SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0042
         (619 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK125400-1|BAC86156.1|  233|Homo sapiens protein ( Homo sapiens ...    33   0.61 
D28532-1|BAA05888.1|  465|Homo sapiens renal Na+-dependent phosp...    31   2.5  
X71355-1|CAA50490.1|  467|Homo sapiens Sodium-Phosphate Transpor...    31   4.3  
BC101747-1|AAI01748.1|  467|Homo sapiens solute carrier family 1...    31   4.3  
BC101745-1|AAI01746.1|  467|Homo sapiens solute carrier family 1...    31   4.3  
AL138726-7|CAI19543.1|  465|Homo sapiens solute carrier family 1...    31   4.3  

>AK125400-1|BAC86156.1|  233|Homo sapiens protein ( Homo sapiens
           cDNA FLJ43411 fis, clone OCBBF2021286. ).
          Length = 233

 Score = 33.5 bits (73), Expect = 0.61
 Identities = 31/99 (31%), Positives = 47/99 (47%), Gaps = 4/99 (4%)
 Frame = +2

Query: 179 WPFDCRVGHRCPTRRTEVIMS-ISVTRRLHGLLLFVNVCFSLIDLLEIRFILSI-VRIRL 352
           W F  +  +   T+   V +S +  TRRL   LL  N+C SL   L +   LS+ + + L
Sbjct: 74  WLFPWQCDYPALTQSKGVPLSWVKFTRRLLKCLLRGNLCLSLSLSLSLSLSLSLSLSLSL 133

Query: 353 SQ--SLLDIPAPLITSKST*LLQYLKIFFSCRVKYLFSL 463
           SQ  SLL    P   SK+  L++ L    +  + +  SL
Sbjct: 134 SQCISLLSFTFPFFLSKNNVLVEALVTLINQNLPFPVSL 172


>D28532-1|BAA05888.1|  465|Homo sapiens renal Na+-dependent
           phosphate cotransporter protein.
          Length = 465

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 16/40 (40%), Positives = 22/40 (55%)
 Frame = +3

Query: 177 IGPLTVV*VTGALRGALK*LCRFLLLGACMAFYCLLMYVL 296
           +GP  V+ VTG +  +L     F + GAC    CLL +VL
Sbjct: 178 LGPFIVLLVTGVICESLGWPMVFYIFGACCCAVCLLWFVL 217


>X71355-1|CAA50490.1|  467|Homo sapiens Sodium-Phosphate Transport
           System 1 protein.
          Length = 467

 Score = 30.7 bits (66), Expect = 4.3
 Identities = 16/40 (40%), Positives = 22/40 (55%)
 Frame = +3

Query: 177 IGPLTVV*VTGALRGALK*LCRFLLLGACMAFYCLLMYVL 296
           +GP  V+ VTG +  +L     F + GAC    CLL +VL
Sbjct: 180 LGPFIVLLVTGVICESLGWPMVFYIFGACGCAVCLLWFVL 219


>BC101747-1|AAI01748.1|  467|Homo sapiens solute carrier family 17
           (sodium phosphate), member 1 protein.
          Length = 467

 Score = 30.7 bits (66), Expect = 4.3
 Identities = 16/40 (40%), Positives = 22/40 (55%)
 Frame = +3

Query: 177 IGPLTVV*VTGALRGALK*LCRFLLLGACMAFYCLLMYVL 296
           +GP  V+ VTG +  +L     F + GAC    CLL +VL
Sbjct: 180 LGPFIVLLVTGVICESLGWPMVFYIFGACGCAVCLLWFVL 219


>BC101745-1|AAI01746.1|  467|Homo sapiens solute carrier family 17
           (sodium phosphate), member 1 protein.
          Length = 467

 Score = 30.7 bits (66), Expect = 4.3
 Identities = 16/40 (40%), Positives = 22/40 (55%)
 Frame = +3

Query: 177 IGPLTVV*VTGALRGALK*LCRFLLLGACMAFYCLLMYVL 296
           +GP  V+ VTG +  +L     F + GAC    CLL +VL
Sbjct: 180 LGPFIVLLVTGVICESLGWPMVFYIFGACGCAVCLLWFVL 219


>AL138726-7|CAI19543.1|  465|Homo sapiens solute carrier family 17
           (sodium phosphate), member 1 protein.
          Length = 465

 Score = 30.7 bits (66), Expect = 4.3
 Identities = 16/40 (40%), Positives = 22/40 (55%)
 Frame = +3

Query: 177 IGPLTVV*VTGALRGALK*LCRFLLLGACMAFYCLLMYVL 296
           +GP  V+ VTG +  +L     F + GAC    CLL +VL
Sbjct: 178 LGPFIVLLVTGVICESLGWPMVFYIFGACGCAVCLLWFVL 217


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 81,718,556
Number of Sequences: 237096
Number of extensions: 1634585
Number of successful extensions: 10608
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 10558
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10608
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6635341780
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).