SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0039
         (616 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X63432-1|CAA45026.1|  375|Homo sapiens mutant beta-actin  (beta'...   189   6e-48
X04098-1|CAA27723.1|  375|Homo sapiens gamma-actin protein.           189   6e-48
X00351-1|CAA25099.1|  375|Homo sapiens protein ( Human mRNA for ...   189   6e-48
M19283-1|AAA51579.1|  375|Homo sapiens ACTG1 protein.                 189   6e-48
M10277-1|AAA51567.1|  375|Homo sapiens protein ( Human cytoplasm...   189   6e-48
DQ471327-1|ABF01018.1|  375|Homo sapiens PS1TP5-binding protein ...   189   6e-48
BT019856-1|AAV38659.1|  375|Homo sapiens actin, gamma 1 protein.      189   6e-48
BC053572-1|AAH53572.1|  375|Homo sapiens actin, gamma 1 protein.      189   6e-48
BC018774-1|AAH18774.1|  375|Homo sapiens ACTG1 protein protein.       189   6e-48
BC017450-1|AAH17450.1|  363|Homo sapiens Unknown (protein for IM...   189   6e-48
BC015779-1|AAH15779.1|  375|Homo sapiens ACTG1 protein protein.       189   6e-48
BC015695-1|AAH15695.1|  375|Homo sapiens actin, gamma 1 protein.      189   6e-48
BC015005-1|AAH15005.1|  375|Homo sapiens ACTG1 protein protein.       189   6e-48
BC014861-1|AAH14861.1|  375|Homo sapiens actin, beta protein.         189   6e-48
BC013380-1|AAH13380.1|  375|Homo sapiens actin, beta protein.         189   6e-48
BC012050-1|AAH12050.1|  375|Homo sapiens actin, gamma 1 protein.      189   6e-48
BC010999-1|AAH10999.1|  375|Homo sapiens actin, gamma 1 protein.      189   6e-48
BC009848-1|AAH09848.1|  375|Homo sapiens actin, gamma 1 protein.      189   6e-48
BC008633-1|AAH08633.1|  368|Homo sapiens actin, beta protein.         189   6e-48
BC007442-1|AAH07442.1|  375|Homo sapiens actin, gamma 1 protein.      189   6e-48
BC004251-1|AAH04251.1|  375|Homo sapiens actin, beta protein.         189   6e-48
BC002409-1|AAH02409.1|  375|Homo sapiens actin, beta protein.         189   6e-48
BC001920-1|AAH01920.1|  375|Homo sapiens ACTG1 protein protein.       189   6e-48
BC001301-1|AAH01301.1|  375|Homo sapiens actin, beta protein.         189   6e-48
BC000292-1|AAH00292.1|  375|Homo sapiens actin, gamma 1 protein.      189   6e-48
AY582799-1|AAS79319.1|  375|Homo sapiens actin, beta protein.         189   6e-48
AK223055-1|BAD96775.1|  375|Homo sapiens beta actin variant prot...   189   6e-48
AK223032-1|BAD96752.1|  375|Homo sapiens beta actin variant prot...   189   6e-48
AK222925-1|BAD96645.1|  375|Homo sapiens beta actin variant prot...   189   6e-48
AC006483-1|AAP22343.1|  375|Homo sapiens unknown protein.             189   6e-48
BC016045-1|AAH16045.1|  375|Homo sapiens actin, beta protein.         187   2e-47
BC012854-1|AAH12854.1|  360|Homo sapiens ACTB protein protein.        186   4e-47
M20543-1|AAA60296.1|  377|Homo sapiens ACTA1 protein.                 184   2e-46
J00073-1|AAB59619.1|  377|Homo sapiens alpha-cardiac actin protein.   184   2e-46
J00068-1|AAB59376.1|  377|Homo sapiens ACTA1 protein.                 184   2e-46
CR541796-1|CAG46595.1|  377|Homo sapiens ACTA1 protein.               184   2e-46
CR541795-1|CAG46594.1|  377|Homo sapiens ACTC protein.                184   2e-46
CR536516-1|CAG38754.1|  377|Homo sapiens ACTA1 protein.               184   2e-46
BC012597-1|AAH12597.1|  377|Homo sapiens actin, alpha 1, skeleta...   184   2e-46
BC009978-1|AAH09978.1|  377|Homo sapiens actin, alpha, cardiac m...   184   2e-46
AL160004-6|CAI19050.1|  377|Homo sapiens actin, alpha 1, skeleta...   184   2e-46
AF182035-1|AAF02694.1|  377|Homo sapiens skeletal muscle alpha-a...   184   2e-46
AY280960-1|AAP37280.1|  254|Homo sapiens actin alpha 1 skeletal ...   184   2e-46
X16940-1|CAA34814.1|  376|Homo sapiens protein ( Human mRNA for ...   183   5e-46
X13839-1|CAA32064.1|  377|Homo sapiens protein ( Human mRNA for ...   183   5e-46
J05192-1|AAA51577.1|  377|Homo sapiens ACTA3 protein.                 183   5e-46
D00654-1|BAA00546.1|  376|Homo sapiens enteric smooth muscle gam...   183   5e-46
CR541794-1|CAG46593.1|  376|Homo sapiens ACTG2 protein.               183   5e-46
CR536518-1|CAG38756.1|  377|Homo sapiens ACTA2 protein.               183   5e-46
BC094877-1|AAH94877.1|  376|Homo sapiens ACTG2 protein protein.       183   5e-46
BC093052-1|AAH93052.1|  377|Homo sapiens actin, alpha 2, smooth ...   183   5e-46
BC017554-1|AAH17554.1|  377|Homo sapiens actin, alpha 2, smooth ...   183   5e-46
BC012617-1|AAH12617.1|  376|Homo sapiens actin, gamma 2, smooth ...   183   5e-46
AY692464-1|AAW29811.1|  377|Homo sapiens growth-inhibiting gene ...   183   5e-46
AL157394-6|CAI13864.1|  377|Homo sapiens actin, alpha 2, smooth ...   183   5e-46
AC073046-2|AAX88909.1|  376|Homo sapiens unknown protein.             183   5e-46
AL157394-7|CAI13865.1|  151|Homo sapiens actin, alpha 2, smooth ...   182   7e-46
CR536515-1|CAG38753.1|  376|Homo sapiens ACTG2 protein.               182   9e-46
EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin prot...   182   1e-45
K01747-1|AAA51586.1|  330|Homo sapiens ACTA2 protein.                 180   4e-45
EF095209-1|ABL01513.1|  121|Homo sapiens beta-actin protein.          175   1e-43
AL160004-4|CAI19051.1|  287|Homo sapiens actin, alpha 1, skeleta...   144   3e-34
AY970420-1|AAX82229.1|  103|Homo sapiens actin-like protein prot...   126   8e-29
AY970501-1|AAX82307.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970498-1|AAX82304.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970497-1|AAX82303.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970495-1|AAX82301.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970494-1|AAX82300.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970493-1|AAX82299.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970491-1|AAX82297.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970489-1|AAX82295.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970488-1|AAX82294.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970487-1|AAX82293.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970486-1|AAX82292.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970479-1|AAX82285.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970478-1|AAX82284.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970477-1|AAX82283.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970476-1|AAX82282.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970474-1|AAX82280.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970473-1|AAX82279.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970472-1|AAX82278.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970471-1|AAX82277.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970470-1|AAX82276.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970469-1|AAX82275.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970468-1|AAX82274.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970462-1|AAX82269.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970443-1|AAX82252.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970441-1|AAX82250.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970426-1|AAX82235.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970419-1|AAX82228.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970418-1|AAX82227.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970417-1|AAX82226.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970416-1|AAX82225.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970415-1|AAX82224.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970414-1|AAX82223.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970413-1|AAX82222.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970412-1|AAX82221.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970411-1|AAX82220.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970410-1|AAX82219.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970409-1|AAX82218.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970408-1|AAX82217.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970406-1|AAX82215.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970405-1|AAX82214.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970404-1|AAX82213.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970403-1|AAX82212.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970402-1|AAX82211.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970383-1|AAX82192.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970382-1|AAX82191.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970381-1|AAX82190.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970380-1|AAX82189.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970377-1|AAX82186.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970376-1|AAX82185.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970375-1|AAX82184.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970372-1|AAX82182.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970371-1|AAX82181.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970370-1|AAX82180.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970369-1|AAX82179.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970368-1|AAX82178.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970366-1|AAX82176.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970364-1|AAX82174.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970363-1|AAX82173.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970502-1|AAX82308.1|  103|Homo sapiens actin-like protein prot...   123   4e-28
AY970480-1|AAX82286.1|  103|Homo sapiens actin-like protein prot...   123   4e-28
AY970460-1|AAX82267.1|  103|Homo sapiens actin-like protein prot...   123   4e-28
AY970457-1|AAX82264.1|  103|Homo sapiens actin-like protein prot...   123   4e-28
AY970446-1|AAX82255.1|  103|Homo sapiens actin-like protein prot...   123   4e-28
AY970431-1|AAX82240.1|  103|Homo sapiens actin-like protein prot...   123   4e-28
AY970430-1|AAX82239.1|  103|Homo sapiens actin-like protein prot...   123   4e-28
AY970428-1|AAX82237.1|  103|Homo sapiens actin-like protein prot...   123   4e-28
AY970421-1|AAX82230.1|  103|Homo sapiens actin-like protein prot...   123   4e-28
AY970390-1|AAX82199.1|  103|Homo sapiens actin-like protein prot...   123   4e-28
AY970389-1|AAX82198.1|  103|Homo sapiens actin-like protein prot...   123   4e-28
AY970386-1|AAX82195.1|  103|Homo sapiens actin-like protein prot...   123   4e-28
AY970378-1|AAX82187.1|  103|Homo sapiens actin-like protein prot...   123   4e-28
AY970464-1|AAX82271.1|  103|Homo sapiens actin-like protein prot...   123   6e-28
AY970499-1|AAX82305.1|  103|Homo sapiens actin-like protein prot...   122   8e-28
AY970492-1|AAX82298.1|  103|Homo sapiens actin-like protein prot...   122   8e-28
AY970490-1|AAX82296.1|  103|Homo sapiens actin-like protein prot...   122   1e-27
AY970444-1|AAX82253.1|  103|Homo sapiens actin-like protein prot...   122   1e-27
AY970500-1|AAX82306.1|  103|Homo sapiens actin-like protein prot...   122   1e-27
AY970456-1|AAX82263.1|  103|Homo sapiens actin-like protein prot...   122   1e-27
AY970442-1|AAX82251.1|  103|Homo sapiens actin-like protein prot...   122   1e-27
AY970429-1|AAX82238.1|  103|Homo sapiens actin-like protein prot...   122   1e-27
AY970388-1|AAX82197.1|  103|Homo sapiens actin-like protein prot...   122   1e-27
AY970387-1|AAX82196.1|  103|Homo sapiens actin-like protein prot...   122   1e-27
AY970432-1|AAX82241.1|  103|Homo sapiens actin-like protein prot...   121   2e-27
AY970392-1|AAX82201.1|  103|Homo sapiens actin-like protein prot...   121   2e-27
AY970374-1|AAX82183.1|  103|Homo sapiens actin-like protein prot...   121   2e-27
AY970367-1|AAX82177.1|  103|Homo sapiens actin-like protein prot...   121   2e-27
AY970485-1|AAX82291.1|  103|Homo sapiens actin-like protein prot...   121   2e-27
AY970463-1|AAX82270.1|  103|Homo sapiens actin-like protein prot...   121   2e-27
AY970391-1|AAX82200.1|  103|Homo sapiens actin-like protein prot...   121   2e-27
AY970385-1|AAX82194.1|  103|Homo sapiens actin-like protein prot...   121   2e-27
AY970365-1|AAX82175.1|  103|Homo sapiens actin-like protein prot...   121   2e-27
AY970496-1|AAX82302.1|  103|Homo sapiens actin-like protein prot...   120   3e-27
AY970458-1|AAX82265.1|  103|Homo sapiens actin-like protein prot...   120   4e-27
AY970454-1|AAX82261.1|  103|Homo sapiens actin-like protein prot...   120   4e-27
AY970455-1|AAX82262.1|  103|Homo sapiens actin-like protein prot...   120   5e-27
X82208-1|CAA57692.1|  329|Homo sapiens beta-centractin protein.       119   7e-27
X82207-1|CAA57691.1|  376|Homo sapiens beta-centracetin protein.      119   7e-27
BC010090-1|AAH10090.1|  376|Homo sapiens ARP1 actin-related prot...   119   7e-27
BC006372-1|AAH06372.1|  376|Homo sapiens ARP1 actin-related prot...   119   7e-27
BC004374-1|AAH04374.1|  376|Homo sapiens ARP1 actin-related prot...   119   7e-27
AY970483-1|AAX82289.1|  103|Homo sapiens actin-like protein prot...   119   7e-27
AC017099-2|AAY24280.1|  376|Homo sapiens unknown protein.             119   7e-27
AY970475-1|AAX82281.1|  103|Homo sapiens actin-like protein prot...   118   2e-26
AY970461-1|AAX82268.1|  103|Homo sapiens actin-like protein prot...   118   2e-26
AY970440-1|AAX82249.1|  103|Homo sapiens actin-like protein prot...   118   2e-26
AY970439-1|AAX82248.1|  103|Homo sapiens actin-like protein prot...   118   2e-26
AY970427-1|AAX82236.1|  103|Homo sapiens actin-like protein prot...   117   3e-26
Z14978-1|CAA78701.1|  376|Homo sapiens actin-related protein pro...   117   4e-26
X82206-1|CAA57690.1|  376|Homo sapiens alpha-centractin protein.      117   4e-26
BC026016-1|AAH26016.1|  376|Homo sapiens ARP1 actin-related prot...   117   4e-26
BC000693-1|AAH00693.1|  376|Homo sapiens ARP1 actin-related prot...   117   4e-26
AY970407-1|AAX82216.1|  103|Homo sapiens actin-like protein prot...   117   4e-26
AL121928-12|CAC08404.1|  376|Homo sapiens ARP1 actin-related pro...   117   4e-26
AY970384-1|AAX82193.1|  103|Homo sapiens actin-like protein prot...   116   9e-26
AY970424-1|AAX82233.1|  103|Homo sapiens actin-like protein prot...   115   2e-25
AY970451-1|AAX82259.1|  103|Homo sapiens actin-like protein prot...   114   2e-25
AY970425-1|AAX82234.1|  103|Homo sapiens actin-like protein prot...   114   2e-25
AY970447-1|AAX82256.1|  103|Homo sapiens actin-like protein prot...   114   3e-25
AY970481-1|AAX82287.1|  103|Homo sapiens actin-like protein prot...   113   5e-25
AY970452-1|AAX82260.1|  103|Homo sapiens actin-like protein prot...   113   5e-25
AY970448-1|AAX82257.1|  103|Homo sapiens actin-like protein prot...   113   6e-25
AY970433-1|AAX82242.1|  103|Homo sapiens actin-like protein prot...   112   8e-25
AY970459-1|AAX82266.1|  103|Homo sapiens actin-like protein prot...   111   1e-24
AY970395-1|AAX82204.1|  103|Homo sapiens actin-like protein prot...   111   2e-24
AY129015-1|AAM98758.1|  109|Homo sapiens unknown protein.             111   2e-24
AY970398-1|AAX82207.1|  103|Homo sapiens actin-like protein prot...   108   1e-23
AY970438-1|AAX82247.1|  103|Homo sapiens actin-like protein prot...   107   3e-23
AY970396-1|AAX82205.1|  103|Homo sapiens actin-like protein prot...   107   4e-23
AY970400-1|AAX82209.1|  103|Homo sapiens actin-like protein prot...   106   5e-23
AY970379-1|AAX82188.1|  103|Homo sapiens actin-like protein prot...   106   7e-23
AY970467-1|AAX82273.1|  103|Homo sapiens actin-like protein prot...   105   2e-22
AY970422-1|AAX82231.1|  103|Homo sapiens actin-like protein prot...   105   2e-22
AY970401-1|AAX82210.1|  103|Homo sapiens actin-like protein prot...   105   2e-22
AF006082-1|AAB64187.1|  394|Homo sapiens Arp2 protein.                105   2e-22
AY970465-1|AAX82272.1|  103|Homo sapiens actin-like protein prot...   104   2e-22
AY970445-1|AAX82254.1|  103|Homo sapiens actin-like protein prot...   104   3e-22
BC014546-1|AAH14546.1|  394|Homo sapiens ARP2 actin-related prot...   103   4e-22
AY970436-1|AAX82245.1|  103|Homo sapiens actin-like protein prot...   103   4e-22
Z74696-1|CAI42428.1|  376|Homo sapiens actin-related protein T1 ...   103   5e-22
BC014597-1|AAH14597.1|  376|Homo sapiens actin-related protein T...   103   5e-22
AY970423-1|AAX82232.1|  103|Homo sapiens actin-like protein prot...   103   5e-22
AF440739-1|AAM00432.1|  376|Homo sapiens actin-related protein T...   103   5e-22
AY970484-1|AAX82290.1|  103|Homo sapiens actin-like protein prot...   103   7e-22
BC036253-1|AAH36253.1|  339|Homo sapiens ACTR2 protein protein.       102   9e-22
AL160004-5|CAI19052.1|  342|Homo sapiens actin, alpha 1, skeleta...   101   2e-21
AK055346-1|BAB70906.1|  372|Homo sapiens protein ( Homo sapiens ...   101   2e-21
AB049117-1|BAB39481.1|  372|Homo sapiens actin related protein p...   101   2e-21
AY970435-1|AAX82244.1|  103|Homo sapiens actin-like protein prot...   100   5e-21
AY970434-1|AAX82243.1|  103|Homo sapiens actin-like protein prot...    99   6e-21
BC029499-1|AAH29499.1|  376|Homo sapiens actin-related protein T...   100   8e-21
AY970437-1|AAX82246.1|  103|Homo sapiens actin-like protein prot...   100   8e-21
AL356984-1|CAH72587.1|  377|Homo sapiens actin-related protein M...   100   8e-21
AK058153-1|BAB71690.1|  328|Homo sapiens protein ( Homo sapiens ...   100   8e-21
AF440740-1|AAM00433.1|  377|Homo sapiens actin-related protein T...   100   8e-21
AB057364-1|BAB85862.1|  377|Homo sapiens actin-related protein h...   100   8e-21
AY970503-1|AAX82309.1|  103|Homo sapiens actin-like protein prot...    99   1e-20
AY970450-1|AAX82258.1|  102|Homo sapiens actin-like protein prot...    99   1e-20
AY970394-1|AAX82203.1|  103|Homo sapiens actin-like protein prot...    99   1e-20
BC014610-1|AAH14610.1|  435|Homo sapiens actin-like 7A protein.        97   3e-20
AL359692-4|CAI40571.1|  435|Homo sapiens actin-like 7A protein.        97   3e-20
AF113526-1|AAD44109.1|  435|Homo sapiens actin-like-7-alpha prot...    97   3e-20
AB284520-1|BAF41971.1|  435|Homo sapiens human t-actin 2 protein.      97   3e-20
BC033789-1|AAH33789.1|  415|Homo sapiens actin-like 7B protein.        96   8e-20
BC007289-1|AAH07289.1|  372|Homo sapiens actin related protein M...    96   8e-20
AL359692-3|CAI40570.1|  415|Homo sapiens actin-like 7B protein.        96   8e-20
AF113527-1|AAD44110.1|  415|Homo sapiens actin-like-7-beta protein.    96   8e-20
AB284521-1|BAF41972.1|  415|Homo sapiens t-actin 1 protein.            96   8e-20
AY970397-1|AAX82206.1|  103|Homo sapiens actin-like protein prot...    96   1e-19
AY970482-1|AAX82288.1|  103|Homo sapiens actin-like protein prot...    95   1e-19
AY970393-1|AAX82202.1|  103|Homo sapiens actin-like protein prot...    95   2e-19
BC044590-1|AAH44590.1|  418|Homo sapiens ARP3 actin-related prot...    92   1e-18
AF127773-1|AAD51904.1|  418|Homo sapiens unknown protein.              92   1e-18
AF006083-1|AAB64188.1|  418|Homo sapiens Arp3 protein.                 92   1e-18
AC110769-1|AAX93226.1|  418|Homo sapiens unknown protein.              92   1e-18
AB209353-1|BAD92590.1|  369|Homo sapiens ARP3 actin-related prot...    92   1e-18
BC015207-1|AAH15207.1|  348|Homo sapiens ARP3 actin-related prot...    92   2e-18
BC008682-1|AAH08682.1|  418|Homo sapiens ARP3 actin-related prot...    92   2e-18
AF086920-1|AAP97150.1|  402|Homo sapiens actin related protein A...    92   2e-18
AF023453-1|AAC98904.1|  418|Homo sapiens actin-related protein 3...    92   2e-18
BC045752-1|AAH45752.1|  416|Homo sapiens hypothetical protein MG...    85   1e-16
BC024028-1|AAH24028.1|  416|Homo sapiens hypothetical protein MG...    85   1e-16
AY970399-1|AAX82208.1|   97|Homo sapiens actin-like protein prot...    85   2e-16
BC020944-1|AAH20944.1|  426|Homo sapiens actin-like 6B protein.        70   6e-12
AF053356-5|AAC78795.1|  475|Homo sapiens actin like gene protein.      70   6e-12
AF041475-1|AAD54678.1|  426|Homo sapiens BAF53b protein.               70   6e-12
AC099394-1|AAP21874.1|  426|Homo sapiens unknown protein.              70   6e-12
AB015906-1|BAA74576.1|  426|Homo sapiens actin-related protein h...    70   6e-12
BC036371-1|AAH36371.1|  429|Homo sapiens actin-like 6A protein.        70   8e-12
BC001391-1|AAH01391.1|  429|Homo sapiens actin-like 6A protein.        70   8e-12
BC000949-1|AAH00949.1|  387|Homo sapiens actin-like 6A protein.        70   8e-12
AK223212-1|BAD96932.1|  429|Homo sapiens actin-like 6A isoform 1...    70   8e-12
AF041474-1|AAC94991.1|  429|Homo sapiens BAF53a protein.               70   8e-12
AB061315-1|BAB87848.1|  387|Homo sapiens hArpNbeta-s protein.          70   8e-12
AB060168-1|BAB87844.1|  387|Homo sapiens hArpNbeta-s protein.          70   8e-12
AB015907-1|BAA74577.1|  429|Homo sapiens actin-related protein h...    70   8e-12
CR533529-1|CAG38560.1|  429|Homo sapiens BAF53A protein.               69   1e-11
BC113036-1|AAI13037.1|  103|Homo sapiens ACTB protein protein.         63   7e-10
BC028909-1|AAH28909.1|  366|Homo sapiens actin-like 8 protein.         63   9e-10
AL136529-1|CAC15940.1|  366|Homo sapiens actin-like 8 protein.         63   9e-10
AK057339-1|BAB71434.1|  366|Homo sapiens protein ( Homo sapiens ...    63   9e-10
BC023548-1|AAH23548.1|  263|Homo sapiens ACTG1 protein protein.        58   2e-08
BC038402-1|AAH38402.1|  607|Homo sapiens ARP5 actin-related prot...    48   3e-05
AL133519-2|CAD37358.1|  607|Homo sapiens ARP5 actin-related prot...    48   3e-05
AK022847-1|BAB14270.1|  607|Homo sapiens protein ( Homo sapiens ...    48   3e-05
AY211911-1|AAO65164.1|  280|Homo sapiens sarcoma antigen NY-SAR-...    44   4e-04
U20582-1|AAA62476.1|  302|Homo sapiens protein ( Human actin-lik...    44   6e-04
BC015107-1|AAH15107.1|  396|Homo sapiens ARP6 actin-related prot...    42   0.002
AK222959-1|BAD96679.1|  396|Homo sapiens ARP6 actin-related prot...    42   0.002
AK023495-1|BAB14588.1|  396|Homo sapiens protein ( Homo sapiens ...    42   0.002
AF212251-1|AAK14934.1|  396|Homo sapiens CDA12 protein.                42   0.002
AB038229-1|BAB20762.1|  396|Homo sapiens hARPX protein.                42   0.002
BC004223-1|AAH04223.2|   32|Homo sapiens ACTG1 protein protein.        41   0.003
BC011997-1|AAH11997.1|  417|Homo sapiens actin-related protein 1...    39   0.016
BC005208-1|AAH05208.1|  339|Homo sapiens Unknown (protein for IM...    39   0.016
AK222702-1|BAD96422.1|  417|Homo sapiens uncharacterized hypotha...    39   0.016
AK222624-1|BAD96344.1|  417|Homo sapiens uncharacterized hypotha...    39   0.016
AK022534-1|BAB14083.1|  417|Homo sapiens protein ( Homo sapiens ...    39   0.016
AK000544-1|BAA91243.1|  417|Homo sapiens protein ( Homo sapiens ...    39   0.016
AF220190-1|AAF67655.1|  417|Homo sapiens uncharacterized hypotha...    39   0.016
BC020234-1|AAH20234.1|  195|Homo sapiens Unknown (protein for MG...    36   0.11 
K00790-1|AAA51578.1|   17|Homo sapiens ACTB protein.                   34   0.35 
BC126219-1|AAI26220.1|  917|Homo sapiens scaffold attachment fac...    31   3.2  
X07994-1|CAA30801.1| 1927|Homo sapiens protein ( Human mRNA for ...    31   4.3  
M61850-1|AAA59504.1| 1927|Homo sapiens lactase phlorizinhydrolas...    31   4.3  
AK126430-1|BAC86548.1|  252|Homo sapiens protein ( Homo sapiens ...    31   4.3  
AC011893-3|AAX88924.1| 1927|Homo sapiens unknown protein.              31   4.3  
BC146794-1|AAI46795.1| 1919|Homo sapiens discs, large homolog 5 ...    30   5.6  
BC073996-1|AAH73996.1|  845|Homo sapiens DLG5 protein protein.         30   5.6  
BC013946-1|AAH13946.1|  288|Homo sapiens Kruppel-like factor 13 ...    30   5.6  
BC012741-1|AAH12741.1|  288|Homo sapiens Kruppel-like factor 13 ...    30   5.6  
BC010438-1|AAH10438.1|  288|Homo sapiens Kruppel-like factor 13 ...    30   5.6  
AL450306-3|CAI17324.2| 1919|Homo sapiens discs, large homolog 5 ...    30   5.6  
AL450306-2|CAI17323.1|  880|Homo sapiens discs, large homolog 5 ...    30   5.6  
AL391421-2|CAI12104.2| 1919|Homo sapiens discs, large homolog 5 ...    30   5.6  
AL391421-1|CAI12103.1|  880|Homo sapiens discs, large homolog 5 ...    30   5.6  
AF352034-1|AAL83938.1| 1809|Homo sapiens DLG5 protein.                 30   5.6  
AF352033-1|AAL83937.1| 1809|Homo sapiens DLG5 protein.                 30   5.6  
AF150628-1|AAD34020.1|  289|Homo sapiens transcription factor NS...    30   5.6  
AF132599-1|AAD26864.1|  288|Homo sapiens RANTES factor of late a...    30   5.6  
AB091676-1|BAC65420.1| 1764|Homo sapiens discs large protein lp-...    30   5.6  
AB011155-1|BAA25509.2| 1952|Homo sapiens KIAA0583 protein protein.     30   5.6  
BC117303-1|AAI17304.1| 1021|Homo sapiens dynein heavy chain doma...    25   6.8  
BC117301-1|AAI17302.1| 1021|Homo sapiens dynein heavy chain doma...    25   6.8  
AK057314-1|BAB71423.1| 1021|Homo sapiens protein ( Homo sapiens ...    25   6.8  
AB039791-1|BAB21501.1|  210|Homo sapiens actin-related protein A...    30   7.5  

>X63432-1|CAA45026.1|  375|Homo sapiens mutant beta-actin
           (beta'-actin) protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAMLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (259), Expect = 2e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>X04098-1|CAA27723.1|  375|Homo sapiens gamma-actin protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (260), Expect = 1e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>X00351-1|CAA25099.1|  375|Homo sapiens protein ( Human mRNA for
           beta-actin. ).
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (259), Expect = 2e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>M19283-1|AAA51579.1|  375|Homo sapiens ACTG1 protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (260), Expect = 1e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>M10277-1|AAA51567.1|  375|Homo sapiens protein ( Human cytoplasmic
           beta-actin gene, complete cds. ).
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (259), Expect = 2e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>DQ471327-1|ABF01018.1|  375|Homo sapiens PS1TP5-binding protein 1
           protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (259), Expect = 2e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>BT019856-1|AAV38659.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (260), Expect = 1e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>BC053572-1|AAH53572.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (260), Expect = 1e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>BC018774-1|AAH18774.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (260), Expect = 1e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>BC017450-1|AAH17450.1|  363|Homo sapiens Unknown (protein for
           IMAGE:3538275) protein.
          Length = 363

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 36  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 95

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 96  APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 153



 Score = 78.2 bits (184), Expect = 2e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 148 KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 6   KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 40


>BC015779-1|AAH15779.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (260), Expect = 1e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>BC015695-1|AAH15695.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (260), Expect = 1e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>BC015005-1|AAH15005.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (260), Expect = 1e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>BC014861-1|AAH14861.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (259), Expect = 2e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>BC013380-1|AAH13380.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (259), Expect = 2e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>BC012050-1|AAH12050.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (260), Expect = 1e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>BC010999-1|AAH10999.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (260), Expect = 1e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>BC009848-1|AAH09848.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (260), Expect = 1e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>BC008633-1|AAH08633.1|  368|Homo sapiens actin, beta protein.
          Length = 368

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 41  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 100

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 101 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 158



 Score =   99 bits (238), Expect = 6e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 45


>BC007442-1|AAH07442.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (260), Expect = 1e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>BC004251-1|AAH04251.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (259), Expect = 2e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>BC002409-1|AAH02409.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (259), Expect = 2e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>BC001920-1|AAH01920.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (260), Expect = 1e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>BC001301-1|AAH01301.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (259), Expect = 2e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>BC000292-1|AAH00292.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (260), Expect = 1e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>AY582799-1|AAS79319.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (259), Expect = 2e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>AK223055-1|BAD96775.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (259), Expect = 2e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>AK223032-1|BAD96752.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (259), Expect = 2e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>AK222925-1|BAD96645.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (259), Expect = 2e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>AC006483-1|AAP22343.1|  375|Homo sapiens unknown protein.
          Length = 375

 Score =  189 bits (461), Expect = 6e-48
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (259), Expect = 2e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>BC016045-1|AAH16045.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  187 bits (456), Expect = 2e-47
 Identities = 92/119 (77%), Positives = 94/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRV PEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVPPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (259), Expect = 2e-23
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>BC012854-1|AAH12854.1|  360|Homo sapiens ACTB protein protein.
          Length = 360

 Score =  186 bits (454), Expect = 4e-47
 Identities = 92/119 (77%), Positives = 94/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 33  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 92

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKAN EKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 93  APLNPKANLEKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 150



 Score = 83.8 bits (198), Expect = 4e-16
 Identities = 37/37 (100%), Positives = 37/37 (100%)
 Frame = +1

Query: 142 MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 37


>M20543-1|AAA60296.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  184 bits (449), Expect = 2e-46
 Identities = 90/119 (75%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTE
Sbjct: 50  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 167



 Score =  101 bits (243), Expect = 2e-21
 Identities = 48/54 (88%), Positives = 49/54 (90%), Gaps = 1/54 (1%)
 Frame = +1

Query: 94  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 54


>J00073-1|AAB59619.1|  377|Homo sapiens alpha-cardiac actin protein.
          Length = 377

 Score =  184 bits (449), Expect = 2e-46
 Identities = 90/119 (75%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTE
Sbjct: 50  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 167



 Score =  101 bits (243), Expect = 2e-21
 Identities = 48/54 (88%), Positives = 49/54 (90%), Gaps = 1/54 (1%)
 Frame = +1

Query: 94  MCD-EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD EE  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 54


>J00068-1|AAB59376.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  184 bits (449), Expect = 2e-46
 Identities = 90/119 (75%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTE
Sbjct: 50  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 167



 Score =  101 bits (243), Expect = 2e-21
 Identities = 48/54 (88%), Positives = 49/54 (90%), Gaps = 1/54 (1%)
 Frame = +1

Query: 94  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 54


>CR541796-1|CAG46595.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  184 bits (449), Expect = 2e-46
 Identities = 90/119 (75%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTE
Sbjct: 50  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 167



 Score =  101 bits (243), Expect = 2e-21
 Identities = 48/54 (88%), Positives = 49/54 (90%), Gaps = 1/54 (1%)
 Frame = +1

Query: 94  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 54


>CR541795-1|CAG46594.1|  377|Homo sapiens ACTC protein.
          Length = 377

 Score =  184 bits (449), Expect = 2e-46
 Identities = 90/119 (75%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTE
Sbjct: 50  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 167



 Score =  101 bits (243), Expect = 2e-21
 Identities = 48/54 (88%), Positives = 49/54 (90%), Gaps = 1/54 (1%)
 Frame = +1

Query: 94  MCD-EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD EE  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 54


>CR536516-1|CAG38754.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  184 bits (449), Expect = 2e-46
 Identities = 90/119 (75%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTE
Sbjct: 50  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 167



 Score =  101 bits (243), Expect = 2e-21
 Identities = 48/54 (88%), Positives = 49/54 (90%), Gaps = 1/54 (1%)
 Frame = +1

Query: 94  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 54


>BC012597-1|AAH12597.1|  377|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 377

 Score =  184 bits (449), Expect = 2e-46
 Identities = 90/119 (75%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTE
Sbjct: 50  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 167



 Score =  101 bits (243), Expect = 2e-21
 Identities = 48/54 (88%), Positives = 49/54 (90%), Gaps = 1/54 (1%)
 Frame = +1

Query: 94  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 54


>BC009978-1|AAH09978.1|  377|Homo sapiens actin, alpha, cardiac
           muscle 1 protein.
          Length = 377

 Score =  184 bits (449), Expect = 2e-46
 Identities = 90/119 (75%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTE
Sbjct: 50  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 167



 Score =  101 bits (243), Expect = 2e-21
 Identities = 48/54 (88%), Positives = 49/54 (90%), Gaps = 1/54 (1%)
 Frame = +1

Query: 94  MCD-EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD EE  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 54


>AL160004-6|CAI19050.1|  377|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 377

 Score =  184 bits (449), Expect = 2e-46
 Identities = 90/119 (75%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTE
Sbjct: 50  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 167



 Score =  101 bits (243), Expect = 2e-21
 Identities = 48/54 (88%), Positives = 49/54 (90%), Gaps = 1/54 (1%)
 Frame = +1

Query: 94  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 54


>AF182035-1|AAF02694.1|  377|Homo sapiens skeletal muscle
           alpha-actin precursor protein.
          Length = 377

 Score =  184 bits (449), Expect = 2e-46
 Identities = 90/119 (75%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTE
Sbjct: 50  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 167



 Score =  101 bits (243), Expect = 2e-21
 Identities = 48/54 (88%), Positives = 49/54 (90%), Gaps = 1/54 (1%)
 Frame = +1

Query: 94  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 54


>AY280960-1|AAP37280.1|  254|Homo sapiens actin alpha 1 skeletal
           muscle protein protein.
          Length = 254

 Score =  184 bits (448), Expect = 2e-46
 Identities = 83/91 (91%), Positives = 85/91 (93%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTE
Sbjct: 50  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           APLNPKANREKMTQIMFETFN PAMYVAIQA
Sbjct: 110 APLNPKANREKMTQIMFETFNVPAMYVAIQA 140



 Score =  101 bits (243), Expect = 2e-21
 Identities = 48/54 (88%), Positives = 49/54 (90%), Gaps = 1/54 (1%)
 Frame = +1

Query: 94  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 54



 Score = 35.1 bits (77), Expect = 0.20
 Identities = 16/17 (94%), Positives = 17/17 (100%)
 Frame = +2

Query: 506 SVLSLYASGRTTGIVLD 556
           +VLSLYASGRTTGIVLD
Sbjct: 140 AVLSLYASGRTTGIVLD 156


>X16940-1|CAA34814.1|  376|Homo sapiens protein ( Human mRNA for
           enteric smooth muscle gamma-actin. ).
          Length = 376

 Score =  183 bits (445), Expect = 5e-46
 Identities = 89/119 (74%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 166



 Score =  108 bits (260), Expect = 1e-23
 Identities = 48/53 (90%), Positives = 50/53 (94%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>X13839-1|CAA32064.1|  377|Homo sapiens protein ( Human mRNA for
           vascular smooth muscle alpha-actin. ).
          Length = 377

 Score =  183 bits (445), Expect = 5e-46
 Identities = 89/119 (74%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTE
Sbjct: 50  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 167



 Score =  103 bits (247), Expect = 5e-22
 Identities = 48/54 (88%), Positives = 51/54 (94%), Gaps = 1/54 (1%)
 Frame = +1

Query: 94  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 54


>J05192-1|AAA51577.1|  377|Homo sapiens ACTA3 protein.
          Length = 377

 Score =  183 bits (445), Expect = 5e-46
 Identities = 89/119 (74%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTE
Sbjct: 50  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 167



 Score =  103 bits (247), Expect = 5e-22
 Identities = 48/54 (88%), Positives = 51/54 (94%), Gaps = 1/54 (1%)
 Frame = +1

Query: 94  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 54


>D00654-1|BAA00546.1|  376|Homo sapiens enteric smooth muscle
           gamma-actin protein.
          Length = 376

 Score =  183 bits (445), Expect = 5e-46
 Identities = 89/119 (74%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 166



 Score =  108 bits (260), Expect = 1e-23
 Identities = 48/53 (90%), Positives = 50/53 (94%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>CR541794-1|CAG46593.1|  376|Homo sapiens ACTG2 protein.
          Length = 376

 Score =  183 bits (445), Expect = 5e-46
 Identities = 89/119 (74%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 166



 Score =  108 bits (260), Expect = 1e-23
 Identities = 48/53 (90%), Positives = 50/53 (94%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>CR536518-1|CAG38756.1|  377|Homo sapiens ACTA2 protein.
          Length = 377

 Score =  183 bits (445), Expect = 5e-46
 Identities = 89/119 (74%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTE
Sbjct: 50  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 167



 Score =  103 bits (247), Expect = 5e-22
 Identities = 48/54 (88%), Positives = 51/54 (94%), Gaps = 1/54 (1%)
 Frame = +1

Query: 94  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 54


>BC094877-1|AAH94877.1|  376|Homo sapiens ACTG2 protein protein.
          Length = 376

 Score =  183 bits (445), Expect = 5e-46
 Identities = 89/119 (74%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 166



 Score =  108 bits (260), Expect = 1e-23
 Identities = 48/53 (90%), Positives = 50/53 (94%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>BC093052-1|AAH93052.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  183 bits (445), Expect = 5e-46
 Identities = 89/119 (74%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTE
Sbjct: 50  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 167



 Score =  103 bits (247), Expect = 5e-22
 Identities = 48/54 (88%), Positives = 51/54 (94%), Gaps = 1/54 (1%)
 Frame = +1

Query: 94  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 54


>BC017554-1|AAH17554.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  183 bits (445), Expect = 5e-46
 Identities = 89/119 (74%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTE
Sbjct: 50  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 167



 Score =  103 bits (247), Expect = 5e-22
 Identities = 48/54 (88%), Positives = 51/54 (94%), Gaps = 1/54 (1%)
 Frame = +1

Query: 94  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 54


>BC012617-1|AAH12617.1|  376|Homo sapiens actin, gamma 2, smooth
           muscle, enteric protein.
          Length = 376

 Score =  183 bits (445), Expect = 5e-46
 Identities = 89/119 (74%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 166



 Score =  108 bits (260), Expect = 1e-23
 Identities = 48/53 (90%), Positives = 50/53 (94%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>AY692464-1|AAW29811.1|  377|Homo sapiens growth-inhibiting gene 46
           protein.
          Length = 377

 Score =  183 bits (445), Expect = 5e-46
 Identities = 89/119 (74%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTE
Sbjct: 50  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 167



 Score =  103 bits (247), Expect = 5e-22
 Identities = 48/54 (88%), Positives = 51/54 (94%), Gaps = 1/54 (1%)
 Frame = +1

Query: 94  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 54


>AL157394-6|CAI13864.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  183 bits (445), Expect = 5e-46
 Identities = 89/119 (74%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTE
Sbjct: 50  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 167



 Score =  103 bits (247), Expect = 5e-22
 Identities = 48/54 (88%), Positives = 51/54 (94%), Gaps = 1/54 (1%)
 Frame = +1

Query: 94  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 54


>AC073046-2|AAX88909.1|  376|Homo sapiens unknown protein.
          Length = 376

 Score =  183 bits (445), Expect = 5e-46
 Identities = 89/119 (74%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 166



 Score =  108 bits (260), Expect = 1e-23
 Identities = 48/53 (90%), Positives = 50/53 (94%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>AL157394-7|CAI13865.1|  151|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 151

 Score =  182 bits (444), Expect = 7e-46
 Identities = 82/91 (90%), Positives = 85/91 (93%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTE
Sbjct: 50  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           APLNPKANREKMTQIMFETFN PAMYVAIQA
Sbjct: 110 APLNPKANREKMTQIMFETFNVPAMYVAIQA 140



 Score =  103 bits (247), Expect = 5e-22
 Identities = 48/54 (88%), Positives = 51/54 (94%), Gaps = 1/54 (1%)
 Frame = +1

Query: 94  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 54


>CR536515-1|CAG38753.1|  376|Homo sapiens ACTG2 protein.
          Length = 376

 Score =  182 bits (443), Expect = 9e-46
 Identities = 89/119 (74%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNFPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 166



 Score =  108 bits (260), Expect = 1e-23
 Identities = 48/53 (90%), Positives = 50/53 (94%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin protein.
          Length = 1075

 Score =  182 bits (442), Expect = 1e-45
 Identities = 91/131 (69%), Positives = 96/131 (73%)
 Frame = +3

Query: 201  GKAPPSGRDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 380
            G+    G  G    +   VG EAQSKRGILTLKYP+EHGI+TNWDDMEKIWHHTFYNELR
Sbjct: 736  GRPRQQGMMGGMHQKESYVGKEAQSKRGILTLKYPMEHGIITNWDDMEKIWHHTFYNELR 795

Query: 381  VAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTS 560
            VAPEEHPVLLTEA LNPKANREKMTQIMFETFNTPAMYVAIQA                S
Sbjct: 796  VAPEEHPVLLTEATLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYTSGRTTGIVMDS 855

Query: 561  GDGGLPHPCPI 593
            GD G+ H  PI
Sbjct: 856  GD-GVTHTVPI 865



 Score = 93.1 bits (221), Expect = 7e-19
 Identities = 41/51 (80%), Positives = 46/51 (90%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           D++ A LV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPR QG+M GM QK+S
Sbjct: 702 DDDTAVLVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRQQGMMGGMHQKES 752


>K01747-1|AAA51586.1|  330|Homo sapiens ACTA2 protein.
          Length = 330

 Score =  180 bits (438), Expect = 4e-45
 Identities = 88/119 (73%), Positives = 92/119 (77%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VG EAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTE
Sbjct: 50  GQKDSYVGHEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 110 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 167



 Score =  103 bits (247), Expect = 5e-22
 Identities = 48/54 (88%), Positives = 51/54 (94%), Gaps = 1/54 (1%)
 Frame = +1

Query: 94  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 54


>EF095209-1|ABL01513.1|  121|Homo sapiens beta-actin protein.
          Length = 121

 Score =  175 bits (425), Expect = 1e-43
 Identities = 79/84 (94%), Positives = 80/84 (95%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 38  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 97

Query: 417 APLNPKANREKMTQIMFETFNTPA 488
           APLNPKANREKMTQIMFETFNTPA
Sbjct: 98  APLNPKANREKMTQIMFETFNTPA 121



 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 42/42 (100%), Positives = 42/42 (100%)
 Frame = +1

Query: 127 DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 42


>AL160004-4|CAI19051.1|  287|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 287

 Score =  144 bits (348), Expect = 3e-34
 Identities = 64/75 (85%), Positives = 67/75 (89%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTE
Sbjct: 50  GQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTE 109

Query: 417 APLNPKANREKMTQI 461
           APLNPKANRE +  I
Sbjct: 110 APLNPKANREIVRDI 124



 Score =  101 bits (243), Expect = 2e-21
 Identities = 48/54 (88%), Positives = 49/54 (90%), Gaps = 1/54 (1%)
 Frame = +1

Query: 94  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 54


>AY970420-1|AAX82229.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  126 bits (303), Expect = 8e-29
 Identities = 66/88 (75%), Positives = 68/88 (77%), Gaps = 5/88 (5%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA----- 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 510 CSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
            S CT  +V       SGD G+ H  PI
Sbjct: 61  ASGCTTGIV-----MDSGD-GVTHTVPI 82


>AY970501-1|AAX82307.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970498-1|AAX82304.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970497-1|AAX82303.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970495-1|AAX82301.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970494-1|AAX82300.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970493-1|AAX82299.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970491-1|AAX82297.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970489-1|AAX82295.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970488-1|AAX82294.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970487-1|AAX82293.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970486-1|AAX82292.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970479-1|AAX82285.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AY970478-1|AAX82284.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970477-1|AAX82283.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970476-1|AAX82282.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970474-1|AAX82280.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970473-1|AAX82279.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970472-1|AAX82278.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970471-1|AAX82277.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970470-1|AAX82276.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970469-1|AAX82275.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970468-1|AAX82274.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970462-1|AAX82269.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 61/83 (73%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVPSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AY970443-1|AAX82252.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970441-1|AAX82250.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970426-1|AAX82235.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 61/83 (73%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVPSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AY970419-1|AAX82228.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970418-1|AAX82227.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970417-1|AAX82226.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970416-1|AAX82225.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970415-1|AAX82224.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970414-1|AAX82223.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970413-1|AAX82222.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970412-1|AAX82221.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970411-1|AAX82220.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970410-1|AAX82219.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970409-1|AAX82218.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970408-1|AAX82217.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970406-1|AAX82215.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970405-1|AAX82214.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970404-1|AAX82213.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970403-1|AAX82212.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970402-1|AAX82211.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970383-1|AAX82192.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970382-1|AAX82191.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970381-1|AAX82190.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970380-1|AAX82189.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970377-1|AAX82186.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970376-1|AAX82185.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970375-1|AAX82184.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970372-1|AAX82182.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970371-1|AAX82181.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970370-1|AAX82180.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970369-1|AAX82179.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970368-1|AAX82178.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970366-1|AAX82176.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970364-1|AAX82174.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970363-1|AAX82173.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (298), Expect = 3e-28
 Identities = 62/83 (74%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970502-1|AAX82308.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  123 bits (297), Expect = 4e-28
 Identities = 61/83 (73%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AY970480-1|AAX82286.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  123 bits (297), Expect = 4e-28
 Identities = 61/83 (73%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AY970460-1|AAX82267.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  123 bits (297), Expect = 4e-28
 Identities = 61/83 (73%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AY970457-1|AAX82264.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  123 bits (297), Expect = 4e-28
 Identities = 61/83 (73%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AY970446-1|AAX82255.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  123 bits (297), Expect = 4e-28
 Identities = 61/83 (73%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AY970431-1|AAX82240.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  123 bits (297), Expect = 4e-28
 Identities = 61/83 (73%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AY970430-1|AAX82239.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  123 bits (297), Expect = 4e-28
 Identities = 61/83 (73%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AY970428-1|AAX82237.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  123 bits (297), Expect = 4e-28
 Identities = 61/83 (73%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AY970421-1|AAX82230.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  123 bits (297), Expect = 4e-28
 Identities = 61/83 (73%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970390-1|AAX82199.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  123 bits (297), Expect = 4e-28
 Identities = 61/83 (73%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AY970389-1|AAX82198.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  123 bits (297), Expect = 4e-28
 Identities = 61/83 (73%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AY970386-1|AAX82195.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  123 bits (297), Expect = 4e-28
 Identities = 61/83 (73%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AY970378-1|AAX82187.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  123 bits (297), Expect = 4e-28
 Identities = 61/83 (73%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AY970464-1|AAX82271.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  123 bits (296), Expect = 6e-28
 Identities = 61/83 (73%), Positives = 62/83 (74%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G  H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GFTHTVPI 82


>AY970499-1|AAX82305.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  122 bits (295), Expect = 8e-28
 Identities = 55/55 (100%), Positives = 55/55 (100%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 55



 Score = 36.7 bits (81), Expect = 0.065
 Identities = 16/18 (88%), Positives = 18/18 (100%)
 Frame = +2

Query: 506 SVLSLYASGRTTGIVLDF 559
           +VLSLYASGRTTGIV+DF
Sbjct: 55  AVLSLYASGRTTGIVMDF 72


>AY970492-1|AAX82298.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  122 bits (295), Expect = 8e-28
 Identities = 61/83 (73%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLT+APLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTQAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970490-1|AAX82296.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  122 bits (294), Expect = 1e-27
 Identities = 61/83 (73%), Positives = 62/83 (74%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRV PEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVTPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970444-1|AAX82253.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  122 bits (294), Expect = 1e-27
 Identities = 61/83 (73%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYN+LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNKLRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970500-1|AAX82306.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  122 bits (293), Expect = 1e-27
 Identities = 61/83 (73%), Positives = 62/83 (74%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ MFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQTMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970456-1|AAX82263.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  122 bits (293), Expect = 1e-27
 Identities = 60/83 (72%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPA+YVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAIYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AY970442-1|AAX82251.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  122 bits (293), Expect = 1e-27
 Identities = 61/83 (73%), Positives = 62/83 (74%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN EKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANHEKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970429-1|AAX82238.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  122 bits (293), Expect = 1e-27
 Identities = 60/83 (72%), Positives = 63/83 (75%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMT+IMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTRIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AY970388-1|AAX82197.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  122 bits (293), Expect = 1e-27
 Identities = 60/83 (72%), Positives = 62/83 (74%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYV IQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVTIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AY970387-1|AAX82196.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  122 bits (293), Expect = 1e-27
 Identities = 60/83 (72%), Positives = 62/83 (74%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYV IQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVTIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AY970432-1|AAX82241.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  121 bits (292), Expect = 2e-27
 Identities = 60/83 (72%), Positives = 62/83 (74%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKAN EKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANHEKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGHTTGIVMDSGD-GVTHTVPI 82


>AY970392-1|AAX82201.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  121 bits (292), Expect = 2e-27
 Identities = 60/83 (72%), Positives = 62/83 (74%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKAN EKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANHEKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AY970374-1|AAX82183.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  121 bits (292), Expect = 2e-27
 Identities = 61/83 (73%), Positives = 62/83 (74%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPL PKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLTPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970367-1|AAX82177.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  121 bits (292), Expect = 2e-27
 Identities = 63/88 (71%), Positives = 65/88 (73%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIW HTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWRHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPILRKGF 608
                      SGD G+ H  PI  KG+
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPIY-KGY 86


>AY970485-1|AAX82291.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  121 bits (291), Expect = 2e-27
 Identities = 61/83 (73%), Positives = 62/83 (74%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF TFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFGTFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970463-1|AAX82270.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  121 bits (291), Expect = 2e-27
 Identities = 60/83 (72%), Positives = 62/83 (74%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFY+ELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYSELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G  H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GFTHTVPI 82


>AY970391-1|AAX82200.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  121 bits (291), Expect = 2e-27
 Identities = 60/83 (72%), Positives = 62/83 (74%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNP ANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPMANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIFMDSGD-GVTHTAPI 82


>AY970385-1|AAX82194.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  121 bits (291), Expect = 2e-27
 Identities = 60/83 (72%), Positives = 62/83 (74%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKAN EKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANHEKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHNVPI 82


>AY970365-1|AAX82175.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  121 bits (291), Expect = 2e-27
 Identities = 61/83 (73%), Positives = 62/83 (74%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNEL VAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELGVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970496-1|AAX82302.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  120 bits (290), Expect = 3e-27
 Identities = 61/83 (73%), Positives = 62/83 (74%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWH TFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHRTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970458-1|AAX82265.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  120 bits (289), Expect = 4e-27
 Identities = 53/55 (96%), Positives = 55/55 (100%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           KIWHHTFYNELRVAPEEHP+LLTEAPL+PKANREKMTQIMFETFNTPAMYVAIQA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLSPKANREKMTQIMFETFNTPAMYVAIQA 55



 Score = 33.1 bits (72), Expect = 0.80
 Identities = 16/25 (64%), Positives = 19/25 (76%)
 Frame = +2

Query: 506 SVLSLYASGRTTGIVLDFRRRGSST 580
           +VLSLY SGRTTGIV+D   R + T
Sbjct: 55  AVLSLYTSGRTTGIVMDSGDRVTPT 79


>AY970454-1|AAX82261.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  120 bits (289), Expect = 4e-27
 Identities = 60/83 (72%), Positives = 62/83 (74%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEH +LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHSILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AY970455-1|AAX82262.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  120 bits (288), Expect = 5e-27
 Identities = 60/83 (72%), Positives = 62/83 (74%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAM VAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMCVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>X82208-1|CAA57692.1|  329|Homo sapiens beta-centractin protein.
          Length = 329

 Score =  119 bits (287), Expect = 7e-27
 Identities = 56/121 (46%), Positives = 81/121 (66%), Gaps = 1/121 (0%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPL 425
           L +G +A+  RG+LT++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPL
Sbjct: 26  LFIGPKAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPL 85

Query: 426 NPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPILRKG 605
           NP  NREK  ++ FETFN PA+++++QA                SGD G+ H  PI  +G
Sbjct: 86  NPSKNREKAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGD-GVTHAVPIY-EG 143

Query: 606 F 608
           F
Sbjct: 144 F 144



 Score = 30.3 bits (65), Expect = 5.6
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +1

Query: 175 PRAVFPSIVGRPRHQGVMVGMGQKD 249
           P+  FP+ VGRP+H  VM G  + D
Sbjct: 1   PKYCFPNYVGRPKHMRVMAGALEGD 25


>X82207-1|CAA57691.1|  376|Homo sapiens beta-centracetin protein.
          Length = 376

 Score =  119 bits (287), Expect = 7e-27
 Identities = 56/121 (46%), Positives = 81/121 (66%), Gaps = 1/121 (0%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPL 425
           L +G +A+  RG+LT++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPL
Sbjct: 56  LFIGPKAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPL 115

Query: 426 NPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPILRKG 605
           NP  NREK  ++ FETFN PA+++++QA                SGD G+ H  PI  +G
Sbjct: 116 NPSKNREKAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGD-GVTHAVPIY-EG 173

Query: 606 F 608
           F
Sbjct: 174 F 174



 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 25/44 (56%), Positives = 32/44 (72%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGD 55


>BC010090-1|AAH10090.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score =  119 bits (287), Expect = 7e-27
 Identities = 56/121 (46%), Positives = 81/121 (66%), Gaps = 1/121 (0%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPL 425
           L +G +A+  RG+LT++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPL
Sbjct: 56  LFIGPKAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPL 115

Query: 426 NPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPILRKG 605
           NP  NREK  ++ FETFN PA+++++QA                SGD G+ H  PI  +G
Sbjct: 116 NPSKNREKAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGD-GVTHAVPIY-EG 173

Query: 606 F 608
           F
Sbjct: 174 F 174



 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 25/44 (56%), Positives = 32/44 (72%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGD 55


>BC006372-1|AAH06372.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score =  119 bits (287), Expect = 7e-27
 Identities = 56/121 (46%), Positives = 81/121 (66%), Gaps = 1/121 (0%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPL 425
           L +G +A+  RG+LT++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPL
Sbjct: 56  LFIGPKAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYAYSKDQLQTFSEEHPVLLTEAPL 115

Query: 426 NPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPILRKG 605
           NP  NREK  ++ FETFN PA+++++QA                SGD G+ H  PI  +G
Sbjct: 116 NPSKNREKAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGD-GVTHAVPIY-EG 173

Query: 606 F 608
           F
Sbjct: 174 F 174



 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 25/44 (56%), Positives = 32/44 (72%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGD 55


>BC004374-1|AAH04374.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score =  119 bits (287), Expect = 7e-27
 Identities = 56/121 (46%), Positives = 81/121 (66%), Gaps = 1/121 (0%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPL 425
           L +G +A+  RG+LT++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPL
Sbjct: 56  LFIGPKAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPL 115

Query: 426 NPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPILRKG 605
           NP  NREK  ++ FETFN PA+++++QA                SGD G+ H  PI  +G
Sbjct: 116 NPSKNREKAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGD-GVTHAVPIY-EG 173

Query: 606 F 608
           F
Sbjct: 174 F 174



 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 25/44 (56%), Positives = 32/44 (72%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGD 55


>AY970483-1|AAX82289.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  119 bits (287), Expect = 7e-27
 Identities = 60/83 (72%), Positives = 62/83 (74%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           +IWHHTFYNELRVAPEEHPVLLTEA LNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   RIWHHTFYNELRVAPEEHPVLLTEATLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AC017099-2|AAY24280.1|  376|Homo sapiens unknown protein.
          Length = 376

 Score =  119 bits (287), Expect = 7e-27
 Identities = 56/121 (46%), Positives = 81/121 (66%), Gaps = 1/121 (0%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPL 425
           L +G +A+  RG+LT++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPL
Sbjct: 56  LFIGPKAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPL 115

Query: 426 NPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPILRKG 605
           NP  NREK  ++ FETFN PA+++++QA                SGD G+ H  PI  +G
Sbjct: 116 NPSKNREKAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGD-GVTHAVPIY-EG 173

Query: 606 F 608
           F
Sbjct: 174 F 174



 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 25/44 (56%), Positives = 32/44 (72%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGD 55


>AY970475-1|AAX82281.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  118 bits (284), Expect = 2e-26
 Identities = 59/83 (71%), Positives = 62/83 (74%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHT YNELRVAPEEHPVLLTEAPLNPKANRE++TQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTLYNELRVAPEEHPVLLTEAPLNPKANREEITQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970461-1|AAX82268.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  118 bits (284), Expect = 2e-26
 Identities = 60/83 (72%), Positives = 61/83 (73%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHT YNELRVAPEEHPVLLTEA LNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTLYNELRVAPEEHPVLLTEATLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AY970440-1|AAX82249.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  118 bits (283), Expect = 2e-26
 Identities = 59/83 (71%), Positives = 61/83 (73%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQA     
Sbjct: 1   KIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVLDSGD-GVTHNVPI 82


>AY970439-1|AAX82248.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  118 bits (283), Expect = 2e-26
 Identities = 59/83 (71%), Positives = 61/83 (73%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQA     
Sbjct: 1   KIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVLDSGD-GVTHNVPI 82


>AY970427-1|AAX82236.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  117 bits (282), Expect = 3e-26
 Identities = 59/83 (71%), Positives = 61/83 (73%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIM ETFNTPAMYVA QA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMSETFNTPAMYVANQAMLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>Z14978-1|CAA78701.1|  376|Homo sapiens actin-related protein
           protein.
          Length = 376

 Score =  117 bits (281), Expect = 4e-26
 Identities = 54/121 (44%), Positives = 82/121 (67%), Gaps = 1/121 (0%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPL 425
           + +G +A+  RG+L+++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPL
Sbjct: 56  IFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPL 115

Query: 426 NPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPILRKG 605
           NP+ NRE+  ++ FETFN PA+++++QA                SGD G+ H  PI  +G
Sbjct: 116 NPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGD-GVTHAVPIY-EG 173

Query: 606 F 608
           F
Sbjct: 174 F 174



 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 25/44 (56%), Positives = 32/44 (72%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGD 55


>X82206-1|CAA57690.1|  376|Homo sapiens alpha-centractin protein.
          Length = 376

 Score =  117 bits (281), Expect = 4e-26
 Identities = 54/121 (44%), Positives = 82/121 (67%), Gaps = 1/121 (0%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPL 425
           + +G +A+  RG+L+++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPL
Sbjct: 56  IFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPL 115

Query: 426 NPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPILRKG 605
           NP+ NRE+  ++ FETFN PA+++++QA                SGD G+ H  PI  +G
Sbjct: 116 NPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGD-GVTHAVPIY-EG 173

Query: 606 F 608
           F
Sbjct: 174 F 174



 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 25/44 (56%), Positives = 32/44 (72%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGD 55


>BC026016-1|AAH26016.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score =  117 bits (281), Expect = 4e-26
 Identities = 54/121 (44%), Positives = 82/121 (67%), Gaps = 1/121 (0%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPL 425
           + +G +A+  RG+L+++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPL
Sbjct: 56  IFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPL 115

Query: 426 NPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPILRKG 605
           NP+ NRE+  ++ FETFN PA+++++QA                SGD G+ H  PI  +G
Sbjct: 116 NPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGD-GVTHAVPIY-EG 173

Query: 606 F 608
           F
Sbjct: 174 F 174



 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 25/44 (56%), Positives = 32/44 (72%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGD 55


>BC000693-1|AAH00693.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score =  117 bits (281), Expect = 4e-26
 Identities = 54/121 (44%), Positives = 82/121 (67%), Gaps = 1/121 (0%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPL 425
           + +G +A+  RG+L+++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPL
Sbjct: 56  IFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPL 115

Query: 426 NPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPILRKG 605
           NP+ NRE+  ++ FETFN PA+++++QA                SGD G+ H  PI  +G
Sbjct: 116 NPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGD-GVTHAVPIY-EG 173

Query: 606 F 608
           F
Sbjct: 174 F 174



 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 25/44 (56%), Positives = 32/44 (72%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGD 55


>AY970407-1|AAX82216.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  117 bits (281), Expect = 4e-26
 Identities = 60/83 (72%), Positives = 61/83 (73%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHT YNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM VAIQA     
Sbjct: 1   KIWHHTSYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMCVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGILMDSGD-GVTHTVPI 82


>AL121928-12|CAC08404.1|  376|Homo sapiens ARP1 actin-related
           protein 1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score =  117 bits (281), Expect = 4e-26
 Identities = 54/121 (44%), Positives = 82/121 (67%), Gaps = 1/121 (0%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPL 425
           + +G +A+  RG+L+++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPL
Sbjct: 56  IFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPL 115

Query: 426 NPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPILRKG 605
           NP+ NRE+  ++ FETFN PA+++++QA                SGD G+ H  PI  +G
Sbjct: 116 NPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGD-GVTHAVPIY-EG 173

Query: 606 F 608
           F
Sbjct: 174 F 174



 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 25/44 (56%), Positives = 32/44 (72%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGD 55


>AY970384-1|AAX82193.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  116 bits (278), Expect = 9e-26
 Identities = 57/83 (68%), Positives = 61/83 (73%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIW+HTFYNELRVAP+EHP+LLTEAPLNPK NREKMTQIMFE FNTPAMYVAIQA     
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMTQIMFEAFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHTVPI 82


>AY970424-1|AAX82233.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  115 bits (276), Expect = 2e-25
 Identities = 51/55 (92%), Positives = 54/55 (98%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           KIWHHTFYNELRVAP++HPVLLT+APLNPKANREKMTQIMFETFNT AMYVAIQA
Sbjct: 1   KIWHHTFYNELRVAPKQHPVLLTKAPLNPKANREKMTQIMFETFNTAAMYVAIQA 55



 Score = 31.9 bits (69), Expect = 1.8
 Identities = 13/17 (76%), Positives = 17/17 (100%)
 Frame = +2

Query: 506 SVLSLYASGRTTGIVLD 556
           ++LSLYASGRTTGI++D
Sbjct: 55  ALLSLYASGRTTGIMMD 71


>AY970451-1|AAX82259.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  114 bits (275), Expect = 2e-25
 Identities = 50/55 (90%), Positives = 53/55 (96%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           KIW+HTFYNELRVAP+EHP+LLTEAPLNPK NREKMTQIMFE FNTPAMYVAIQA
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMTQIMFEAFNTPAMYVAIQA 55



 Score = 34.3 bits (75), Expect = 0.35
 Identities = 15/17 (88%), Positives = 17/17 (100%)
 Frame = +2

Query: 506 SVLSLYASGRTTGIVLD 556
           +VLSLYASGRTTGIV+D
Sbjct: 55  AVLSLYASGRTTGIVMD 71


>AY970425-1|AAX82234.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  114 bits (275), Expect = 2e-25
 Identities = 58/83 (69%), Positives = 61/83 (73%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNEL VA +EHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAMLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AY970447-1|AAX82256.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  114 bits (274), Expect = 3e-25
 Identities = 57/83 (68%), Positives = 60/83 (72%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIM E F+ PAMYVAIQA     
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMLEIFDRPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AY970481-1|AAX82287.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  113 bits (272), Expect = 5e-25
 Identities = 51/55 (92%), Positives = 52/55 (94%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM E F+ PAMYVAIQA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMLEIFDRPAMYVAIQA 55



 Score = 31.1 bits (67), Expect = 3.2
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = +2

Query: 506 SVLSLYASGRTTGIVLDF 559
           +VLSLY SGRTT IV+D+
Sbjct: 55  AVLSLYTSGRTTDIVMDY 72


>AY970452-1|AAX82260.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  113 bits (272), Expect = 5e-25
 Identities = 56/83 (67%), Positives = 60/83 (72%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIW+HTFYNELRVAP+EHP+LLTEAPLNPK NREKMTQIMFE FNTPAMY AIQA     
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMTQIMFEAFNTPAMYAAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHIVPI 82


>AY970448-1|AAX82257.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  113 bits (271), Expect = 6e-25
 Identities = 50/55 (90%), Positives = 52/55 (94%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           KIWHHTFY E+RV PEEHPVL+TEA LNPKANREKMTQIMFETFNTPAMYVAIQA
Sbjct: 1   KIWHHTFYKEVRVVPEEHPVLVTEATLNPKANREKMTQIMFETFNTPAMYVAIQA 55


>AY970433-1|AAX82242.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  112 bits (270), Expect = 8e-25
 Identities = 56/83 (67%), Positives = 60/83 (72%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIW+HTFYNELRVAP+EHP+LLTEAPLNPK NREKM QIMFE FNTPAMYVAIQA     
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMIQIMFEAFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  ASGRTTGIVMDSGD-GVTHIVPI 82


>AY970459-1|AAX82266.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  111 bits (268), Expect = 1e-24
 Identities = 55/83 (66%), Positives = 62/83 (74%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHH F+NELRVAP++HP+LLT+APL+PKANREKMTQIMFETFNTPAMYVAIQA     
Sbjct: 1   KIWHHIFHNELRVAPKQHPMLLTKAPLDPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIVMDSGD-GVTHTVPI 82


>AY970395-1|AAX82204.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  111 bits (267), Expect = 2e-24
 Identities = 60/91 (65%), Positives = 65/91 (71%), Gaps = 5/91 (5%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA----- 509
           KIWHH FYN LRVAPEE  VLLTEAPLNP+ANREKMTQIMF+TFNTPAMYVAIQA     
Sbjct: 1   KIWHHVFYNVLRVAPEEQVVLLTEAPLNPRANREKMTQIMFKTFNTPAMYVAIQAVLTLH 60

Query: 510 CSRCTRPVVPPVSCWTSGDGGLPHPCPILRK 602
            S CT  +V       SGD G+ H  PI  +
Sbjct: 61  SSGCTTGIV-----MDSGD-GVTHTVPIYER 85


>AY129015-1|AAM98758.1|  109|Homo sapiens unknown protein.
          Length = 109

 Score =  111 bits (266), Expect = 2e-24
 Identities = 51/63 (80%), Positives = 55/63 (87%)
 Frame = +3

Query: 321 VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVA 500
           +TNWDD+EKIWHHTFY  L +A EEH VLLTE PLN KANREKMTQIMF+TFNT AMYVA
Sbjct: 1   MTNWDDIEKIWHHTFYKGLHMALEEHLVLLTEDPLNLKANREKMTQIMFDTFNTLAMYVA 60

Query: 501 IQA 509
           IQA
Sbjct: 61  IQA 63


>AY970398-1|AAX82207.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  108 bits (260), Expect = 1e-23
 Identities = 48/55 (87%), Positives = 52/55 (94%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           KIWHH F+NELRVAP++HPVLLT+APLNPKANREKMT IMFETFNT AMYVAIQA
Sbjct: 1   KIWHHIFHNELRVAPKQHPVLLTKAPLNPKANREKMTHIMFETFNTAAMYVAIQA 55



 Score = 31.9 bits (69), Expect = 1.8
 Identities = 13/17 (76%), Positives = 17/17 (100%)
 Frame = +2

Query: 506 SVLSLYASGRTTGIVLD 556
           ++LSLYASGRTTGI++D
Sbjct: 55  ALLSLYASGRTTGIMMD 71


>AY970438-1|AAX82247.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  107 bits (257), Expect = 3e-23
 Identities = 59/91 (64%), Positives = 64/91 (70%), Gaps = 5/91 (5%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA----- 509
           KIW H FYNEL VAPEE  VLLTEAPLNP+ANREKMTQIMF+TFNTPAMYVAIQA     
Sbjct: 1   KIWDHVFYNELWVAPEEQVVLLTEAPLNPRANREKMTQIMFKTFNTPAMYVAIQAVLSLH 60

Query: 510 CSRCTRPVVPPVSCWTSGDGGLPHPCPILRK 602
            S CT  +V       SGD G+ H  PI  +
Sbjct: 61  SSGCTTGIV-----MDSGD-GVTHTVPIYER 85


>AY970396-1|AAX82205.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  107 bits (256), Expect = 4e-23
 Identities = 47/55 (85%), Positives = 52/55 (94%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           KIWHHTFYN+L VAPEE+ VL+T+APLNPKANREKMTQIMFE FNTPAMY+AIQA
Sbjct: 1   KIWHHTFYNKLHVAPEEYLVLMTKAPLNPKANREKMTQIMFEVFNTPAMYMAIQA 55



 Score = 35.1 bits (77), Expect = 0.20
 Identities = 15/18 (83%), Positives = 17/18 (94%)
 Frame = +2

Query: 506 SVLSLYASGRTTGIVLDF 559
           +VLSLY SGRTTGIV+DF
Sbjct: 55  AVLSLYTSGRTTGIVMDF 72


>AY970400-1|AAX82209.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  106 bits (255), Expect = 5e-23
 Identities = 47/54 (87%), Positives = 51/54 (94%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQ 506
           KIWHHTFYNELRVAPEE P+LL EAPLNPKAN +KMTQI+FETFNTPAMY+AIQ
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLIEAPLNPKANCKKMTQIIFETFNTPAMYLAIQ 54



 Score = 33.9 bits (74), Expect = 0.46
 Identities = 15/17 (88%), Positives = 17/17 (100%)
 Frame = +2

Query: 506 SVLSLYASGRTTGIVLD 556
           ++LSLYASGRTTGIVLD
Sbjct: 55  TMLSLYASGRTTGIVLD 71


>AY970379-1|AAX82188.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  106 bits (254), Expect = 7e-23
 Identities = 46/55 (83%), Positives = 51/55 (92%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           KIWHHTFYNEL VAP+EH +LLTE PLNPKAN +KMTQIMFETFNTPA+Y+AIQA
Sbjct: 1   KIWHHTFYNELHVAPKEHRMLLTEVPLNPKANHKKMTQIMFETFNTPAVYMAIQA 55


>AY970467-1|AAX82273.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  105 bits (251), Expect = 2e-22
 Identities = 46/54 (85%), Positives = 51/54 (94%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQ 506
           KIWHHTFYNELRVAPEE P+LL EAPLNP+AN +KMTQI+FETFNTPAMY+AIQ
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKKMTQIIFETFNTPAMYLAIQ 54



 Score = 33.9 bits (74), Expect = 0.46
 Identities = 15/17 (88%), Positives = 17/17 (100%)
 Frame = +2

Query: 506 SVLSLYASGRTTGIVLD 556
           ++LSLYASGRTTGIVLD
Sbjct: 55  TMLSLYASGRTTGIVLD 71


>AY970422-1|AAX82231.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  105 bits (251), Expect = 2e-22
 Identities = 46/54 (85%), Positives = 51/54 (94%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQ 506
           KIWHHTFYNELRVAPEE P+LL EAPLNP+AN +KMTQI+FETFNTPAMY+AIQ
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKKMTQIIFETFNTPAMYLAIQ 54



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 14/17 (82%), Positives = 16/17 (94%)
 Frame = +2

Query: 506 SVLSLYASGRTTGIVLD 556
           ++LSLYASGRTTGIV D
Sbjct: 55  TMLSLYASGRTTGIVSD 71


>AY970401-1|AAX82210.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  105 bits (251), Expect = 2e-22
 Identities = 46/54 (85%), Positives = 51/54 (94%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQ 506
           KIWHHTFYNELRVAPEE P+LL EAPLNP+AN +KMTQI+FETFNTPAMY+AIQ
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKKMTQIIFETFNTPAMYLAIQ 54



 Score = 33.9 bits (74), Expect = 0.46
 Identities = 15/17 (88%), Positives = 17/17 (100%)
 Frame = +2

Query: 506 SVLSLYASGRTTGIVLD 556
           ++LSLYASGRTTGIVLD
Sbjct: 55  TMLSLYASGRTTGIVLD 71


>AF006082-1|AAB64187.1|  394|Homo sapiens Arp2 protein.
          Length = 394

 Score =  105 bits (251), Expect = 2e-22
 Identities = 55/128 (42%), Positives = 76/128 (59%), Gaps = 1/128 (0%)
 Frame = +3

Query: 228 GRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPV 404
           G    + L+VGDEA   R +L + YP+E+GIV NWDDM+ +W +TF  E L +      +
Sbjct: 48  GNIEIKDLMVGDEASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKI 107

Query: 405 LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHP 584
           LLTE P+NP  NREK+ ++MFET+    +YVAIQA        +       SGD G+ H 
Sbjct: 108 LLTEPPMNPTKNREKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGD-GVTHI 166

Query: 585 CPILRKGF 608
           CP+  +GF
Sbjct: 167 CPVY-EGF 173



 Score = 43.2 bits (97), Expect = 7e-04
 Identities = 16/31 (51%), Positives = 23/31 (74%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 210
           +V DNG+G  K G+AG + P  +FP++VGRP
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRP 39


>AY970465-1|AAX82272.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  104 bits (250), Expect = 2e-22
 Identities = 50/56 (89%), Positives = 52/56 (92%), Gaps = 1/56 (1%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF-NTPAMYVAIQA 509
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN  KMTQI FETF NTPA+Y+AIQA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN-HKMTQITFETFSNTPAIYMAIQA 55



 Score = 31.1 bits (67), Expect = 3.2
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = +2

Query: 509 VLSLYASGRTTGIVLD 556
           VLSLYASG TTGIV+D
Sbjct: 57  VLSLYASGLTTGIVMD 72


>AY970445-1|AAX82254.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  104 bits (249), Expect = 3e-22
 Identities = 46/55 (83%), Positives = 51/55 (92%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           KIWHH F+NELRVAP++HPVLLT+APLNP+ANREKMT IMFETF T AMYVAIQA
Sbjct: 1   KIWHHIFHNELRVAPKQHPVLLTKAPLNPRANREKMTHIMFETFYTAAMYVAIQA 55



 Score = 31.9 bits (69), Expect = 1.8
 Identities = 13/17 (76%), Positives = 17/17 (100%)
 Frame = +2

Query: 506 SVLSLYASGRTTGIVLD 556
           ++LSLYASGRTTGI++D
Sbjct: 55  ALLSLYASGRTTGIMMD 71


>BC014546-1|AAH14546.1|  394|Homo sapiens ARP2 actin-related protein
           2 homolog (yeast) protein.
          Length = 394

 Score =  103 bits (248), Expect = 4e-22
 Identities = 53/123 (43%), Positives = 72/123 (58%), Gaps = 1/123 (0%)
 Frame = +3

Query: 228 GRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPV 404
           G    + L+VGDEA   R  L + YP+E+GIV NWDDM+ +W +TF  E L +      +
Sbjct: 48  GNIEIKDLMVGDEASELRSTLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKI 107

Query: 405 LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHP 584
           LLTE P+NP  NREK+ ++MFET+    +YVAIQA        +       SGD G+ H 
Sbjct: 108 LLTEPPMNPTKNREKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGD-GVTHI 166

Query: 585 CPI 593
           CP+
Sbjct: 167 CPV 169



 Score = 43.2 bits (97), Expect = 7e-04
 Identities = 16/31 (51%), Positives = 23/31 (74%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 210
           +V DNG+G  K G+AG + P  +FP++VGRP
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRP 39


>AY970436-1|AAX82245.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  103 bits (248), Expect = 4e-22
 Identities = 58/91 (63%), Positives = 63/91 (69%), Gaps = 5/91 (5%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA----- 509
           KIWHH FYNEL VA EE  VLLTEAPLNP+ANREKMTQIMF+TFNT AMYVAIQA     
Sbjct: 1   KIWHHVFYNELCVALEEQVVLLTEAPLNPRANREKMTQIMFKTFNTQAMYVAIQAVLTLH 60

Query: 510 CSRCTRPVVPPVSCWTSGDGGLPHPCPILRK 602
            S CT  +V       SGD G+ H  PI  +
Sbjct: 61  SSGCTTGIV-----MDSGD-GVTHTVPIYER 85


>Z74696-1|CAI42428.1|  376|Homo sapiens actin-related protein T1
           (ACTRT1) protein.
          Length = 376

 Score =  103 bits (247), Expect = 5e-22
 Identities = 50/105 (47%), Positives = 62/105 (59%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VG EA  K   L L YPIE G+VT WDDMEK+W H F  EL V P + PVL+TE  LNP+
Sbjct: 57  VGQEALYKYEALHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPR 116

Query: 435 ANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDG 569
             REK+ ++MFETF+ P  Y++  A +              SGDG
Sbjct: 117 EIREKLAEMMFETFSVPGFYLSNHAVAALYASACVTGLVVDSGDG 161



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 19/47 (40%), Positives = 30/47 (63%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK 246
           +V A++ DNGSG+CKAG +G+  PR V  S++G  +    +  + QK
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK 54


>BC014597-1|AAH14597.1|  376|Homo sapiens actin-related protein T1
           protein.
          Length = 376

 Score =  103 bits (247), Expect = 5e-22
 Identities = 50/105 (47%), Positives = 62/105 (59%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VG EA  K   L L YPIE G+VT WDDMEK+W H F  EL V P + PVL+TE  LNP+
Sbjct: 57  VGQEALYKYEALHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPR 116

Query: 435 ANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDG 569
             REK+ ++MFETF+ P  Y++  A +              SGDG
Sbjct: 117 EIREKLAEMMFETFSVPGFYLSNHAVAALYASACVTGLVVDSGDG 161



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 19/47 (40%), Positives = 30/47 (63%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK 246
           +V A++ DNGSG+CKAG +G+  PR V  S++G  +    +  + QK
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK 54


>AY970423-1|AAX82232.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  103 bits (247), Expect = 5e-22
 Identities = 45/54 (83%), Positives = 51/54 (94%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQ 506
           +IWHHTFYNELRVAPEE P+LL EAPLNP+AN +KMTQI+FETFNTPAMY+AIQ
Sbjct: 1   EIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKKMTQIIFETFNTPAMYLAIQ 54



 Score = 33.9 bits (74), Expect = 0.46
 Identities = 15/17 (88%), Positives = 17/17 (100%)
 Frame = +2

Query: 506 SVLSLYASGRTTGIVLD 556
           ++LSLYASGRTTGIVLD
Sbjct: 55  TMLSLYASGRTTGIVLD 71


>AF440739-1|AAM00432.1|  376|Homo sapiens actin-related protein T1
           protein.
          Length = 376

 Score =  103 bits (247), Expect = 5e-22
 Identities = 50/105 (47%), Positives = 62/105 (59%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VG EA  K   L L YPIE G+VT WDDMEK+W H F  EL V P + PVL+TE  LNP+
Sbjct: 57  VGQEALYKYEALHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPR 116

Query: 435 ANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDG 569
             REK+ ++MFETF+ P  Y++  A +              SGDG
Sbjct: 117 EIREKLAEMMFETFSVPGFYLSNHAVAALYASACVTGLVVDSGDG 161



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 19/47 (40%), Positives = 30/47 (63%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK 246
           +V A++ DNGSG+CKAG +G+  PR V  S++G  +    +  + QK
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK 54


>AY970484-1|AAX82290.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  103 bits (246), Expect = 7e-22
 Identities = 45/55 (81%), Positives = 50/55 (90%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           KIWHHTFYNEL VAP+EH +LLTE PLN KAN +KMTQIMFETFNTPA+Y+AIQA
Sbjct: 1   KIWHHTFYNELHVAPKEHRMLLTEVPLNSKANHKKMTQIMFETFNTPAVYMAIQA 55


>BC036253-1|AAH36253.1|  339|Homo sapiens ACTR2 protein protein.
          Length = 339

 Score =  102 bits (245), Expect = 9e-22
 Identities = 53/120 (44%), Positives = 73/120 (60%), Gaps = 1/120 (0%)
 Frame = +3

Query: 252 LVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLN 428
           +VGDEA   R +L + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+N
Sbjct: 1   MVGDEASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMN 60

Query: 429 PKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPILRKGF 608
           P  NREK+ ++MFET+    +YVAIQA        +       SGD G+ H CP+  +GF
Sbjct: 61  PTKNREKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGD-GVTHICPVY-EGF 118


>AL160004-5|CAI19052.1|  342|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 342

 Score =  101 bits (243), Expect = 2e-21
 Identities = 48/54 (88%), Positives = 49/54 (90%), Gaps = 1/54 (1%)
 Frame = +1

Query: 94  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 54



 Score = 57.2 bits (132), Expect = 4e-08
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 2/45 (4%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVT--NWDDMEKIWHHTF 365
           G +   VGDEAQSKRGILTLKYPIEHGI+T  N + M +I   TF
Sbjct: 50  GQKDSYVGDEAQSKRGILTLKYPIEHGIITKANREKMTQIMFETF 94



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 32/54 (59%), Positives = 33/54 (61%)
 Frame = +3

Query: 432 KANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           KANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 80  KANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVTHNVPI 132


>AK055346-1|BAB70906.1|  372|Homo sapiens protein ( Homo sapiens
           cDNA FLJ30784 fis, clone FEBRA2000881, moderately
           similar to ACTIN 6. ).
          Length = 372

 Score =  101 bits (242), Expect = 2e-21
 Identities = 46/103 (44%), Positives = 68/103 (66%)
 Frame = +3

Query: 201 GKAPPSGRDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 380
           G+A    R  + G E L VGD+AQ  R  L + YP+E G++T+W+DME +W H +   L+
Sbjct: 36  GRAKGQSRAAQGGLE-LCVGDQAQDWRSSLFISYPVERGLITSWEDMEIMWKHIYDYNLK 94

Query: 381 VAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           + P + PVL+TE  LNP ANR+++T++ FE    PA Y++IQA
Sbjct: 95  LKPCDGPVLITEPALNPLANRQQITEMFFEHLGVPAFYMSIQA 137



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 18/34 (52%), Positives = 26/34 (76%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 219
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQ 41


>AB049117-1|BAB39481.1|  372|Homo sapiens actin related protein
           protein.
          Length = 372

 Score =  101 bits (242), Expect = 2e-21
 Identities = 46/103 (44%), Positives = 68/103 (66%)
 Frame = +3

Query: 201 GKAPPSGRDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 380
           G+A    R  + G E L VGD+AQ  R  L + YP+E G++T+W+DME +W H +   L+
Sbjct: 36  GRAKGQSRAAQGGLE-LCVGDQAQDWRSSLFISYPVERGLITSWEDMEIMWKHIYDYNLK 94

Query: 381 VAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           + P + PVL+TE  LNP ANR+++T++ FE    PA Y++IQA
Sbjct: 95  LKPCDGPVLITEPALNPLANRQQITEMFFEHLGVPAFYMSIQA 137



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 18/34 (52%), Positives = 26/34 (76%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 219
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQ 41


>AY970435-1|AAX82244.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  100 bits (239), Expect = 5e-21
 Identities = 56/91 (61%), Positives = 62/91 (68%), Gaps = 5/91 (5%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA----- 509
           KIWHH FYNEL VA EE  VLLTE PLNP+ANREKMTQIMF+TFNT AMYVAI+A     
Sbjct: 1   KIWHHVFYNELCVALEEQVVLLTEPPLNPRANREKMTQIMFKTFNTQAMYVAIRAVLTLH 60

Query: 510 CSRCTRPVVPPVSCWTSGDGGLPHPCPILRK 602
            S CT  +V       SGD G+ H  PI  +
Sbjct: 61  SSGCTTGIV-----MDSGD-GVTHTVPIYER 85


>AY970434-1|AAX82243.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =   99 bits (238), Expect = 6e-21
 Identities = 53/86 (61%), Positives = 57/86 (66%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHH FYNEL VA EE  VLLTEAPL P+ANREKMTQIMF+TFNT AMYVAIQA     
Sbjct: 1   KIWHHVFYNELCVALEEQVVLLTEAPLKPRANREKMTQIMFKTFNTQAMYVAIQAVLTLH 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPILRK 602
                      SGD G+ H  PI  +
Sbjct: 61  SSGWTTGIVMDSGD-GVTHTVPIYER 85


>BC029499-1|AAH29499.1|  376|Homo sapiens actin-related protein T2
           protein.
          Length = 376

 Score = 99.5 bits (237), Expect = 8e-21
 Identities = 43/85 (50%), Positives = 57/85 (67%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VG+EA  K+  L L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+
Sbjct: 57  VGEEALYKQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPR 116

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NREKM ++MFE F  PA Y++ QA
Sbjct: 117 ENREKMAEVMFENFGVPAFYLSDQA 141



 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 26/44 (59%)
 Frame = +1

Query: 115 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK 246
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQK 54


>AY970437-1|AAX82246.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 99.5 bits (237), Expect = 8e-21
 Identities = 47/54 (87%), Positives = 48/54 (88%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQ 506
           KIW HTFYNEL VA EEHPVLL EA  NPKANREKMTQIMFETFN+PAMYVAIQ
Sbjct: 1   KIWDHTFYNELCVALEEHPVLLIEACPNPKANREKMTQIMFETFNSPAMYVAIQ 54



 Score = 31.1 bits (67), Expect = 3.2
 Identities = 17/25 (68%), Positives = 19/25 (76%)
 Frame = +2

Query: 482 ARHVRRHPSVLSLYASGRTTGIVLD 556
           A +V   P VLSLYASGRT+GIV D
Sbjct: 48  AMYVAIQP-VLSLYASGRTSGIVRD 71


>AL356984-1|CAH72587.1|  377|Homo sapiens actin-related protein M2
           (ARPM2) protein.
          Length = 377

 Score = 99.5 bits (237), Expect = 8e-21
 Identities = 43/85 (50%), Positives = 57/85 (67%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VG+EA  K+  L L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+
Sbjct: 58  VGEEALYKQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPR 117

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NREKM ++MFE F  PA Y++ QA
Sbjct: 118 ENREKMAEVMFENFGVPAFYLSDQA 142



 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 26/44 (59%)
 Frame = +1

Query: 115 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK 246
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQK 54


>AK058153-1|BAB71690.1|  328|Homo sapiens protein ( Homo sapiens
           cDNA FLJ25424 fis, clone TST04169. ).
          Length = 328

 Score = 99.5 bits (237), Expect = 8e-21
 Identities = 43/85 (50%), Positives = 57/85 (67%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VG+EA  K+  L L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+
Sbjct: 58  VGEEALYKQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPR 117

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NREKM ++MFE F  PA Y++ QA
Sbjct: 118 ENREKMAEVMFENFGVPAFYLSDQA 142



 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 26/44 (59%)
 Frame = +1

Query: 115 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK 246
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQK 54


>AF440740-1|AAM00433.1|  377|Homo sapiens actin-related protein T2
           protein.
          Length = 377

 Score = 99.5 bits (237), Expect = 8e-21
 Identities = 43/85 (50%), Positives = 57/85 (67%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VG+EA  K+  L L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+
Sbjct: 58  VGEEALYKQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPR 117

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NREKM ++MFE F  PA Y++ QA
Sbjct: 118 ENREKMAEVMFENFGVPAFYLSDQA 142



 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 26/44 (59%)
 Frame = +1

Query: 115 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK 246
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQK 54


>AB057364-1|BAB85862.1|  377|Homo sapiens actin-related protein
           hArpM2 protein.
          Length = 377

 Score = 99.5 bits (237), Expect = 8e-21
 Identities = 43/85 (50%), Positives = 57/85 (67%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VG+EA  K+  L L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+
Sbjct: 58  VGEEALYKQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPR 117

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NREKM ++MFE F  PA Y++ QA
Sbjct: 118 ENREKMAEVMFENFGVPAFYLSDQA 142



 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 20/44 (45%), Positives = 26/44 (59%)
 Frame = +1

Query: 115 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK 246
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQK 54


>AY970503-1|AAX82309.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 44/55 (80%), Positives = 49/55 (89%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           KIWHHTFYNEL VA +EHP+LLT+ PL+PKANREKMTQIM E F+ PAMYVAIQA
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTKVPLSPKANREKMTQIMLEIFDRPAMYVAIQA 55



 Score = 33.9 bits (74), Expect = 0.46
 Identities = 14/18 (77%), Positives = 17/18 (94%)
 Frame = +2

Query: 506 SVLSLYASGRTTGIVLDF 559
           +VLSLY SGRTTGIV+D+
Sbjct: 55  AVLSLYTSGRTTGIVMDY 72


>AY970450-1|AAX82258.1|  102|Homo sapiens actin-like protein
           protein.
          Length = 102

 Score = 98.7 bits (235), Expect = 1e-20
 Identities = 44/53 (83%), Positives = 48/53 (90%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAI 503
           KIWHHTFYNEL VAP+EHPVLLT+ PLNPKAN EK+ QIMFETFN PAMY+AI
Sbjct: 1   KIWHHTFYNEL-VAPKEHPVLLTKVPLNPKANHEKIAQIMFETFNIPAMYMAI 52



 Score = 29.5 bits (63), Expect = 9.9
 Identities = 12/16 (75%), Positives = 15/16 (93%)
 Frame = +2

Query: 509 VLSLYASGRTTGIVLD 556
           +LS+YASG TTGIV+D
Sbjct: 55  MLSVYASGHTTGIVMD 70


>AY970394-1|AAX82203.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 98.7 bits (235), Expect = 1e-20
 Identities = 44/55 (80%), Positives = 49/55 (89%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           KIWHHTFYNEL VA +EHP+LLT+APL+PKAN EKMTQIM E F+ PAMYVAIQA
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTKAPLSPKANHEKMTQIMLEIFSRPAMYVAIQA 55



 Score = 31.1 bits (67), Expect = 3.2
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = +2

Query: 506 SVLSLYASGRTTGIVLDF 559
           +VLSLY SGRTT IV+D+
Sbjct: 55  AVLSLYTSGRTTDIVMDY 72


>BC014610-1|AAH14610.1|  435|Homo sapiens actin-like 7A protein.
          Length = 435

 Score = 97.5 bits (232), Expect = 3e-20
 Identities = 39/85 (45%), Positives = 59/85 (69%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VG E  +    L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P 
Sbjct: 118 VGQELNNTNVHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPH 177

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NREK  +++FE FNTPAM++A Q+
Sbjct: 178 TNREKYAEMLFEAFNTPAMHIAYQS 202



 Score = 39.1 bits (87), Expect = 0.012
 Identities = 19/50 (38%), Positives = 27/50 (54%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K++
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKET 116


>AL359692-4|CAI40571.1|  435|Homo sapiens actin-like 7A protein.
          Length = 435

 Score = 97.5 bits (232), Expect = 3e-20
 Identities = 39/85 (45%), Positives = 59/85 (69%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VG E  +    L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P 
Sbjct: 118 VGQELNNTNVHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPH 177

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NREK  +++FE FNTPAM++A Q+
Sbjct: 178 TNREKYAEMLFEAFNTPAMHIAYQS 202



 Score = 39.1 bits (87), Expect = 0.012
 Identities = 19/50 (38%), Positives = 27/50 (54%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K++
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKET 116


>AF113526-1|AAD44109.1|  435|Homo sapiens actin-like-7-alpha
           protein.
          Length = 435

 Score = 97.5 bits (232), Expect = 3e-20
 Identities = 39/85 (45%), Positives = 59/85 (69%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VG E  +    L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P 
Sbjct: 118 VGQELNNTNVHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPH 177

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NREK  +++FE FNTPAM++A Q+
Sbjct: 178 TNREKYAEMLFEAFNTPAMHIAYQS 202



 Score = 39.1 bits (87), Expect = 0.012
 Identities = 19/50 (38%), Positives = 27/50 (54%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K++
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKET 116


>AB284520-1|BAF41971.1|  435|Homo sapiens human t-actin 2 protein.
          Length = 435

 Score = 97.5 bits (232), Expect = 3e-20
 Identities = 39/85 (45%), Positives = 59/85 (69%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VG E  +    L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P 
Sbjct: 118 VGQELNNTNVHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPH 177

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NREK  +++FE FNTPAM++A Q+
Sbjct: 178 TNREKYAEMLFEAFNTPAMHIAYQS 202



 Score = 39.1 bits (87), Expect = 0.012
 Identities = 19/50 (38%), Positives = 27/50 (54%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K++
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKET 116


>BC033789-1|AAH33789.1|  415|Homo sapiens actin-like 7B protein.
          Length = 415

 Score = 96.3 bits (229), Expect = 8e-20
 Identities = 43/103 (41%), Positives = 63/103 (61%)
 Frame = +3

Query: 201 GKAPPSGRDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 380
           GK  P   D     +  LVG E  +    L L  P++HGIV +WD ++ IW + F   ++
Sbjct: 80  GKRCPEAADAGDTRKWTLVGHELLNTEAPLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMK 139

Query: 381 VAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           + PEEH VL+++ PL+P +NREK  ++MFETF  PAM+V  Q+
Sbjct: 140 ILPEEHAVLVSDPPLSPSSNREKYAELMFETFGIPAMHVTSQS 182



 Score = 33.9 bits (74), Expect = 0.46
 Identities = 13/34 (38%), Positives = 21/34 (61%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 207
           ++ A+++D GS  CK G+AG+  P     S VG+
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGK 81


>BC007289-1|AAH07289.1|  372|Homo sapiens actin related protein M1
           protein.
          Length = 372

 Score = 96.3 bits (229), Expect = 8e-20
 Identities = 45/103 (43%), Positives = 67/103 (65%)
 Frame = +3

Query: 201 GKAPPSGRDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 380
           G+A    R  + G E L VGD+AQ  R  L + YP+E G++T+ +DME +W H +   L+
Sbjct: 36  GRAKGQSRAAQGGLE-LCVGDQAQDWRSSLFISYPVERGLITSCEDMEIMWKHIYDYNLK 94

Query: 381 VAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           + P + PVL+TE  LNP ANR+++T++ FE    PA Y++IQA
Sbjct: 95  LKPCDGPVLITEPALNPLANRQQITEMFFEHLGVPAFYMSIQA 137



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 18/34 (52%), Positives = 26/34 (76%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 219
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQ 41


>AL359692-3|CAI40570.1|  415|Homo sapiens actin-like 7B protein.
          Length = 415

 Score = 96.3 bits (229), Expect = 8e-20
 Identities = 43/103 (41%), Positives = 63/103 (61%)
 Frame = +3

Query: 201 GKAPPSGRDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 380
           GK  P   D     +  LVG E  +    L L  P++HGIV +WD ++ IW + F   ++
Sbjct: 80  GKRCPEAADAGDTRKWTLVGHELLNTEAPLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMK 139

Query: 381 VAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           + PEEH VL+++ PL+P +NREK  ++MFETF  PAM+V  Q+
Sbjct: 140 ILPEEHAVLVSDPPLSPSSNREKYAELMFETFGIPAMHVTSQS 182



 Score = 33.9 bits (74), Expect = 0.46
 Identities = 13/34 (38%), Positives = 21/34 (61%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 207
           ++ A+++D GS  CK G+AG+  P     S VG+
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGK 81


>AF113527-1|AAD44110.1|  415|Homo sapiens actin-like-7-beta protein.
          Length = 415

 Score = 96.3 bits (229), Expect = 8e-20
 Identities = 43/103 (41%), Positives = 63/103 (61%)
 Frame = +3

Query: 201 GKAPPSGRDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 380
           GK  P   D     +  LVG E  +    L L  P++HGIV +WD ++ IW + F   ++
Sbjct: 80  GKRCPEAADAGDTRKWTLVGHELLNTEAPLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMK 139

Query: 381 VAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           + PEEH VL+++ PL+P +NREK  ++MFETF  PAM+V  Q+
Sbjct: 140 ILPEEHAVLVSDPPLSPSSNREKYAELMFETFGIPAMHVTSQS 182



 Score = 33.9 bits (74), Expect = 0.46
 Identities = 13/34 (38%), Positives = 21/34 (61%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 207
           ++ A+++D GS  CK G+AG+  P     S VG+
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGK 81


>AB284521-1|BAF41972.1|  415|Homo sapiens t-actin 1 protein.
          Length = 415

 Score = 96.3 bits (229), Expect = 8e-20
 Identities = 43/103 (41%), Positives = 63/103 (61%)
 Frame = +3

Query: 201 GKAPPSGRDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 380
           GK  P   D     +  LVG E  +    L L  P++HGIV +WD ++ IW + F   ++
Sbjct: 80  GKRCPEAADAGDTRKWTLVGHELLNTEAPLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMK 139

Query: 381 VAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           + PEEH VL+++ PL+P +NREK  ++MFETF  PAM+V  Q+
Sbjct: 140 ILPEEHAVLVSDPPLSPSSNREKYAELMFETFGIPAMHVTSQS 182



 Score = 33.9 bits (74), Expect = 0.46
 Identities = 13/34 (38%), Positives = 21/34 (61%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 207
           ++ A+++D GS  CK G+AG+  P     S VG+
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGK 81


>AY970397-1|AAX82206.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 50/83 (60%), Positives = 56/83 (67%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIWHHTFYN+L VAPEE+ VL+T+APL  KANRE MTQIMFE FNT AMY+AIQA     
Sbjct: 1   KIWHHTFYNKLHVAPEEYLVLMTKAPLMTKANREMMTQIMFEVFNTLAMYMAIQAVLSLY 60

Query: 525 RPVVPPVSCWTSGDGGLPHPCPI 593
                      SGD G+ H  PI
Sbjct: 61  TSGRTTGIAMDSGD-GVAHTVPI 82


>AY970482-1|AAX82288.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 42/55 (76%), Positives = 48/55 (87%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           KIWHHTFYNEL VA +EHP+LLT+ PL+PKAN +KMTQIM E F+ PAMYVAIQA
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTKVPLSPKANHKKMTQIMLEIFDRPAMYVAIQA 55



 Score = 31.1 bits (67), Expect = 3.2
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = +2

Query: 506 SVLSLYASGRTTGIVLDF 559
           +VLSLY SGRTT IV+D+
Sbjct: 55  AVLSLYTSGRTTDIVMDY 72


>AY970393-1|AAX82202.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 94.7 bits (225), Expect = 2e-19
 Identities = 44/56 (78%), Positives = 50/56 (89%), Gaps = 1/56 (1%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF-NTPAMYVAIQA 509
           KIWHHTFYN+L + PEEHP+LLT+APLNPKAN  KMTQI FETF NTPA+Y+AIQA
Sbjct: 1   KIWHHTFYNKLCMTPEEHPMLLTQAPLNPKAN-HKMTQITFETFSNTPAIYMAIQA 55



 Score = 31.1 bits (67), Expect = 3.2
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = +2

Query: 509 VLSLYASGRTTGIVLD 556
           VLSLYASG TTGIV+D
Sbjct: 57  VLSLYASGLTTGIVMD 72


>BC044590-1|AAH44590.1|  418|Homo sapiens ARP3 actin-related protein
           3 homolog (yeast) protein.
          Length = 418

 Score = 92.3 bits (219), Expect = 1e-18
 Identities = 43/85 (50%), Positives = 54/85 (63%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           +GDEA  K    T K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN  
Sbjct: 62  IGDEAIEKPTYAT-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTP 120

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NRE   +IMFE+FN P +Y+A+QA
Sbjct: 121 ENREYTAEIMFESFNVPGLYIAVQA 145



 Score = 31.9 bits (69), Expect = 1.8
 Identities = 13/29 (44%), Positives = 19/29 (65%)
 Frame = +1

Query: 115 ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 201
           A VVD G+G  K G+AG+  P+ + PS +
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCI 35


>AF127773-1|AAD51904.1|  418|Homo sapiens unknown protein.
          Length = 418

 Score = 92.3 bits (219), Expect = 1e-18
 Identities = 43/85 (50%), Positives = 54/85 (63%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           +GDEA  K    T K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN  
Sbjct: 62  IGDEAIEKPTYAT-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTP 120

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NRE   +IMFE+FN P +Y+A+QA
Sbjct: 121 ENREYTAEIMFESFNVPGLYIAVQA 145



 Score = 31.9 bits (69), Expect = 1.8
 Identities = 13/29 (44%), Positives = 19/29 (65%)
 Frame = +1

Query: 115 ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 201
           A VVD G+G  K G+AG+  P+ + PS +
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCI 35


>AF006083-1|AAB64188.1|  418|Homo sapiens Arp3 protein.
          Length = 418

 Score = 92.3 bits (219), Expect = 1e-18
 Identities = 43/85 (50%), Positives = 54/85 (63%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           +GDEA  K    T K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN  
Sbjct: 62  IGDEAIEKPTYAT-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTP 120

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NRE   +IMFE+FN P +Y+A+QA
Sbjct: 121 ENREYTAEIMFESFNVPGLYIAVQA 145



 Score = 31.9 bits (69), Expect = 1.8
 Identities = 13/29 (44%), Positives = 19/29 (65%)
 Frame = +1

Query: 115 ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 201
           A VVD G+G  K G+AG+  P+ + PS +
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCI 35


>AC110769-1|AAX93226.1|  418|Homo sapiens unknown protein.
          Length = 418

 Score = 92.3 bits (219), Expect = 1e-18
 Identities = 43/85 (50%), Positives = 54/85 (63%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           +GDEA  K    T K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN  
Sbjct: 62  IGDEAIEKPTYAT-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTP 120

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NRE   +IMFE+FN P +Y+A+QA
Sbjct: 121 ENREYTAEIMFESFNVPGLYIAVQA 145



 Score = 31.9 bits (69), Expect = 1.8
 Identities = 13/29 (44%), Positives = 19/29 (65%)
 Frame = +1

Query: 115 ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 201
           A VVD G+G  K G+AG+  P+ + PS +
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCI 35


>AB209353-1|BAD92590.1|  369|Homo sapiens ARP3 actin-related protein
           3 homolog variant protein.
          Length = 369

 Score = 92.3 bits (219), Expect = 1e-18
 Identities = 43/85 (50%), Positives = 54/85 (63%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           +GDEA  K    T K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN  
Sbjct: 13  IGDEAIEKPTYAT-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTP 71

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NRE   +IMFE+FN P +Y+A+QA
Sbjct: 72  ENREYTAEIMFESFNVPGLYIAVQA 96


>BC015207-1|AAH15207.1|  348|Homo sapiens ARP3 actin-related protein
           3 homolog B (yeast) protein.
          Length = 348

 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 41/85 (48%), Positives = 55/85 (64%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           +GDEA  K    T K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE PLN  
Sbjct: 62  IGDEAIDKPTYAT-KWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTP 120

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NRE + +IMFE+FN P +Y+A+QA
Sbjct: 121 ENREYLAEIMFESFNVPGLYIAVQA 145



 Score = 30.7 bits (66), Expect = 4.3
 Identities = 12/27 (44%), Positives = 18/27 (66%)
 Frame = +1

Query: 121 VVDNGSGMCKAGFAGDDAPRAVFPSIV 201
           VVD G+G  K G+AG+  P+ + PS +
Sbjct: 9   VVDCGTGYTKLGYAGNTEPQFIIPSCI 35


>BC008682-1|AAH08682.1|  418|Homo sapiens ARP3 actin-related protein
           3 homolog B (yeast) protein.
          Length = 418

 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 41/85 (48%), Positives = 55/85 (64%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           +GDEA  K    T K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE PLN  
Sbjct: 62  IGDEAIDKPTYAT-KWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTP 120

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NRE + +IMFE+FN P +Y+A+QA
Sbjct: 121 ENREYLAEIMFESFNVPGLYIAVQA 145



 Score = 30.7 bits (66), Expect = 4.3
 Identities = 12/27 (44%), Positives = 18/27 (66%)
 Frame = +1

Query: 121 VVDNGSGMCKAGFAGDDAPRAVFPSIV 201
           VVD G+G  K G+AG+  P+ + PS +
Sbjct: 9   VVDCGTGYTKLGYAGNTEPQFIIPSCI 35


>AF086920-1|AAP97150.1|  402|Homo sapiens actin related protein ARP4
           protein.
          Length = 402

 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 41/85 (48%), Positives = 55/85 (64%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           +GDEA  K    T K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE PLN  
Sbjct: 43  IGDEAIDKPTYAT-KWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTP 101

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NRE + +IMFE+FN P +Y+A+QA
Sbjct: 102 ENREYLAEIMFESFNVPGLYIAVQA 126


>AF023453-1|AAC98904.1|  418|Homo sapiens actin-related protein
           3-beta protein.
          Length = 418

 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 41/85 (48%), Positives = 55/85 (64%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           +GDEA  K    T K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE PLN  
Sbjct: 62  IGDEAIDKPTYAT-KWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTP 120

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NRE + +IMFE+FN P +Y+A+QA
Sbjct: 121 ENREYLAEIMFESFNVPGLYIAVQA 145



 Score = 30.7 bits (66), Expect = 4.3
 Identities = 12/27 (44%), Positives = 18/27 (66%)
 Frame = +1

Query: 121 VVDNGSGMCKAGFAGDDAPRAVFPSIV 201
           VVD G+G  K G+AG+  P+ + PS +
Sbjct: 9   VVDCGTGYTKLGYAGNTEPQFIIPSCI 35


>BC045752-1|AAH45752.1|  416|Homo sapiens hypothetical protein
           MGC33407 protein.
          Length = 416

 Score = 85.4 bits (202), Expect = 1e-16
 Identities = 35/74 (47%), Positives = 50/74 (67%)
 Frame = +3

Query: 288 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 467
           LTL  P+  GIV +WD  E IW H   ++LRVA  +HP+L ++ P +P  NREK+ ++ F
Sbjct: 108 LTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLFSDPPFSPATNREKLVEVAF 167

Query: 468 ETFNTPAMYVAIQA 509
           E+  +PAMYVA Q+
Sbjct: 168 ESLRSPAMYVASQS 181



 Score = 35.5 bits (78), Expect = 0.15
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           +  A+V+D G+G CK GFAG  +P     +I+G
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILG 80


>BC024028-1|AAH24028.1|  416|Homo sapiens hypothetical protein
           MGC33407 protein.
          Length = 416

 Score = 85.4 bits (202), Expect = 1e-16
 Identities = 35/74 (47%), Positives = 50/74 (67%)
 Frame = +3

Query: 288 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 467
           LTL  P+  GIV +WD  E IW H   ++LRVA  +HP+L ++ P +P  NREK+ ++ F
Sbjct: 108 LTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLFSDPPFSPATNREKLVEVAF 167

Query: 468 ETFNTPAMYVAIQA 509
           E+  +PAMYVA Q+
Sbjct: 168 ESLRSPAMYVASQS 181



 Score = 35.5 bits (78), Expect = 0.15
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           +  A+V+D G+G CK GFAG  +P     +I+G
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILG 80


>AY970399-1|AAX82208.1|   97|Homo sapiens actin-like protein
           protein.
          Length = 97

 Score = 85.0 bits (201), Expect = 2e-16
 Identities = 48/85 (56%), Positives = 56/85 (65%)
 Frame = +3

Query: 345 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
           KIW    YNEL VAPEEHPV LTEAP+N KAN +KMTQIMFETFNTPA+YVA  +     
Sbjct: 1   KIW---LYNELGVAPEEHPVQLTEAPMNHKANCKKMTQIMFETFNTPAIYVAFVSLYASG 57

Query: 525 RPVVPPVSCWTSGDGGLPHPCPILR 599
           R     +    SGD G+ H  P+ +
Sbjct: 58  RTTSIMMD---SGD-GVTHTVPMYK 78


>BC020944-1|AAH20944.1|  426|Homo sapiens actin-like 6B protein.
          Length = 426

 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 26/65 (40%), Positives = 45/65 (69%)
 Frame = +3

Query: 303 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 482
           P+++G++ +W+    I  HT+   ++  P  HPVL++EAP N +A REK+T++MFE +N 
Sbjct: 84  PLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNI 143

Query: 483 PAMYV 497
           PA ++
Sbjct: 144 PAFFL 148



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           +EV ALV D GS   +AG+AG+D P+A FP+ VG
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVG 42


>AF053356-5|AAC78795.1|  475|Homo sapiens actin like gene protein.
          Length = 475

 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 26/65 (40%), Positives = 45/65 (69%)
 Frame = +3

Query: 303 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 482
           P+++G++ +W+    I  HT+   ++  P  HPVL++EAP N +A REK+T++MFE +N 
Sbjct: 84  PLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNI 143

Query: 483 PAMYV 497
           PA ++
Sbjct: 144 PAFFL 148



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           +EV ALV D GS   +AG+AG+D P+A FP+ VG
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVG 42


>AF041475-1|AAD54678.1|  426|Homo sapiens BAF53b protein.
          Length = 426

 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 26/65 (40%), Positives = 45/65 (69%)
 Frame = +3

Query: 303 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 482
           P+++G++ +W+    I  HT+   ++  P  HPVL++EAP N +A REK+T++MFE +N 
Sbjct: 84  PLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNI 143

Query: 483 PAMYV 497
           PA ++
Sbjct: 144 PAFFL 148



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           +EV ALV D GS   +AG+AG+D P+A FP+ VG
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVG 42


>AC099394-1|AAP21874.1|  426|Homo sapiens unknown protein.
          Length = 426

 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 26/65 (40%), Positives = 45/65 (69%)
 Frame = +3

Query: 303 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 482
           P+++G++ +W+    I  HT+   ++  P  HPVL++EAP N +A REK+T++MFE +N 
Sbjct: 84  PLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNI 143

Query: 483 PAMYV 497
           PA ++
Sbjct: 144 PAFFL 148



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           +EV ALV D GS   +AG+AG+D P+A FP+ VG
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVG 42


>AB015906-1|BAA74576.1|  426|Homo sapiens actin-related protein
           hArpN alpha protein.
          Length = 426

 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 26/65 (40%), Positives = 45/65 (69%)
 Frame = +3

Query: 303 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 482
           P+++G++ +W+    I  HT+   ++  P  HPVL++EAP N +A REK+T++MFE +N 
Sbjct: 84  PLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNI 143

Query: 483 PAMYV 497
           PA ++
Sbjct: 144 PAFFL 148



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           +EV ALV D GS   +AG+AG+D P+A FP+ VG
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVG 42


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 107,510,926
Number of Sequences: 237096
Number of extensions: 2654835
Number of successful extensions: 9473
Number of sequences better than 10.0: 308
Number of HSP's better than 10.0 without gapping: 7994
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9246
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6579110070
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).