.1|  145|Homo sapiens ribosomal protein S15
           protein.
          Length = 145

 Score =  107 bits (258), Expect = 4e-23
 Identities = 50/75 (66%), Positives = 61/75 (81%)
 Frame = +2

Query: 458 EQLMELMHXXXXXXXXXGLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEMV 637
           EQLM+L           GL+RK  +L+K+LR+AKKEAPP EKPE+VKTHLR+MII+PEMV
Sbjct: 31  EQLMQLYSARQRRRLNRGLRRKQHSLLKRLRKAKKEAPPMEKPEVVKTHLRDMIILPEMV 90

Query: 638 GSIVGIYNGKTFNQV 682
           GS+VG+YNGKTFNQV
Sbjct: 91  GSMVGVYNGKTFNQV 105



 Score = 47.6 bits (108), Expect = 7e-05
 Identities = 21/22 (95%), Positives = 21/22 (95%)
 Frame = +3

Query: 174 KKKRIFRKFTYRGVDLDQLLDM 239
           KKKR FRKFTYRGVDLDQLLDM
Sbjct: 7   KKKRTFRKFTYRGVDLDQLLDM 28


>BC064908-1|AAH64908.1|  145|Homo sapiens ribosomal protein S15
           protein.
          Length = 145

 Score =  107 bits (258), Expect = 4e-23
 Identities = 50/75 (66%), Positives = 61/75 (81%)
 Frame = +2

Query: 458 EQLMELMHXXXXXXXXXGLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEMV 637
           EQLM+L           GL+RK  +L+K+LR+AKKEAPP EKPE+VKTHLR+MII+PEMV
Sbjct: 31  EQLMQLYSARQRRRLNRGLRRKQHSLLKRLRKAKKEAPPMEKPEVVKTHLRDMIILPEMV 90

Query: 638 GSIVGIYNGKTFNQV 682
           GS+VG+YNGKTFNQV
Sbjct: 91  GSMVGVYNGKTFNQV 105



 Score = 47.6 bits (108), Expect = 7e-05
 Identities = 21/22 (95%), Positives = 21/22 (95%)
 Frame = +3

Query: 174 KKKRIFRKFTYRGVDLDQLLDM 239
           KKKR FRKFTYRGVDLDQLLDM
Sbjct: 7   KKKRTFRKFTYRGVDLDQLLDM 28


>AF145025-1|AAP97277.1|  145|Homo sapiens insulinoma protein
           protein.
          Length = 145

 Score =  107 bits (258), Expect = 4e-23
 Identities = 50/75 (66%), Positives = 61/75 (81%)
 Frame = +2

Query: 458 EQLMELMHXXXXXXXXXGLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEMV 637
           EQLM+L           GL+RK  +L+K+LR+AKKEAPP EKPE+VKTHLR+MII+PEMV
Sbjct: 31  EQLMQLYSARQRRRLNRGLRRKQHSLLKRLRKAKKEAPPMEKPEVVKTHLRDMIILPEMV 90

Query: 638 GSIVGIYNGKTFNQV 682
           GS+VG+YNGKTFNQV
Sbjct: 91  GSMVGVYNGKTFNQV 105



 Score = 47.6 bits (108), Expect = 7e-05
 Identities = 21/22 (95%), Positives = 21/22 (95%)
 Frame = +3

Query: 174 KKKRIFRKFTYRGVDLDQLLDM 239
           KKKR FRKFTYRGVDLDQLLDM
Sbjct: 7   KKKRTFRKFTYRGVDLDQLLDM 28


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 118,589,622
Number of Sequences: 237096
Number of extensions: 2178365
Number of successful extensions: 3455
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 3308
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3455
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 12436574528
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).