SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0036
         (602 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U83867-1|AAB41498.1| 2477|Homo sapiens alpha II spectrin protein.     116   6e-26
BC053521-1|AAH53521.1| 2452|Homo sapiens SPTAN1 protein protein.      116   6e-26
AL356481-4|CAH71405.1| 2472|Homo sapiens spectrin, alpha, non-er...   116   6e-26
AL356481-3|CAH71404.1| 2477|Homo sapiens spectrin, alpha, non-er...   116   6e-26
AB209860-1|BAD93097.1| 2506|Homo sapiens spectrin, alpha, non-er...   116   6e-26
AB191262-1|BAD52438.1| 2452|Homo sapiens non-erythrocytic spectr...   116   6e-26
J05243-1|AAA51790.1| 2472|Homo sapiens SPTAN1 protein.                116   8e-26
M24773-1|AAA52468.1|  920|Homo sapiens alpha-fodrin protein.          105   2e-22
M18627-1|AAA51702.1|  920|Homo sapiens SPTAN1 protein.                105   2e-22
M61877-1|AAA60577.1| 2429|Homo sapiens erythroid alpha spectrin ...    73   6e-13
M61826-1|AAA60994.1| 2429|Homo sapiens alpha-spectrin protein.         73   6e-13
AL353894-3|CAH73936.1| 2416|Homo sapiens spectrin, alpha, erythr...    73   6e-13
AL353894-2|CAH73937.1| 2419|Homo sapiens spectrin, alpha, erythr...    73   6e-13
M11049-1|AAA60569.1|  237|Homo sapiens SPTA1 protein.                  66   9e-11
AB008567-1|BAA32700.1| 2390|Homo sapiens beta-spectrin III protein.    59   1e-08
AF233523-1|AAF65317.1| 3674|Homo sapiens beta V spectrin protein.      57   4e-08
S65762-1|AAB28324.1| 1252|Homo sapiens beta-fodrin protein.            56   7e-08
M19725-1|AAA59904.1|  475|Homo sapiens SPTAN1 protein.                 56   7e-08
AC093110-1|AAY24229.1| 2314|Homo sapiens unknown protein.              56   7e-08
AB209748-1|BAD92985.1| 2377|Homo sapiens spectrin, beta, non-ery...    56   7e-08
U26396-1|AAB60364.1|  719|Homo sapiens alpha II spectrin protein.      55   2e-07
M96803-1|AAA60580.1| 2364|Homo sapiens beta-spectrin protein.          54   3e-07
AF327441-1|AAO15362.1| 2155|Homo sapiens beta-spectrin 2 isoform...    54   3e-07
AY004227-1|AAF93173.1| 2149|Homo sapiens betaIV spectrin isoform...    52   2e-06
AY004226-1|AAF93171.1| 1304|Homo sapiens betaIV spectrin isoform...    52   2e-06
AF324064-1|AAQ14859.1| 2002|Homo sapiens beta spectrin IV protein.     52   2e-06
AF324063-1|AAQ14860.1| 2564|Homo sapiens non-erythrocytic beta-s...    52   2e-06
AF311855-1|AAG42473.1| 2564|Homo sapiens spectrin beta IV protein.     52   2e-06
AF082075-1|AAG38874.1| 2559|Homo sapiens beta4sigma1 spectrin pr...    52   2e-06
AB046862-1|BAB13468.1| 1997|Homo sapiens KIAA1642 protein protein.     52   2e-06
AY004226-2|AAF93172.1| 1307|Homo sapiens betaIV spectrin isoform...    52   2e-06
AL133093-1|CAB61407.1|  441|Homo sapiens hypothetical protein pr...    52   2e-06
AF311856-1|AAG42474.1|  678|Homo sapiens spectrin beta IV protein.     52   2e-06
AF148808-1|AAF26672.1|  277|Homo sapiens nonerythroid alpha-spec...    50   6e-06
J05500-2|AAA60578.1| 2106|Homo sapiens SPTB protein.                   49   1e-05
J05500-1|AAA60579.1| 2137|Homo sapiens SPTB protein.                   49   1e-05
AB209415-1|BAD92652.1| 2332|Homo sapiens spectrin, beta, erythro...    49   1e-05
BC139788-1|AAI39789.1|  934|Homo sapiens SPTBN2 protein protein.       48   2e-05
X59511-1|CAA42098.1|  229|Homo sapiens beta-spectrin protein.          46   1e-04
M37884-1|AAA63259.1| 1274|Homo sapiens muscle beta spectrin prot...    46   1e-04
AF465439-1|AAL73492.1| 1028|Homo sapiens beta I spectrin form be...    46   1e-04
AF013187-1|AAC02793.1|  111|Homo sapiens beta-spectrin protein.        46   1e-04
AF013177-1|AAC02789.1|  193|Homo sapiens beta-spectrin protein.        46   1e-04
M29994-1|AAA60575.1|  521|Homo sapiens SPTA1 protein.                  46   1e-04
EF151925-1|ABL96684.1|   65|Homo sapiens beta-spectrin protein.        43   7e-04
AF013178-1|AAC02790.1|  289|Homo sapiens beta-spectrin protein.        43   7e-04
AF013181-1|AAC02791.1|  399|Homo sapiens beta-spectrin protein.        43   0.001
M18054-1|AAA60572.1|  274|Homo sapiens SPTB protein.                   42   0.002
X59510-1|CAA42097.1|   99|Homo sapiens beta-spectrin protein.          38   0.021
M86406-1|AAA51583.1|  894|Homo sapiens alpha-actinin protein.          38   0.027
BC051770-1|AAH51770.2|  894|Homo sapiens actinin, alpha 2 protein.     38   0.027
BC047901-1|AAH47901.2|  894|Homo sapiens actinin, alpha 2 protein.     38   0.027
AL359921-13|CAI13778.1|  894|Homo sapiens actinin, alpha 2 protein.    38   0.027
AL359185-4|CAH73201.1|  894|Homo sapiens actinin, alpha 2 protein.     38   0.027
AJ249756-1|CAB61269.1|  894|Homo sapiens alpha-actinin 2 protein...    38   0.027
AB209521-1|BAD92758.1|  664|Homo sapiens actinin, alpha 2 varian...    38   0.027
Z54367-1|CAA91196.1| 4684|Homo sapiens plectin protein.                36   0.083
U63610-1|AAB05428.1| 4574|Homo sapiens plectin protein.                36   0.083
U53204-1|AAB05427.1| 4574|Homo sapiens plectin protein.                36   0.083
AY480051-1|AAR95684.1| 4547|Homo sapiens plectin 11 protein.           36   0.083
AY480050-1|AAR95683.1| 4551|Homo sapiens plectin 10 protein.           36   0.083
AY480049-1|AAR95682.1| 4547|Homo sapiens plectin 8 protein.            36   0.083
AY480048-1|AAR95681.1| 4515|Homo sapiens plectin 7 protein.            36   0.083
AY480047-1|AAR95680.1| 4684|Homo sapiens plectin 6 protein.            36   0.083
AY480046-1|AAR95679.1| 4525|Homo sapiens plectin 3 protein.            36   0.083
AY480045-1|AAR95678.1| 4533|Homo sapiens plectin 2 protein.            36   0.083
AY480044-1|AAR95677.1| 4574|Homo sapiens plectin 1 protein.            36   0.083
X55187-1|CAA38970.1|  596|Homo sapiens alpha-actinin protein.          36   0.14 
X15804-1|CAA33803.1|  892|Homo sapiens protein ( Human mRNA for ...    36   0.14 
M95178-1|AAA51582.1|  892|Homo sapiens alpha-actinin protein.          36   0.14 
DQ496098-1|ABF50047.1|  914|Homo sapiens actinin alpha 1 isoform...    36   0.14 
BT007207-1|AAP35871.1|  892|Homo sapiens actinin, alpha 1 protein.     36   0.14 
BC015766-1|AAH15766.1|  892|Homo sapiens actinin, alpha 1 protein.     36   0.14 
BC003576-1|AAH03576.1|  892|Homo sapiens actinin, alpha 1 protein.     36   0.14 
AL442071-4|CAH73671.1| 5938|Homo sapiens microtubule-actin cross...    35   0.25 
AL442071-2|CAH73669.1| 4433|Homo sapiens microtubule-actin cross...    35   0.25 
AL442071-1|CAH73668.1| 5430|Homo sapiens microtubule-actin cross...    35   0.25 
AL365277-12|CAI16422.1| 5938|Homo sapiens microtubule-actin cros...    35   0.25 
AL365277-10|CAI16420.1| 4433|Homo sapiens microtubule-actin cros...    35   0.25 
AL365277-7|CAI16417.1| 5430|Homo sapiens microtubule-actin cross...    35   0.25 
AL355477-1|CAH70156.1| 5430|Homo sapiens microtubule-actin cross...    35   0.25 
AL137853-3|CAI21816.1| 5938|Homo sapiens microtubule-actin cross...    35   0.25 
AL137853-2|CAI21815.1| 4433|Homo sapiens microtubule-actin cross...    35   0.25 
AL137853-1|CAI21814.1| 5430|Homo sapiens microtubule-actin cross...    35   0.25 
AF325341-2|AAL38997.1| 5314|Homo sapiens macrophin 1 isoform 4 p...    35   0.25 
AF325341-1|AAL39000.1| 4631|Homo sapiens macrophin 1 isoform 2 p...    35   0.25 
AF317696-1|AAL09459.1| 5938|Homo sapiens macrophin 1 isoform 4 p...    35   0.25 
AF141968-1|AAF06360.1| 5373|Homo sapiens trabeculin-alpha protein.     35   0.25 
AB029290-1|BAA83821.1| 5430|Homo sapiens actin binding protein A...    35   0.25 
AB007934-1|BAA32310.3| 4433|Homo sapiens KIAA0465 protein protein.     35   0.25 
AF013184-1|AAC02792.1|  237|Homo sapiens beta-spectrin protein.        33   0.58 
U48734-1|AAC17470.1|  912|Homo sapiens alpha actinin protein.          33   0.77 
L11690-1|AAA52288.1| 2649|Homo sapiens bullous pemphigoid antige...    33   0.77 
D89980-1|BAA24447.1|  884|Homo sapiens alpha actinin 4 protein.        33   0.77 
BC065536-1|AAH65536.1| 1143|Homo sapiens DST protein protein.          33   0.77 
BC015620-1|AAH15620.2|  634|Homo sapiens ACTN4 protein protein.        33   0.77 
BC005033-1|AAH05033.1|  911|Homo sapiens actinin, alpha 4 protein.     33   0.77 
AL590005-3|CAI14988.1| 5457|Homo sapiens dystonin protein.             33   0.77 
AL590005-2|CAI14989.1| 7543|Homo sapiens dystonin protein.             33   0.77 
AL512448-3|CAI16610.1| 5144|Homo sapiens dystonin protein.             33   0.77 
AL512448-2|CAI16608.1| 5457|Homo sapiens dystonin protein.             33   0.77 
AL512448-1|CAI16609.1| 7543|Homo sapiens dystonin protein.             33   0.77 
AL512422-3|CAI14342.1| 5457|Homo sapiens dystonin protein.             33   0.77 
AL512422-2|CAI14341.1| 7543|Homo sapiens dystonin protein.             33   0.77 
AL137008-4|CAI20332.1| 5144|Homo sapiens dystonin protein.             33   0.77 
AL137008-3|CAI20331.1| 5457|Homo sapiens dystonin protein.             33   0.77 
AL137008-2|CAI20330.1| 7543|Homo sapiens dystonin protein.             33   0.77 
AL096710-6|CAI22047.1| 2649|Homo sapiens dystonin protein.             33   0.77 
AL096710-5|CAI22046.1| 3060|Homo sapiens dystonin protein.             33   0.77 
AL096710-4|CAI22045.1| 5144|Homo sapiens dystonin protein.             33   0.77 
AL096710-3|CAI22043.1| 5457|Homo sapiens dystonin protein.             33   0.77 
AL096710-2|CAI22044.1| 7543|Homo sapiens dystonin protein.             33   0.77 
AF400227-1|AAL62062.1| 3060|Homo sapiens bullous pemphigoid anti...    33   0.77 
AF400226-1|AAL62061.1| 5171|Homo sapiens bullous pemphigoid anti...    33   0.77 
AK055189-1|BAB70870.1| 1174|Homo sapiens protein ( Homo sapiens ...    33   1.0  
M86407-1|AAA51585.1|  901|Homo sapiens alpha-actinin protein.          32   1.8  
BC099649-1|AAH99649.1|  901|Homo sapiens actinin, alpha 3 protein.     32   1.8  
BC099647-1|AAH99647.1|  901|Homo sapiens actinin, alpha 3 protein.     32   1.8  
BC096323-1|AAH96323.1|  620|Homo sapiens ACTN3 protein protein.        32   1.8  
AF026487-1|AAC79502.1|  491|Homo sapiens beta III spectrin protein.    32   1.8  
AK094883-1|BAC04449.1|  775|Homo sapiens protein ( Homo sapiens ...    31   2.4  
U72849-1|AAD00186.1| 2033|Homo sapiens envoplakin protein.             30   5.4  
U53786-1|AAC64662.1| 2033|Homo sapiens envoplakin protein.             30   5.4  
BC126105-1|AAI26106.1| 2033|Homo sapiens envoplakin protein.           30   5.4  
BC126103-1|AAI26104.1| 2033|Homo sapiens envoplakin protein.           30   5.4  
BC114620-1|AAI14621.1| 1756|Homo sapiens periplakin protein.           30   5.4  
BC042165-1|AAH42165.1|  488|Homo sapiens Similar to tubulin, gam...    30   5.4  
BC023573-1|AAH23573.1| 1009|Homo sapiens TUBGCP6 protein protein.      30   5.4  
AL022328-10|CAI42756.1| 1819|Homo sapiens tubulin, gamma complex...    30   5.4  
AF495910-1|AAN60442.1| 8797|Homo sapiens nesprin-1 protein.            30   5.4  
AF272887-1|AAK82968.1| 1819|Homo sapiens gamma-tubulin complex c...    30   5.4  
AF041004-1|AAD17459.1| 1756|Homo sapiens periplakin protein.           30   5.4  
AF013717-1|AAC39668.1| 1756|Homo sapiens periplakin protein.           30   5.4  
AF001691-1|AAC17738.1| 1756|Homo sapiens 195 kDa cornified envel...    30   5.4  
X69086-1|CAA48829.1| 3433|Homo sapiens utrophin (dystrophin rela...    30   7.2  
AL590704-1|CAI10894.1| 3433|Homo sapiens utrophin protein.             30   7.2  
AL590488-1|CAI16497.1| 3433|Homo sapiens utrophin protein.             30   7.2  
AL513475-1|CAI13032.1| 3433|Homo sapiens utrophin protein.             30   7.2  
AL513184-1|CAI40502.1| 3433|Homo sapiens utrophin protein.             30   7.2  
AL357149-1|CAI40388.1| 3433|Homo sapiens utrophin protein.             30   7.2  
AL024474-2|CAI23353.1| 3433|Homo sapiens utrophin protein.             30   7.2  
D87343-1|BAA23225.1|  297|Homo sapiens DCRA protein.                   29   9.5  
BC110655-1|AAI10656.1|  297|Homo sapiens Down syndrome critical ...    29   9.5  
BC050325-1|AAH50325.1|  356|Homo sapiens CCDC67 protein protein.       29   9.5  
BC017929-1|AAH17929.1|  399|Homo sapiens CCDC67 protein protein.       29   9.5  
AK127973-1|BAC87213.1|  567|Homo sapiens protein ( Homo sapiens ...    29   9.5  
AK127130-1|BAC86842.1|  266|Homo sapiens protein ( Homo sapiens ...    29   9.5  
AK058122-1|BAB71673.1|  520|Homo sapiens protein ( Homo sapiens ...    29   9.5  

>U83867-1|AAB41498.1| 2477|Homo sapiens alpha II spectrin protein.
          Length = 2477

 Score =  116 bits (279), Expect = 6e-26
 Identities = 55/70 (78%), Positives = 62/70 (88%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           ELKG KL+EA QQQQ+NR VEDIELWL EVEG L S+DYGKDLT+VQNLQKKHALLEADV
Sbjct: 668 ELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADV 727

Query: 75  SSHAERIDAI 46
           ++H +RID I
Sbjct: 728 AAHQDRIDGI 737



 Score = 88.6 bits (210), Expect = 1e-17
 Identities = 39/65 (60%), Positives = 49/65 (75%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K  KL+EA +QQ +N  ++D + WLSEVE  L SEDYGKDL SV NL KKH LLEAD+S+
Sbjct: 1655 KSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISA 1714

Query: 69   HAERI 55
            H +R+
Sbjct: 1715 HEDRL 1719



 Score = 85.4 bits (202), Expect = 1e-16
 Identities = 33/77 (42%), Positives = 59/77 (76%)
 Frame = -1

Query: 485 ES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQIS 306
           E  K ATD++Y DP+NL GKVQKHQ FE EL AN+ R+D +   G++L+++ H+A+ +++
Sbjct: 591 EKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVA 650

Query: 305 SRVEELGGIWERLVQSS 255
           +R+ E+  +W++L++++
Sbjct: 651 ARMNEVISLWKKLLEAT 667



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 32/76 (42%), Positives = 48/76 (63%)
 Frame = -1

Query: 488 RES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQI 309
           +E  + A+D++Y DPTNL GK+QKHQ FE E+QAN   + ++   G  ++   HFA   I
Sbjct: 61  QEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETI 120

Query: 308 SSRVEELGGIWERLVQ 261
            +R+ EL   WE L++
Sbjct: 121 RTRLMELHRQWELLLE 136



 Score = 66.5 bits (155), Expect = 7e-11
 Identities = 31/73 (42%), Positives = 48/73 (65%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL E+ +  Q+ R ++D E W+ E +  + SEDYG+DLT VQNL+KKH  LEA++++H  
Sbjct: 1764 KLNESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELAAHEP 1823

Query: 60   RIDAIREPGRASS 22
             I  + + G+  S
Sbjct: 1824 AIQGVLDTGKKLS 1836



 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 32/71 (45%), Positives = 43/71 (60%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           KL ++ + QQ  R VED E W+ E E    S + GKDL  VQNL KKH  L+A+++ H  
Sbjct: 779 KLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEP 838

Query: 60  RIDAIREPGRA 28
           RI A+ + G A
Sbjct: 839 RIKAVTQKGNA 849



 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 26/73 (35%), Positives = 44/73 (60%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +G +L+E+ + QQ+   VE+ E W++E    + SEDYG  L ++Q L KKH   E D + 
Sbjct: 1867 RGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTV 1926

Query: 69   HAERIDAIREPGR 31
            H +R++ +   G+
Sbjct: 1927 HKDRVNDVCTNGQ 1939



 Score = 57.2 bits (132), Expect = 4e-08
 Identities = 28/74 (37%), Positives = 48/74 (64%)
 Frame = -3

Query: 267 GAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALL 88
           G   + +G KL  AA+ Q++NR V++   W+ E E  + S+D+G+DL SVQ L +KH  L
Sbjct: 242 GLALQRQG-KLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGL 300

Query: 87  EADVSSHAERIDAI 46
           E D+++  +++ A+
Sbjct: 301 ERDLAALEDKVKAL 314



 Score = 56.8 bits (131), Expect = 5e-08
 Identities = 26/70 (37%), Positives = 44/70 (62%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG KL +A +  QY R  ED+  W+++ E  + SE+ G+DL  V+ LQKK    + D+++
Sbjct: 141 KGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAA 200

Query: 69  HAERIDAIRE 40
           H ER++ + +
Sbjct: 201 HEERVNEVNQ 210



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/70 (38%), Positives = 41/70 (58%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L+++ Q QQY     + E W+ E E  + S DYGKD  S + L KKH  L +D+S++   
Sbjct: 886  LEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSS 945

Query: 57   IDAIREPGRA 28
            I A+RE  ++
Sbjct: 946  IQALREQAQS 955



 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 26/74 (35%), Positives = 43/74 (58%)
 Frame = -3

Query: 261 VFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEA 82
           ++EL+  + ++    Q + R  E ++ W+S+ E  LL+ED G  L SV+ L KKH   E 
Sbjct: 455 LWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEK 514

Query: 81  DVSSHAERIDAIRE 40
            +S+  E+I A+ E
Sbjct: 515 SLSAQEEKITALDE 528



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 31/80 (38%), Positives = 44/80 (55%), Gaps = 7/80 (8%)
 Frame = -1

Query: 470  ATDDSYLDPTNLN-----GKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFA--QPQ 312
            A+D+SY DPTN+       K QKHQ FE EL AN  R+  +  +G  L+E    A  +  
Sbjct: 1574 ASDESYKDPTNIQLSKLLSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDA 1633

Query: 311  ISSRVEELGGIWERLVQSSS 252
            + +R+  L   W+ LVQ S+
Sbjct: 1634 VKARLAALADQWQFLVQKSA 1653



 Score = 50.0 bits (114), Expect = 6e-06
 Identities = 22/72 (30%), Positives = 44/72 (61%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L  A + Q+++R  ++ + W+ E    L +++YG DL SVQ LQ+KH   E D+
Sbjct: 1223 EERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDL 1282

Query: 75   SSHAERIDAIRE 40
            ++  ++++++ E
Sbjct: 1283 AALGDKVNSLGE 1294



 Score = 47.2 bits (107), Expect = 4e-05
 Identities = 27/79 (34%), Positives = 49/79 (62%), Gaps = 5/79 (6%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQ-----NLQKKHALLE 85
            K +KL E+   QQ++R V++IE W+SE + Q  S++  KD T++Q     +  +KH   E
Sbjct: 1543 KRSKLGESQTLQQFSRDVDEIEAWISE-KLQTASDESYKDPTNIQLSKLLSKHQKHQAFE 1601

Query: 84   ADVSSHAERIDAIREPGRA 28
            A++ ++A+RI  + + G +
Sbjct: 1602 AELHANADRIRGVIDMGNS 1620



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
            D   +   ++KHQ  + E+  ++PR+  +T  G  ++E  HFA   + +++ EL   WE 
Sbjct: 815  DLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEA 874

Query: 269  LVQSSS*R 246
            L   +S R
Sbjct: 875  LKAKASQR 882



 Score = 44.8 bits (101), Expect = 2e-04
 Identities = 24/77 (31%), Positives = 40/77 (51%)
 Frame = -3

Query: 300  RGRAGRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTS 121
            +G  G+      A  + K N + E +   Q+N   + +E W+ E E  L ++DYG+DL+S
Sbjct: 1957 KGLNGKVSDLEKAAAQRKAN-VDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSS 2015

Query: 120  VQNLQKKHALLEADVSS 70
            VQ L  K    +A + +
Sbjct: 2016 VQTLLTKQETFDAGLQA 2032



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 23/73 (31%), Positives = 44/73 (60%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           L+  KL+++ + Q + R  E++E W+ E + Q+ S++  KD T++Q   +KH   EA+V 
Sbjct: 35  LRRQKLEDSYRFQFFQRDAEELEKWIQE-KLQIASDENYKDPTNLQGKLQKHQAFEAEVQ 93

Query: 72  SHAERIDAIREPG 34
           +++  I  + E G
Sbjct: 94  ANSGAIVKLDETG 106



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 21/70 (30%), Positives = 42/70 (60%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L ++   QQ+ R  ++++ W++E       E Y KD +++Q   +KH   EA++S++  
Sbjct: 568 QLADSFHLQQFFRDSDELKSWVNEKMKTATDEAY-KDPSNLQGKVQKHQAFEAELSANQS 626

Query: 60  RIDAIREPGR 31
           RIDA+ + G+
Sbjct: 627 RIDALEKAGQ 636



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/72 (27%), Positives = 39/72 (54%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L+++ ++    R   +++ W++E E  L SE+ G DL  V+ LQKK    + D+
Sbjct: 1081 EKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDL 1140

Query: 75   SSHAERIDAIRE 40
             ++  R+  I +
Sbjct: 1141 KANESRLKDINK 1152



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 21/65 (32%), Positives = 35/65 (53%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L +  + Q ++R  E  E W++  E  L +ED G  L SV+ L KKH   +  ++   E+
Sbjct: 1441 LDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEK 1500

Query: 57   IDAIR 43
            I A++
Sbjct: 1501 IAALQ 1505



 Score = 38.7 bits (86), Expect = 0.016
 Identities = 21/68 (30%), Positives = 34/68 (50%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A+DD   D TN+    +KH   E ++ A++ R+D IT   ++  +  HF    I  + E 
Sbjct: 702 ASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEA 761

Query: 290 LGGIWERL 267
           L   +E L
Sbjct: 762 LVARYEAL 769



 Score = 38.7 bits (86), Expect = 0.016
 Identities = 17/67 (25%), Positives = 36/67 (53%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            T+D      ++   ++KH++F++ +   + ++  + A   +L+   H+A+  ISSR  E+
Sbjct: 1470 TEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGDISSRRNEV 1529

Query: 287  GGIWERL 267
               W RL
Sbjct: 1530 LDRWRRL 1536



 Score = 37.1 bits (82), Expect = 0.047
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A+DD   D  ++   ++KH+  E++L A + +V  + A   RL +    +  QI  + EE
Sbjct: 279 ASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSATQIQVKREE 338

Query: 290 LGGIWERL 267
           L   WE++
Sbjct: 339 LITNWEQI 346



 Score = 37.1 bits (82), Expect = 0.047
 Identities = 19/74 (25%), Positives = 37/74 (50%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            ++D   D T +    +KH+  E EL A++P +  +   GK+L +     + +I  R+ + 
Sbjct: 1794 SEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQF 1853

Query: 287  GGIWERLVQSSS*R 246
               W+ L Q ++ R
Sbjct: 1854 VEHWKELKQLAAAR 1867



 Score = 37.1 bits (82), Expect = 0.047
 Identities = 17/67 (25%), Positives = 40/67 (59%)
 Frame = -1

Query: 437  LNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQS 258
            + G ++KH+ FE +   +K RV+++   G+ L++  +  +  ISS+++ L G    L ++
Sbjct: 1910 IQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKA 1969

Query: 257  SS*RETS 237
            ++ R+ +
Sbjct: 1970 AAQRKAN 1976



 Score = 35.9 bits (79), Expect = 0.11
 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 1/86 (1%)
 Frame = -1

Query: 497  LGKRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQA-NKPRVDEITAVGKRLLELEHFA 321
            +G++E+    TDD   D +++   + K + F+  LQA  +  +  ITA+  +LL  +H  
Sbjct: 1997 IGEKEN-SLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHVQ 2055

Query: 320  QPQISSRVEELGGIWERLVQSSS*RE 243
               I +R   L   W +L+ +S+ R+
Sbjct: 2056 SKAIEARHASLMKRWSQLLANSAARK 2081



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 15/70 (21%), Positives = 35/70 (50%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL ++   Q++     D+  W++ + G + S++  KD+T  + L ++H     ++ + A 
Sbjct: 1334 KLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAG 1393

Query: 60   RIDAIREPGR 31
               A  + G+
Sbjct: 1394 TFQAFEQFGQ 1403



 Score = 33.1 bits (72), Expect = 0.77
 Identities = 11/46 (23%), Positives = 28/46 (60%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           ++KH++FE+ L A + ++  +     +L++  H+A   +++R + L
Sbjct: 506 LKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRRDAL 551



 Score = 33.1 bits (72), Expect = 0.77
 Identities = 15/61 (24%), Positives = 29/61 (47%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            ++D+   D T     +++HQ    E+ A           G++LL   H+A P+I  +++ 
Sbjct: 1363 SSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDI 1422

Query: 290  L 288
            L
Sbjct: 1423 L 1423



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 16/67 (23%), Positives = 32/67 (47%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            TD+   D  ++    +KH+ FE++L A   +V+ +    +RL++    +   +  +  EL
Sbjct: 1258 TDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTEL 1317

Query: 287  GGIWERL 267
               W  L
Sbjct: 1318 NQAWSSL 1324


>BC053521-1|AAH53521.1| 2452|Homo sapiens SPTAN1 protein protein.
          Length = 2452

 Score =  116 bits (279), Expect = 6e-26
 Identities = 55/70 (78%), Positives = 62/70 (88%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           ELKG KL+EA QQQQ+NR VEDIELWL EVEG L S+DYGKDLT+VQNLQKKHALLEADV
Sbjct: 668 ELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADV 727

Query: 75  SSHAERIDAI 46
           ++H +RID I
Sbjct: 728 AAHQDRIDGI 737



 Score = 88.6 bits (210), Expect = 1e-17
 Identities = 39/65 (60%), Positives = 49/65 (75%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K  KL+EA +QQ +N  ++D + WLSEVE  L SEDYGKDL SV NL KKH LLEAD+S+
Sbjct: 1630 KSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISA 1689

Query: 69   HAERI 55
            H +R+
Sbjct: 1690 HEDRL 1694



 Score = 85.4 bits (202), Expect = 1e-16
 Identities = 33/77 (42%), Positives = 59/77 (76%)
 Frame = -1

Query: 485 ES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQIS 306
           E  K ATD++Y DP+NL GKVQKHQ FE EL AN+ R+D +   G++L+++ H+A+ +++
Sbjct: 591 EKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVA 650

Query: 305 SRVEELGGIWERLVQSS 255
           +R+ E+  +W++L++++
Sbjct: 651 ARMNEVISLWKKLLEAT 667



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 32/76 (42%), Positives = 48/76 (63%)
 Frame = -1

Query: 488 RES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQI 309
           +E  + A+D++Y DPTNL GK+QKHQ FE E+QAN   + ++   G  ++   HFA   I
Sbjct: 61  QEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETI 120

Query: 308 SSRVEELGGIWERLVQ 261
            +R+ EL   WE L++
Sbjct: 121 RTRLMELHRQWELLLE 136



 Score = 66.5 bits (155), Expect = 7e-11
 Identities = 31/73 (42%), Positives = 48/73 (65%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL E+ +  Q+ R ++D E W+ E +  + SEDYG+DLT VQNL+KKH  LEA++++H  
Sbjct: 1739 KLNESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELAAHEP 1798

Query: 60   RIDAIREPGRASS 22
             I  + + G+  S
Sbjct: 1799 AIQGVLDTGKKLS 1811



 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 32/71 (45%), Positives = 43/71 (60%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           KL ++ + QQ  R VED E W+ E E    S + GKDL  VQNL KKH  L+A+++ H  
Sbjct: 779 KLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEP 838

Query: 60  RIDAIREPGRA 28
           RI A+ + G A
Sbjct: 839 RIKAVTQKGNA 849



 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 31/75 (41%), Positives = 44/75 (58%), Gaps = 2/75 (2%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFA--QPQISSRV 297
            A+D+SY DPTN+  K QKHQ FE EL AN  R+  +  +G  L+E    A  +  + +R+
Sbjct: 1554 ASDESYKDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARL 1613

Query: 296  EELGGIWERLVQSSS 252
              L   W+ LVQ S+
Sbjct: 1614 AALADQWQFLVQKSA 1628



 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 26/73 (35%), Positives = 44/73 (60%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +G +L+E+ + QQ+   VE+ E W++E    + SEDYG  L ++Q L KKH   E D + 
Sbjct: 1842 RGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTV 1901

Query: 69   HAERIDAIREPGR 31
            H +R++ +   G+
Sbjct: 1902 HKDRVNDVCTNGQ 1914



 Score = 57.2 bits (132), Expect = 4e-08
 Identities = 28/74 (37%), Positives = 48/74 (64%)
 Frame = -3

Query: 267 GAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALL 88
           G   + +G KL  AA+ Q++NR V++   W+ E E  + S+D+G+DL SVQ L +KH  L
Sbjct: 242 GLALQRQG-KLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGL 300

Query: 87  EADVSSHAERIDAI 46
           E D+++  +++ A+
Sbjct: 301 ERDLAALEDKVKAL 314



 Score = 56.8 bits (131), Expect = 5e-08
 Identities = 26/70 (37%), Positives = 44/70 (62%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG KL +A +  QY R  ED+  W+++ E  + SE+ G+DL  V+ LQKK    + D+++
Sbjct: 141 KGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAA 200

Query: 69  HAERIDAIRE 40
           H ER++ + +
Sbjct: 201 HEERVNEVNQ 210



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/70 (38%), Positives = 41/70 (58%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L+++ Q QQY     + E W+ E E  + S DYGKD  S + L KKH  L +D+S++   
Sbjct: 886  LEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSS 945

Query: 57   IDAIREPGRA 28
            I A+RE  ++
Sbjct: 946  IQALREQAQS 955



 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 27/74 (36%), Positives = 49/74 (66%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K +KL E+   QQ++R V++IE W+SE + Q  S++  KD T++Q+  +KH   EA++ +
Sbjct: 1523 KRSKLGESQTLQQFSRDVDEIEAWISE-KLQTASDESYKDPTNIQSKHQKHQAFEAELHA 1581

Query: 69   HAERIDAIREPGRA 28
            +A+RI  + + G +
Sbjct: 1582 NADRIRGVIDMGNS 1595



 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 26/74 (35%), Positives = 43/74 (58%)
 Frame = -3

Query: 261 VFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEA 82
           ++EL+  + ++    Q + R  E ++ W+S+ E  LL+ED G  L SV+ L KKH   E 
Sbjct: 455 LWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEK 514

Query: 81  DVSSHAERIDAIRE 40
            +S+  E+I A+ E
Sbjct: 515 SLSAQEEKITALDE 528



 Score = 50.0 bits (114), Expect = 6e-06
 Identities = 22/72 (30%), Positives = 44/72 (61%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L  A + Q+++R  ++ + W+ E    L +++YG DL SVQ LQ+KH   E D+
Sbjct: 1203 EERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDL 1262

Query: 75   SSHAERIDAIRE 40
            ++  ++++++ E
Sbjct: 1263 AALGDKVNSLGE 1274



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 21/57 (36%), Positives = 33/57 (57%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KL E +   Q+N   + +E W+ E E  L ++DYG+DL+SVQ L  K    +A + +
Sbjct: 1951 KLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQA 2007



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
            D   +   ++KHQ  + E+  ++PR+  +T  G  ++E  HFA   + +++ EL   WE 
Sbjct: 815  DLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEA 874

Query: 269  LVQSSS*R 246
            L   +S R
Sbjct: 875  LKAKASQR 882



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 23/73 (31%), Positives = 44/73 (60%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           L+  KL+++ + Q + R  E++E W+ E + Q+ S++  KD T++Q   +KH   EA+V 
Sbjct: 35  LRRQKLEDSYRFQFFQRDAEELEKWIQE-KLQIASDENYKDPTNLQGKLQKHQAFEAEVQ 93

Query: 72  SHAERIDAIREPG 34
           +++  I  + E G
Sbjct: 94  ANSGAIVKLDETG 106



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 21/70 (30%), Positives = 42/70 (60%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L ++   QQ+ R  ++++ W++E       E Y KD +++Q   +KH   EA++S++  
Sbjct: 568 QLADSFHLQQFFRDSDELKSWVNEKMKTATDEAY-KDPSNLQGKVQKHQAFEAELSANQS 626

Query: 60  RIDAIREPGR 31
           RIDA+ + G+
Sbjct: 627 RIDALEKAGQ 636



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/72 (27%), Positives = 39/72 (54%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L+++ ++    R   +++ W++E E  L SE+ G DL  V+ LQKK    + D+
Sbjct: 1061 EKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDL 1120

Query: 75   SSHAERIDAIRE 40
             ++  R+  I +
Sbjct: 1121 KANESRLKDINK 1132



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 21/65 (32%), Positives = 35/65 (53%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L +  + Q ++R  E  E W++  E  L +ED G  L SV+ L KKH   +  ++   E+
Sbjct: 1421 LDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEK 1480

Query: 57   IDAIR 43
            I A++
Sbjct: 1481 IAALQ 1485



 Score = 38.7 bits (86), Expect = 0.016
 Identities = 21/68 (30%), Positives = 34/68 (50%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A+DD   D TN+    +KH   E ++ A++ R+D IT   ++  +  HF    I  + E 
Sbjct: 702 ASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEA 761

Query: 290 LGGIWERL 267
           L   +E L
Sbjct: 762 LVARYEAL 769



 Score = 38.7 bits (86), Expect = 0.016
 Identities = 17/67 (25%), Positives = 36/67 (53%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            T+D      ++   ++KH++F++ +   + ++  + A   +L+   H+A+  ISSR  E+
Sbjct: 1450 TEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGDISSRRNEV 1509

Query: 287  GGIWERL 267
               W RL
Sbjct: 1510 LDRWRRL 1516



 Score = 37.1 bits (82), Expect = 0.047
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A+DD   D  ++   ++KH+  E++L A + +V  + A   RL +    +  QI  + EE
Sbjct: 279 ASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSATQIQVKREE 338

Query: 290 LGGIWERL 267
           L   WE++
Sbjct: 339 LITNWEQI 346



 Score = 37.1 bits (82), Expect = 0.047
 Identities = 19/74 (25%), Positives = 37/74 (50%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            ++D   D T +    +KH+  E EL A++P +  +   GK+L +     + +I  R+ + 
Sbjct: 1769 SEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQF 1828

Query: 287  GGIWERLVQSSS*R 246
               W+ L Q ++ R
Sbjct: 1829 VEHWKELKQLAAAR 1842



 Score = 36.7 bits (81), Expect = 0.063
 Identities = 15/52 (28%), Positives = 32/52 (61%)
 Frame = -1

Query: 437  LNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGG 282
            + G ++KH+ FE +   +K RV+++   G+ L++  +  +  ISS+++ L G
Sbjct: 1885 IQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNG 1936



 Score = 35.9 bits (79), Expect = 0.11
 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 1/86 (1%)
 Frame = -1

Query: 497  LGKRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQA-NKPRVDEITAVGKRLLELEHFA 321
            +G++E+    TDD   D +++   + K + F+  LQA  +  +  ITA+  +LL  +H  
Sbjct: 1972 IGEKEN-SLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHVQ 2030

Query: 320  QPQISSRVEELGGIWERLVQSSS*RE 243
               I +R   L   W +L+ +S+ R+
Sbjct: 2031 SKAIEARHASLMKRWSQLLANSAARK 2056



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 15/70 (21%), Positives = 35/70 (50%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL ++   Q++     D+  W++ + G + S++  KD+T  + L ++H     ++ + A 
Sbjct: 1314 KLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAG 1373

Query: 60   RIDAIREPGR 31
               A  + G+
Sbjct: 1374 TFQAFEQFGQ 1383



 Score = 33.1 bits (72), Expect = 0.77
 Identities = 11/46 (23%), Positives = 28/46 (60%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           ++KH++FE+ L A + ++  +     +L++  H+A   +++R + L
Sbjct: 506 LKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRRDAL 551



 Score = 33.1 bits (72), Expect = 0.77
 Identities = 15/61 (24%), Positives = 29/61 (47%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            ++D+   D T     +++HQ    E+ A           G++LL   H+A P+I  +++ 
Sbjct: 1343 SSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDI 1402

Query: 290  L 288
            L
Sbjct: 1403 L 1403



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 16/67 (23%), Positives = 32/67 (47%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            TD+   D  ++    +KH+ FE++L A   +V+ +    +RL++    +   +  +  EL
Sbjct: 1238 TDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTEL 1297

Query: 287  GGIWERL 267
               W  L
Sbjct: 1298 NQAWSSL 1304


>AL356481-4|CAH71405.1| 2472|Homo sapiens spectrin, alpha,
           non-erythrocytic 1 (alpha-fodrin) protein.
          Length = 2472

 Score =  116 bits (279), Expect = 6e-26
 Identities = 55/70 (78%), Positives = 62/70 (88%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           ELKG KL+EA QQQQ+NR VEDIELWL EVEG L S+DYGKDLT+VQNLQKKHALLEADV
Sbjct: 668 ELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADV 727

Query: 75  SSHAERIDAI 46
           ++H +RID I
Sbjct: 728 AAHQDRIDGI 737



 Score = 88.6 bits (210), Expect = 1e-17
 Identities = 39/65 (60%), Positives = 49/65 (75%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K  KL+EA +QQ +N  ++D + WLSEVE  L SEDYGKDL SV NL KKH LLEAD+S+
Sbjct: 1650 KSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISA 1709

Query: 69   HAERI 55
            H +R+
Sbjct: 1710 HEDRL 1714



 Score = 85.4 bits (202), Expect = 1e-16
 Identities = 33/77 (42%), Positives = 59/77 (76%)
 Frame = -1

Query: 485 ES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQIS 306
           E  K ATD++Y DP+NL GKVQKHQ FE EL AN+ R+D +   G++L+++ H+A+ +++
Sbjct: 591 EKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVA 650

Query: 305 SRVEELGGIWERLVQSS 255
           +R+ E+  +W++L++++
Sbjct: 651 ARMNEVISLWKKLLEAT 667



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 32/76 (42%), Positives = 48/76 (63%)
 Frame = -1

Query: 488 RES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQI 309
           +E  + A+D++Y DPTNL GK+QKHQ FE E+QAN   + ++   G  ++   HFA   I
Sbjct: 61  QEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETI 120

Query: 308 SSRVEELGGIWERLVQ 261
            +R+ EL   WE L++
Sbjct: 121 RTRLMELHRQWELLLE 136



 Score = 66.5 bits (155), Expect = 7e-11
 Identities = 31/73 (42%), Positives = 48/73 (65%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL E+ +  Q+ R ++D E W+ E +  + SEDYG+DLT VQNL+KKH  LEA++++H  
Sbjct: 1759 KLNESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELAAHEP 1818

Query: 60   RIDAIREPGRASS 22
             I  + + G+  S
Sbjct: 1819 AIQGVLDTGKKLS 1831



 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 32/71 (45%), Positives = 43/71 (60%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           KL ++ + QQ  R VED E W+ E E    S + GKDL  VQNL KKH  L+A+++ H  
Sbjct: 779 KLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEP 838

Query: 60  RIDAIREPGRA 28
           RI A+ + G A
Sbjct: 839 RIKAVTQKGNA 849



 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 31/75 (41%), Positives = 44/75 (58%), Gaps = 2/75 (2%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFA--QPQISSRV 297
            A+D+SY DPTN+  K QKHQ FE EL AN  R+  +  +G  L+E    A  +  + +R+
Sbjct: 1574 ASDESYKDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARL 1633

Query: 296  EELGGIWERLVQSSS 252
              L   W+ LVQ S+
Sbjct: 1634 AALADQWQFLVQKSA 1648



 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 26/73 (35%), Positives = 44/73 (60%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +G +L+E+ + QQ+   VE+ E W++E    + SEDYG  L ++Q L KKH   E D + 
Sbjct: 1862 RGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTV 1921

Query: 69   HAERIDAIREPGR 31
            H +R++ +   G+
Sbjct: 1922 HKDRVNDVCTNGQ 1934



 Score = 57.2 bits (132), Expect = 4e-08
 Identities = 28/74 (37%), Positives = 48/74 (64%)
 Frame = -3

Query: 267 GAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALL 88
           G   + +G KL  AA+ Q++NR V++   W+ E E  + S+D+G+DL SVQ L +KH  L
Sbjct: 242 GLALQRQG-KLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGL 300

Query: 87  EADVSSHAERIDAI 46
           E D+++  +++ A+
Sbjct: 301 ERDLAALEDKVKAL 314



 Score = 56.8 bits (131), Expect = 5e-08
 Identities = 26/70 (37%), Positives = 44/70 (62%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG KL +A +  QY R  ED+  W+++ E  + SE+ G+DL  V+ LQKK    + D+++
Sbjct: 141 KGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAA 200

Query: 69  HAERIDAIRE 40
           H ER++ + +
Sbjct: 201 HEERVNEVNQ 210



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/70 (38%), Positives = 41/70 (58%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L+++ Q QQY     + E W+ E E  + S DYGKD  S + L KKH  L +D+S++   
Sbjct: 886  LEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSS 945

Query: 57   IDAIREPGRA 28
            I A+RE  ++
Sbjct: 946  IQALREQAQS 955



 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 27/74 (36%), Positives = 49/74 (66%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K +KL E+   QQ++R V++IE W+SE + Q  S++  KD T++Q+  +KH   EA++ +
Sbjct: 1543 KRSKLGESQTLQQFSRDVDEIEAWISE-KLQTASDESYKDPTNIQSKHQKHQAFEAELHA 1601

Query: 69   HAERIDAIREPGRA 28
            +A+RI  + + G +
Sbjct: 1602 NADRIRGVIDMGNS 1615



 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 26/74 (35%), Positives = 43/74 (58%)
 Frame = -3

Query: 261 VFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEA 82
           ++EL+  + ++    Q + R  E ++ W+S+ E  LL+ED G  L SV+ L KKH   E 
Sbjct: 455 LWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEK 514

Query: 81  DVSSHAERIDAIRE 40
            +S+  E+I A+ E
Sbjct: 515 SLSAQEEKITALDE 528



 Score = 50.0 bits (114), Expect = 6e-06
 Identities = 22/72 (30%), Positives = 44/72 (61%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L  A + Q+++R  ++ + W+ E    L +++YG DL SVQ LQ+KH   E D+
Sbjct: 1223 EERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDL 1282

Query: 75   SSHAERIDAIRE 40
            ++  ++++++ E
Sbjct: 1283 AALGDKVNSLGE 1294



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 21/57 (36%), Positives = 33/57 (57%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KL E +   Q+N   + +E W+ E E  L ++DYG+DL+SVQ L  K    +A + +
Sbjct: 1971 KLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQA 2027



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
            D   +   ++KHQ  + E+  ++PR+  +T  G  ++E  HFA   + +++ EL   WE 
Sbjct: 815  DLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEA 874

Query: 269  LVQSSS*R 246
            L   +S R
Sbjct: 875  LKAKASQR 882



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 23/73 (31%), Positives = 44/73 (60%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           L+  KL+++ + Q + R  E++E W+ E + Q+ S++  KD T++Q   +KH   EA+V 
Sbjct: 35  LRRQKLEDSYRFQFFQRDAEELEKWIQE-KLQIASDENYKDPTNLQGKLQKHQAFEAEVQ 93

Query: 72  SHAERIDAIREPG 34
           +++  I  + E G
Sbjct: 94  ANSGAIVKLDETG 106



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 21/70 (30%), Positives = 42/70 (60%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L ++   QQ+ R  ++++ W++E       E Y KD +++Q   +KH   EA++S++  
Sbjct: 568 QLADSFHLQQFFRDSDELKSWVNEKMKTATDEAY-KDPSNLQGKVQKHQAFEAELSANQS 626

Query: 60  RIDAIREPGR 31
           RIDA+ + G+
Sbjct: 627 RIDALEKAGQ 636



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/72 (27%), Positives = 39/72 (54%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L+++ ++    R   +++ W++E E  L SE+ G DL  V+ LQKK    + D+
Sbjct: 1081 EKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDL 1140

Query: 75   SSHAERIDAIRE 40
             ++  R+  I +
Sbjct: 1141 KANESRLKDINK 1152



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 21/65 (32%), Positives = 35/65 (53%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L +  + Q ++R  E  E W++  E  L +ED G  L SV+ L KKH   +  ++   E+
Sbjct: 1441 LDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEK 1500

Query: 57   IDAIR 43
            I A++
Sbjct: 1501 IAALQ 1505



 Score = 38.7 bits (86), Expect = 0.016
 Identities = 21/68 (30%), Positives = 34/68 (50%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A+DD   D TN+    +KH   E ++ A++ R+D IT   ++  +  HF    I  + E 
Sbjct: 702 ASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEA 761

Query: 290 LGGIWERL 267
           L   +E L
Sbjct: 762 LVARYEAL 769



 Score = 38.7 bits (86), Expect = 0.016
 Identities = 17/67 (25%), Positives = 36/67 (53%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            T+D      ++   ++KH++F++ +   + ++  + A   +L+   H+A+  ISSR  E+
Sbjct: 1470 TEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGDISSRRNEV 1529

Query: 287  GGIWERL 267
               W RL
Sbjct: 1530 LDRWRRL 1536



 Score = 37.1 bits (82), Expect = 0.047
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A+DD   D  ++   ++KH+  E++L A + +V  + A   RL +    +  QI  + EE
Sbjct: 279 ASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSATQIQVKREE 338

Query: 290 LGGIWERL 267
           L   WE++
Sbjct: 339 LITNWEQI 346



 Score = 37.1 bits (82), Expect = 0.047
 Identities = 19/74 (25%), Positives = 37/74 (50%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            ++D   D T +    +KH+  E EL A++P +  +   GK+L +     + +I  R+ + 
Sbjct: 1789 SEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQF 1848

Query: 287  GGIWERLVQSSS*R 246
               W+ L Q ++ R
Sbjct: 1849 VEHWKELKQLAAAR 1862



 Score = 36.7 bits (81), Expect = 0.063
 Identities = 15/52 (28%), Positives = 32/52 (61%)
 Frame = -1

Query: 437  LNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGG 282
            + G ++KH+ FE +   +K RV+++   G+ L++  +  +  ISS+++ L G
Sbjct: 1905 IQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNG 1956



 Score = 35.9 bits (79), Expect = 0.11
 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 1/86 (1%)
 Frame = -1

Query: 497  LGKRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQA-NKPRVDEITAVGKRLLELEHFA 321
            +G++E+    TDD   D +++   + K + F+  LQA  +  +  ITA+  +LL  +H  
Sbjct: 1992 IGEKEN-SLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHVQ 2050

Query: 320  QPQISSRVEELGGIWERLVQSSS*RE 243
               I +R   L   W +L+ +S+ R+
Sbjct: 2051 SKAIEARHASLMKRWSQLLANSAARK 2076



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 15/70 (21%), Positives = 35/70 (50%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL ++   Q++     D+  W++ + G + S++  KD+T  + L ++H     ++ + A 
Sbjct: 1334 KLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAG 1393

Query: 60   RIDAIREPGR 31
               A  + G+
Sbjct: 1394 TFQAFEQFGQ 1403



 Score = 33.1 bits (72), Expect = 0.77
 Identities = 11/46 (23%), Positives = 28/46 (60%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           ++KH++FE+ L A + ++  +     +L++  H+A   +++R + L
Sbjct: 506 LKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRRDAL 551



 Score = 33.1 bits (72), Expect = 0.77
 Identities = 15/61 (24%), Positives = 29/61 (47%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            ++D+   D T     +++HQ    E+ A           G++LL   H+A P+I  +++ 
Sbjct: 1363 SSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDI 1422

Query: 290  L 288
            L
Sbjct: 1423 L 1423



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 16/67 (23%), Positives = 32/67 (47%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            TD+   D  ++    +KH+ FE++L A   +V+ +    +RL++    +   +  +  EL
Sbjct: 1258 TDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTEL 1317

Query: 287  GGIWERL 267
               W  L
Sbjct: 1318 NQAWSSL 1324


>AL356481-3|CAH71404.1| 2477|Homo sapiens spectrin, alpha,
           non-erythrocytic 1 (alpha-fodrin) protein.
          Length = 2477

 Score =  116 bits (279), Expect = 6e-26
 Identities = 55/70 (78%), Positives = 62/70 (88%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           ELKG KL+EA QQQQ+NR VEDIELWL EVEG L S+DYGKDLT+VQNLQKKHALLEADV
Sbjct: 668 ELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADV 727

Query: 75  SSHAERIDAI 46
           ++H +RID I
Sbjct: 728 AAHQDRIDGI 737



 Score = 88.6 bits (210), Expect = 1e-17
 Identities = 39/65 (60%), Positives = 49/65 (75%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K  KL+EA +QQ +N  ++D + WLSEVE  L SEDYGKDL SV NL KKH LLEAD+S+
Sbjct: 1655 KSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISA 1714

Query: 69   HAERI 55
            H +R+
Sbjct: 1715 HEDRL 1719



 Score = 85.4 bits (202), Expect = 1e-16
 Identities = 33/77 (42%), Positives = 59/77 (76%)
 Frame = -1

Query: 485 ES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQIS 306
           E  K ATD++Y DP+NL GKVQKHQ FE EL AN+ R+D +   G++L+++ H+A+ +++
Sbjct: 591 EKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVA 650

Query: 305 SRVEELGGIWERLVQSS 255
           +R+ E+  +W++L++++
Sbjct: 651 ARMNEVISLWKKLLEAT 667



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 32/76 (42%), Positives = 48/76 (63%)
 Frame = -1

Query: 488 RES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQI 309
           +E  + A+D++Y DPTNL GK+QKHQ FE E+QAN   + ++   G  ++   HFA   I
Sbjct: 61  QEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETI 120

Query: 308 SSRVEELGGIWERLVQ 261
            +R+ EL   WE L++
Sbjct: 121 RTRLMELHRQWELLLE 136



 Score = 66.5 bits (155), Expect = 7e-11
 Identities = 31/73 (42%), Positives = 48/73 (65%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL E+ +  Q+ R ++D E W+ E +  + SEDYG+DLT VQNL+KKH  LEA++++H  
Sbjct: 1764 KLNESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELAAHEP 1823

Query: 60   RIDAIREPGRASS 22
             I  + + G+  S
Sbjct: 1824 AIQGVLDTGKKLS 1836



 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 32/71 (45%), Positives = 43/71 (60%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           KL ++ + QQ  R VED E W+ E E    S + GKDL  VQNL KKH  L+A+++ H  
Sbjct: 779 KLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEP 838

Query: 60  RIDAIREPGRA 28
           RI A+ + G A
Sbjct: 839 RIKAVTQKGNA 849



 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 26/73 (35%), Positives = 44/73 (60%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +G +L+E+ + QQ+   VE+ E W++E    + SEDYG  L ++Q L KKH   E D + 
Sbjct: 1867 RGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTV 1926

Query: 69   HAERIDAIREPGR 31
            H +R++ +   G+
Sbjct: 1927 HKDRVNDVCTNGQ 1939



 Score = 57.2 bits (132), Expect = 4e-08
 Identities = 28/74 (37%), Positives = 48/74 (64%)
 Frame = -3

Query: 267 GAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALL 88
           G   + +G KL  AA+ Q++NR V++   W+ E E  + S+D+G+DL SVQ L +KH  L
Sbjct: 242 GLALQRQG-KLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGL 300

Query: 87  EADVSSHAERIDAI 46
           E D+++  +++ A+
Sbjct: 301 ERDLAALEDKVKAL 314



 Score = 56.8 bits (131), Expect = 5e-08
 Identities = 26/70 (37%), Positives = 44/70 (62%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG KL +A +  QY R  ED+  W+++ E  + SE+ G+DL  V+ LQKK    + D+++
Sbjct: 141 KGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAA 200

Query: 69  HAERIDAIRE 40
           H ER++ + +
Sbjct: 201 HEERVNEVNQ 210



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/70 (38%), Positives = 41/70 (58%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L+++ Q QQY     + E W+ E E  + S DYGKD  S + L KKH  L +D+S++   
Sbjct: 886  LEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSS 945

Query: 57   IDAIREPGRA 28
            I A+RE  ++
Sbjct: 946  IQALREQAQS 955



 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 26/74 (35%), Positives = 43/74 (58%)
 Frame = -3

Query: 261 VFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEA 82
           ++EL+  + ++    Q + R  E ++ W+S+ E  LL+ED G  L SV+ L KKH   E 
Sbjct: 455 LWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEK 514

Query: 81  DVSSHAERIDAIRE 40
            +S+  E+I A+ E
Sbjct: 515 SLSAQEEKITALDE 528



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 31/80 (38%), Positives = 44/80 (55%), Gaps = 7/80 (8%)
 Frame = -1

Query: 470  ATDDSYLDPTNLN-----GKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFA--QPQ 312
            A+D+SY DPTN+       K QKHQ FE EL AN  R+  +  +G  L+E    A  +  
Sbjct: 1574 ASDESYKDPTNIQLSKLLSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDA 1633

Query: 311  ISSRVEELGGIWERLVQSSS 252
            + +R+  L   W+ LVQ S+
Sbjct: 1634 VKARLAALADQWQFLVQKSA 1653



 Score = 50.0 bits (114), Expect = 6e-06
 Identities = 22/72 (30%), Positives = 44/72 (61%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L  A + Q+++R  ++ + W+ E    L +++YG DL SVQ LQ+KH   E D+
Sbjct: 1223 EERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDL 1282

Query: 75   SSHAERIDAIRE 40
            ++  ++++++ E
Sbjct: 1283 AALGDKVNSLGE 1294



 Score = 47.2 bits (107), Expect = 4e-05
 Identities = 27/79 (34%), Positives = 49/79 (62%), Gaps = 5/79 (6%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQ-----NLQKKHALLE 85
            K +KL E+   QQ++R V++IE W+SE + Q  S++  KD T++Q     +  +KH   E
Sbjct: 1543 KRSKLGESQTLQQFSRDVDEIEAWISE-KLQTASDESYKDPTNIQLSKLLSKHQKHQAFE 1601

Query: 84   ADVSSHAERIDAIREPGRA 28
            A++ ++A+RI  + + G +
Sbjct: 1602 AELHANADRIRGVIDMGNS 1620



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 21/57 (36%), Positives = 33/57 (57%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KL E +   Q+N   + +E W+ E E  L ++DYG+DL+SVQ L  K    +A + +
Sbjct: 1976 KLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQA 2032



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
            D   +   ++KHQ  + E+  ++PR+  +T  G  ++E  HFA   + +++ EL   WE 
Sbjct: 815  DLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEA 874

Query: 269  LVQSSS*R 246
            L   +S R
Sbjct: 875  LKAKASQR 882



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 23/73 (31%), Positives = 44/73 (60%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           L+  KL+++ + Q + R  E++E W+ E + Q+ S++  KD T++Q   +KH   EA+V 
Sbjct: 35  LRRQKLEDSYRFQFFQRDAEELEKWIQE-KLQIASDENYKDPTNLQGKLQKHQAFEAEVQ 93

Query: 72  SHAERIDAIREPG 34
           +++  I  + E G
Sbjct: 94  ANSGAIVKLDETG 106



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 21/70 (30%), Positives = 42/70 (60%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L ++   QQ+ R  ++++ W++E       E Y KD +++Q   +KH   EA++S++  
Sbjct: 568 QLADSFHLQQFFRDSDELKSWVNEKMKTATDEAY-KDPSNLQGKVQKHQAFEAELSANQS 626

Query: 60  RIDAIREPGR 31
           RIDA+ + G+
Sbjct: 627 RIDALEKAGQ 636



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/72 (27%), Positives = 39/72 (54%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L+++ ++    R   +++ W++E E  L SE+ G DL  V+ LQKK    + D+
Sbjct: 1081 EKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDL 1140

Query: 75   SSHAERIDAIRE 40
             ++  R+  I +
Sbjct: 1141 KANESRLKDINK 1152



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 21/65 (32%), Positives = 35/65 (53%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L +  + Q ++R  E  E W++  E  L +ED G  L SV+ L KKH   +  ++   E+
Sbjct: 1441 LDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEK 1500

Query: 57   IDAIR 43
            I A++
Sbjct: 1501 IAALQ 1505



 Score = 38.7 bits (86), Expect = 0.016
 Identities = 21/68 (30%), Positives = 34/68 (50%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A+DD   D TN+    +KH   E ++ A++ R+D IT   ++  +  HF    I  + E 
Sbjct: 702 ASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEA 761

Query: 290 LGGIWERL 267
           L   +E L
Sbjct: 762 LVARYEAL 769



 Score = 38.7 bits (86), Expect = 0.016
 Identities = 17/67 (25%), Positives = 36/67 (53%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            T+D      ++   ++KH++F++ +   + ++  + A   +L+   H+A+  ISSR  E+
Sbjct: 1470 TEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGDISSRRNEV 1529

Query: 287  GGIWERL 267
               W RL
Sbjct: 1530 LDRWRRL 1536



 Score = 37.1 bits (82), Expect = 0.047
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A+DD   D  ++   ++KH+  E++L A + +V  + A   RL +    +  QI  + EE
Sbjct: 279 ASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSATQIQVKREE 338

Query: 290 LGGIWERL 267
           L   WE++
Sbjct: 339 LITNWEQI 346



 Score = 37.1 bits (82), Expect = 0.047
 Identities = 19/74 (25%), Positives = 37/74 (50%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            ++D   D T +    +KH+  E EL A++P +  +   GK+L +     + +I  R+ + 
Sbjct: 1794 SEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQF 1853

Query: 287  GGIWERLVQSSS*R 246
               W+ L Q ++ R
Sbjct: 1854 VEHWKELKQLAAAR 1867



 Score = 36.7 bits (81), Expect = 0.063
 Identities = 15/52 (28%), Positives = 32/52 (61%)
 Frame = -1

Query: 437  LNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGG 282
            + G ++KH+ FE +   +K RV+++   G+ L++  +  +  ISS+++ L G
Sbjct: 1910 IQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNG 1961



 Score = 35.9 bits (79), Expect = 0.11
 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 1/86 (1%)
 Frame = -1

Query: 497  LGKRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQA-NKPRVDEITAVGKRLLELEHFA 321
            +G++E+    TDD   D +++   + K + F+  LQA  +  +  ITA+  +LL  +H  
Sbjct: 1997 IGEKEN-SLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHVQ 2055

Query: 320  QPQISSRVEELGGIWERLVQSSS*RE 243
               I +R   L   W +L+ +S+ R+
Sbjct: 2056 SKAIEARHASLMKRWSQLLANSAARK 2081



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 15/70 (21%), Positives = 35/70 (50%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL ++   Q++     D+  W++ + G + S++  KD+T  + L ++H     ++ + A 
Sbjct: 1334 KLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAG 1393

Query: 60   RIDAIREPGR 31
               A  + G+
Sbjct: 1394 TFQAFEQFGQ 1403



 Score = 33.1 bits (72), Expect = 0.77
 Identities = 11/46 (23%), Positives = 28/46 (60%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           ++KH++FE+ L A + ++  +     +L++  H+A   +++R + L
Sbjct: 506 LKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRRDAL 551



 Score = 33.1 bits (72), Expect = 0.77
 Identities = 15/61 (24%), Positives = 29/61 (47%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            ++D+   D T     +++HQ    E+ A           G++LL   H+A P+I  +++ 
Sbjct: 1363 SSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDI 1422

Query: 290  L 288
            L
Sbjct: 1423 L 1423



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 16/67 (23%), Positives = 32/67 (47%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            TD+   D  ++    +KH+ FE++L A   +V+ +    +RL++    +   +  +  EL
Sbjct: 1258 TDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTEL 1317

Query: 287  GGIWERL 267
               W  L
Sbjct: 1318 NQAWSSL 1324


>AB209860-1|BAD93097.1| 2506|Homo sapiens spectrin, alpha,
           non-erythrocytic 1 (alpha-fodrin) variant protein.
          Length = 2506

 Score =  116 bits (279), Expect = 6e-26
 Identities = 55/70 (78%), Positives = 62/70 (88%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           ELKG KL+EA QQQQ+NR VEDIELWL EVEG L S+DYGKDLT+VQNLQKKHALLEADV
Sbjct: 702 ELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADV 761

Query: 75  SSHAERIDAI 46
           ++H +RID I
Sbjct: 762 AAHQDRIDGI 771



 Score = 88.6 bits (210), Expect = 1e-17
 Identities = 39/65 (60%), Positives = 49/65 (75%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K  KL+EA +QQ +N  ++D + WLSEVE  L SEDYGKDL SV NL KKH LLEAD+S+
Sbjct: 1684 KSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISA 1743

Query: 69   HAERI 55
            H +R+
Sbjct: 1744 HEDRL 1748



 Score = 85.4 bits (202), Expect = 1e-16
 Identities = 33/77 (42%), Positives = 59/77 (76%)
 Frame = -1

Query: 485 ES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQIS 306
           E  K ATD++Y DP+NL GKVQKHQ FE EL AN+ R+D +   G++L+++ H+A+ +++
Sbjct: 625 EKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVA 684

Query: 305 SRVEELGGIWERLVQSS 255
           +R+ E+  +W++L++++
Sbjct: 685 ARMNEVISLWKKLLEAT 701



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 32/76 (42%), Positives = 48/76 (63%)
 Frame = -1

Query: 488 RES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQI 309
           +E  + A+D++Y DPTNL GK+QKHQ FE E+QAN   + ++   G  ++   HFA   I
Sbjct: 95  QEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETI 154

Query: 308 SSRVEELGGIWERLVQ 261
            +R+ EL   WE L++
Sbjct: 155 RTRLMELHRQWELLLE 170



 Score = 66.5 bits (155), Expect = 7e-11
 Identities = 31/73 (42%), Positives = 48/73 (65%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL E+ +  Q+ R ++D E W+ E +  + SEDYG+DLT VQNL+KKH  LEA++++H  
Sbjct: 1793 KLNESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELAAHEP 1852

Query: 60   RIDAIREPGRASS 22
             I  + + G+  S
Sbjct: 1853 AIQGVLDTGKKLS 1865



 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 32/71 (45%), Positives = 43/71 (60%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL ++ + QQ  R VED E W+ E E    S + GKDL  VQNL KKH  L+A+++ H  
Sbjct: 813  KLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEP 872

Query: 60   RIDAIREPGRA 28
            RI A+ + G A
Sbjct: 873  RIKAVTQKGNA 883



 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 31/75 (41%), Positives = 44/75 (58%), Gaps = 2/75 (2%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFA--QPQISSRV 297
            A+D+SY DPTN+  K QKHQ FE EL AN  R+  +  +G  L+E    A  +  + +R+
Sbjct: 1608 ASDESYKDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARL 1667

Query: 296  EELGGIWERLVQSSS 252
              L   W+ LVQ S+
Sbjct: 1668 AALADQWQFLVQKSA 1682



 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 26/73 (35%), Positives = 44/73 (60%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +G +L+E+ + QQ+   VE+ E W++E    + SEDYG  L ++Q L KKH   E D + 
Sbjct: 1896 RGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTV 1955

Query: 69   HAERIDAIREPGR 31
            H +R++ +   G+
Sbjct: 1956 HKDRVNDVCTNGQ 1968



 Score = 57.2 bits (132), Expect = 4e-08
 Identities = 28/74 (37%), Positives = 48/74 (64%)
 Frame = -3

Query: 267 GAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALL 88
           G   + +G KL  AA+ Q++NR V++   W+ E E  + S+D+G+DL SVQ L +KH  L
Sbjct: 276 GLALQRQG-KLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGL 334

Query: 87  EADVSSHAERIDAI 46
           E D+++  +++ A+
Sbjct: 335 ERDLAALEDKVKAL 348



 Score = 56.8 bits (131), Expect = 5e-08
 Identities = 26/70 (37%), Positives = 44/70 (62%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG KL +A +  QY R  ED+  W+++ E  + SE+ G+DL  V+ LQKK    + D+++
Sbjct: 175 KGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAA 234

Query: 69  HAERIDAIRE 40
           H ER++ + +
Sbjct: 235 HEERVNEVNQ 244



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/70 (38%), Positives = 41/70 (58%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L+++ Q QQY     + E W+ E E  + S DYGKD  S + L KKH  L +D+S++   
Sbjct: 920  LEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSS 979

Query: 57   IDAIREPGRA 28
            I A+RE  ++
Sbjct: 980  IQALREQAQS 989



 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 27/74 (36%), Positives = 49/74 (66%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K +KL E+   QQ++R V++IE W+SE + Q  S++  KD T++Q+  +KH   EA++ +
Sbjct: 1577 KRSKLGESQTLQQFSRDVDEIEAWISE-KLQTASDESYKDPTNIQSKHQKHQAFEAELHA 1635

Query: 69   HAERIDAIREPGRA 28
            +A+RI  + + G +
Sbjct: 1636 NADRIRGVIDMGNS 1649



 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 26/74 (35%), Positives = 43/74 (58%)
 Frame = -3

Query: 261 VFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEA 82
           ++EL+  + ++    Q + R  E ++ W+S+ E  LL+ED G  L SV+ L KKH   E 
Sbjct: 489 LWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEK 548

Query: 81  DVSSHAERIDAIRE 40
            +S+  E+I A+ E
Sbjct: 549 SLSAQEEKITALDE 562



 Score = 50.0 bits (114), Expect = 6e-06
 Identities = 22/72 (30%), Positives = 44/72 (61%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L  A + Q+++R  ++ + W+ E    L +++YG DL SVQ LQ+KH   E D+
Sbjct: 1257 EERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDL 1316

Query: 75   SSHAERIDAIRE 40
            ++  ++++++ E
Sbjct: 1317 AALGDKVNSLGE 1328



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 21/57 (36%), Positives = 33/57 (57%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KL E +   Q+N   + +E W+ E E  L ++DYG+DL+SVQ L  K    +A + +
Sbjct: 2005 KLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQA 2061



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
            D   +   ++KHQ  + E+  ++PR+  +T  G  ++E  HFA   + +++ EL   WE 
Sbjct: 849  DLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEA 908

Query: 269  LVQSSS*R 246
            L   +S R
Sbjct: 909  LKAKASQR 916



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 23/73 (31%), Positives = 44/73 (60%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           L+  KL+++ + Q + R  E++E W+ E + Q+ S++  KD T++Q   +KH   EA+V 
Sbjct: 69  LRRQKLEDSYRFQFFQRDAEELEKWIQE-KLQIASDENYKDPTNLQGKLQKHQAFEAEVQ 127

Query: 72  SHAERIDAIREPG 34
           +++  I  + E G
Sbjct: 128 ANSGAIVKLDETG 140



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 21/70 (30%), Positives = 42/70 (60%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L ++   QQ+ R  ++++ W++E       E Y KD +++Q   +KH   EA++S++  
Sbjct: 602 QLADSFHLQQFFRDSDELKSWVNEKMKTATDEAY-KDPSNLQGKVQKHQAFEAELSANQS 660

Query: 60  RIDAIREPGR 31
           RIDA+ + G+
Sbjct: 661 RIDALEKAGQ 670



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/72 (27%), Positives = 39/72 (54%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L+++ ++    R   +++ W++E E  L SE+ G DL  V+ LQKK    + D+
Sbjct: 1115 EKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDL 1174

Query: 75   SSHAERIDAIRE 40
             ++  R+  I +
Sbjct: 1175 KANESRLKDINK 1186



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 21/65 (32%), Positives = 35/65 (53%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L +  + Q ++R  E  E W++  E  L +ED G  L SV+ L KKH   +  ++   E+
Sbjct: 1475 LDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEK 1534

Query: 57   IDAIR 43
            I A++
Sbjct: 1535 IAALQ 1539



 Score = 38.7 bits (86), Expect = 0.016
 Identities = 21/68 (30%), Positives = 34/68 (50%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A+DD   D TN+    +KH   E ++ A++ R+D IT   ++  +  HF    I  + E 
Sbjct: 736 ASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEA 795

Query: 290 LGGIWERL 267
           L   +E L
Sbjct: 796 LVARYEAL 803



 Score = 38.7 bits (86), Expect = 0.016
 Identities = 17/67 (25%), Positives = 36/67 (53%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            T+D      ++   ++KH++F++ +   + ++  + A   +L+   H+A+  ISSR  E+
Sbjct: 1504 TEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGDISSRRNEV 1563

Query: 287  GGIWERL 267
               W RL
Sbjct: 1564 LDRWRRL 1570



 Score = 37.1 bits (82), Expect = 0.047
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A+DD   D  ++   ++KH+  E++L A + +V  + A   RL +    +  QI  + EE
Sbjct: 313 ASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSATQIQVKREE 372

Query: 290 LGGIWERL 267
           L   WE++
Sbjct: 373 LITNWEQI 380



 Score = 37.1 bits (82), Expect = 0.047
 Identities = 19/74 (25%), Positives = 37/74 (50%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            ++D   D T +    +KH+  E EL A++P +  +   GK+L +     + +I  R+ + 
Sbjct: 1823 SEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQF 1882

Query: 287  GGIWERLVQSSS*R 246
               W+ L Q ++ R
Sbjct: 1883 VEHWKELKQLAAAR 1896



 Score = 36.7 bits (81), Expect = 0.063
 Identities = 15/52 (28%), Positives = 32/52 (61%)
 Frame = -1

Query: 437  LNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGG 282
            + G ++KH+ FE +   +K RV+++   G+ L++  +  +  ISS+++ L G
Sbjct: 1939 IQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNG 1990



 Score = 35.9 bits (79), Expect = 0.11
 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 1/86 (1%)
 Frame = -1

Query: 497  LGKRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQA-NKPRVDEITAVGKRLLELEHFA 321
            +G++E+    TDD   D +++   + K + F+  LQA  +  +  ITA+  +LL  +H  
Sbjct: 2026 IGEKEN-SLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHVQ 2084

Query: 320  QPQISSRVEELGGIWERLVQSSS*RE 243
               I +R   L   W +L+ +S+ R+
Sbjct: 2085 SKAIEARHASLMKRWSQLLANSAARK 2110



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 15/70 (21%), Positives = 35/70 (50%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL ++   Q++     D+  W++ + G + S++  KD+T  + L ++H     ++ + A 
Sbjct: 1368 KLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAG 1427

Query: 60   RIDAIREPGR 31
               A  + G+
Sbjct: 1428 TFQAFEQFGQ 1437



 Score = 33.1 bits (72), Expect = 0.77
 Identities = 11/46 (23%), Positives = 28/46 (60%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           ++KH++FE+ L A + ++  +     +L++  H+A   +++R + L
Sbjct: 540 LKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRRDAL 585



 Score = 33.1 bits (72), Expect = 0.77
 Identities = 15/61 (24%), Positives = 29/61 (47%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            ++D+   D T     +++HQ    E+ A           G++LL   H+A P+I  +++ 
Sbjct: 1397 SSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDI 1456

Query: 290  L 288
            L
Sbjct: 1457 L 1457



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 16/67 (23%), Positives = 32/67 (47%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            TD+   D  ++    +KH+ FE++L A   +V+ +    +RL++    +   +  +  EL
Sbjct: 1292 TDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTEL 1351

Query: 287  GGIWERL 267
               W  L
Sbjct: 1352 NQAWSSL 1358


>AB191262-1|BAD52438.1| 2452|Homo sapiens non-erythrocytic spectrin
           alpha protein.
          Length = 2452

 Score =  116 bits (279), Expect = 6e-26
 Identities = 55/70 (78%), Positives = 62/70 (88%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           ELKG KL+EA QQQQ+NR VEDIELWL EVEG L S+DYGKDLT+VQNLQKKHALLEADV
Sbjct: 668 ELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADV 727

Query: 75  SSHAERIDAI 46
           ++H +RID I
Sbjct: 728 AAHQDRIDGI 737



 Score = 88.6 bits (210), Expect = 1e-17
 Identities = 39/65 (60%), Positives = 49/65 (75%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K  KL+EA +QQ +N  ++D + WLSEVE  L SEDYGKDL SV NL KKH LLEAD+S+
Sbjct: 1630 KSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISA 1689

Query: 69   HAERI 55
            H +R+
Sbjct: 1690 HEDRL 1694



 Score = 85.4 bits (202), Expect = 1e-16
 Identities = 33/77 (42%), Positives = 59/77 (76%)
 Frame = -1

Query: 485 ES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQIS 306
           E  K ATD++Y DP+NL GKVQKHQ FE EL AN+ R+D +   G++L+++ H+A+ +++
Sbjct: 591 EKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVA 650

Query: 305 SRVEELGGIWERLVQSS 255
           +R+ E+  +W++L++++
Sbjct: 651 ARMNEVISLWKKLLEAT 667



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 32/76 (42%), Positives = 48/76 (63%)
 Frame = -1

Query: 488 RES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQI 309
           +E  + A+D++Y DPTNL GK+QKHQ FE E+QAN   + ++   G  ++   HFA   I
Sbjct: 61  QEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETI 120

Query: 308 SSRVEELGGIWERLVQ 261
            +R+ EL   WE L++
Sbjct: 121 RTRLMELHRQWELLLE 136



 Score = 66.5 bits (155), Expect = 7e-11
 Identities = 31/73 (42%), Positives = 48/73 (65%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL E+ +  Q+ R ++D E W+ E +  + SEDYG+DLT VQNL+KKH  LEA++++H  
Sbjct: 1739 KLNESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELAAHEP 1798

Query: 60   RIDAIREPGRASS 22
             I  + + G+  S
Sbjct: 1799 AIQGVLDTGKKLS 1811



 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 32/71 (45%), Positives = 43/71 (60%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           KL ++ + QQ  R VED E W+ E E    S + GKDL  VQNL KKH  L+A+++ H  
Sbjct: 779 KLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEP 838

Query: 60  RIDAIREPGRA 28
           RI A+ + G A
Sbjct: 839 RIKAVTQKGNA 849



 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 31/75 (41%), Positives = 44/75 (58%), Gaps = 2/75 (2%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFA--QPQISSRV 297
            A+D+SY DPTN+  K QKHQ FE EL AN  R+  +  +G  L+E    A  +  + +R+
Sbjct: 1554 ASDESYKDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARL 1613

Query: 296  EELGGIWERLVQSSS 252
              L   W+ LVQ S+
Sbjct: 1614 AALADQWQFLVQKSA 1628



 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 26/73 (35%), Positives = 44/73 (60%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +G +L+E+ + QQ+   VE+ E W++E    + SEDYG  L ++Q L KKH   E D + 
Sbjct: 1842 RGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTV 1901

Query: 69   HAERIDAIREPGR 31
            H +R++ +   G+
Sbjct: 1902 HKDRVNDVCTNGQ 1914



 Score = 57.2 bits (132), Expect = 4e-08
 Identities = 28/74 (37%), Positives = 48/74 (64%)
 Frame = -3

Query: 267 GAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALL 88
           G   + +G KL  AA+ Q++NR V++   W+ E E  + S+D+G+DL SVQ L +KH  L
Sbjct: 242 GLALQRQG-KLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGL 300

Query: 87  EADVSSHAERIDAI 46
           E D+++  +++ A+
Sbjct: 301 ERDLAALEDKVKAL 314



 Score = 56.8 bits (131), Expect = 5e-08
 Identities = 26/70 (37%), Positives = 44/70 (62%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG KL +A +  QY R  ED+  W+++ E  + SE+ G+DL  V+ LQKK    + D+++
Sbjct: 141 KGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAA 200

Query: 69  HAERIDAIRE 40
           H ER++ + +
Sbjct: 201 HEERVNEVNQ 210



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/70 (38%), Positives = 41/70 (58%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L+++ Q QQY     + E W+ E E  + S DYGKD  S + L KKH  L +D+S++   
Sbjct: 886  LEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSS 945

Query: 57   IDAIREPGRA 28
            I A+RE  ++
Sbjct: 946  IQALREQAQS 955



 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 27/74 (36%), Positives = 49/74 (66%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K +KL E+   QQ++R V++IE W+SE + Q  S++  KD T++Q+  +KH   EA++ +
Sbjct: 1523 KRSKLGESQTLQQFSRDVDEIEAWISE-KLQTASDESYKDPTNIQSKHQKHQAFEAELHA 1581

Query: 69   HAERIDAIREPGRA 28
            +A+RI  + + G +
Sbjct: 1582 NADRIRGVIDMGNS 1595



 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 26/74 (35%), Positives = 43/74 (58%)
 Frame = -3

Query: 261 VFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEA 82
           ++EL+  + ++    Q + R  E ++ W+S+ E  LL+ED G  L SV+ L KKH   E 
Sbjct: 455 LWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEK 514

Query: 81  DVSSHAERIDAIRE 40
            +S+  E+I A+ E
Sbjct: 515 SLSAQEEKITALDE 528



 Score = 50.0 bits (114), Expect = 6e-06
 Identities = 22/72 (30%), Positives = 44/72 (61%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L  A + Q+++R  ++ + W+ E    L +++YG DL SVQ LQ+KH   E D+
Sbjct: 1203 EERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDL 1262

Query: 75   SSHAERIDAIRE 40
            ++  ++++++ E
Sbjct: 1263 AALGDKVNSLGE 1274



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 21/57 (36%), Positives = 33/57 (57%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KL E +   Q+N   + +E W+ E E  L ++DYG+DL+SVQ L  K    +A + +
Sbjct: 1951 KLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQA 2007



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
            D   +   ++KHQ  + E+  ++PR+  +T  G  ++E  HFA   + +++ EL   WE 
Sbjct: 815  DLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEA 874

Query: 269  LVQSSS*R 246
            L   +S R
Sbjct: 875  LKAKASQR 882



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 23/73 (31%), Positives = 44/73 (60%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           L+  KL+++ + Q + R  E++E W+ E + Q+ S++  KD T++Q   +KH   EA+V 
Sbjct: 35  LRRQKLEDSYRFQFFQRDAEELEKWIQE-KLQIASDENYKDPTNLQGKLQKHQAFEAEVQ 93

Query: 72  SHAERIDAIREPG 34
           +++  I  + E G
Sbjct: 94  ANSGAIVKLDETG 106



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 21/70 (30%), Positives = 42/70 (60%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L ++   QQ+ R  ++++ W++E       E Y KD +++Q   +KH   EA++S++  
Sbjct: 568 QLADSFHLQQFFRDSDELKSWVNEKMKTATDEAY-KDPSNLQGKVQKHQAFEAELSANQS 626

Query: 60  RIDAIREPGR 31
           RIDA+ + G+
Sbjct: 627 RIDALEKAGQ 636



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/72 (27%), Positives = 39/72 (54%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L+++ ++    R   +++ W++E E  L SE+ G DL  V+ LQKK    + D+
Sbjct: 1061 EKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDL 1120

Query: 75   SSHAERIDAIRE 40
             ++  R+  I +
Sbjct: 1121 KANESRLKDINK 1132



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 21/65 (32%), Positives = 35/65 (53%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L +  + Q ++R  E  E W++  E  L +ED G  L SV+ L KKH   +  ++   E+
Sbjct: 1421 LDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEK 1480

Query: 57   IDAIR 43
            I A++
Sbjct: 1481 IAALQ 1485



 Score = 38.7 bits (86), Expect = 0.016
 Identities = 21/68 (30%), Positives = 34/68 (50%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A+DD   D TN+    +KH   E ++ A++ R+D IT   ++  +  HF    I  + E 
Sbjct: 702 ASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEA 761

Query: 290 LGGIWERL 267
           L   +E L
Sbjct: 762 LVARYEAL 769



 Score = 38.7 bits (86), Expect = 0.016
 Identities = 17/67 (25%), Positives = 36/67 (53%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            T+D      ++   ++KH++F++ +   + ++  + A   +L+   H+A+  ISSR  E+
Sbjct: 1450 TEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGDISSRRNEV 1509

Query: 287  GGIWERL 267
               W RL
Sbjct: 1510 LDRWRRL 1516



 Score = 37.1 bits (82), Expect = 0.047
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A+DD   D  ++   ++KH+  E++L A + +V  + A   RL +    +  QI  + EE
Sbjct: 279 ASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSATQIQVKREE 338

Query: 290 LGGIWERL 267
           L   WE++
Sbjct: 339 LITNWEQI 346



 Score = 37.1 bits (82), Expect = 0.047
 Identities = 19/74 (25%), Positives = 37/74 (50%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            ++D   D T +    +KH+  E EL A++P +  +   GK+L +     + +I  R+ + 
Sbjct: 1769 SEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQF 1828

Query: 287  GGIWERLVQSSS*R 246
               W+ L Q ++ R
Sbjct: 1829 VEHWKELKQLAAAR 1842



 Score = 36.7 bits (81), Expect = 0.063
 Identities = 15/52 (28%), Positives = 32/52 (61%)
 Frame = -1

Query: 437  LNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGG 282
            + G ++KH+ FE +   +K RV+++   G+ L++  +  +  ISS+++ L G
Sbjct: 1885 IQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNG 1936



 Score = 35.9 bits (79), Expect = 0.11
 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 1/86 (1%)
 Frame = -1

Query: 497  LGKRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQA-NKPRVDEITAVGKRLLELEHFA 321
            +G++E+    TDD   D +++   + K + F+  LQA  +  +  ITA+  +LL  +H  
Sbjct: 1972 IGEKEN-SLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHVQ 2030

Query: 320  QPQISSRVEELGGIWERLVQSSS*RE 243
               I +R   L   W +L+ +S+ R+
Sbjct: 2031 SKAIEARHASLMKRWSQLLANSAARK 2056



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 15/70 (21%), Positives = 35/70 (50%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL ++   Q++     D+  W++ + G + S++  KD+T  + L ++H     ++ + A 
Sbjct: 1314 KLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAG 1373

Query: 60   RIDAIREPGR 31
               A  + G+
Sbjct: 1374 TFQAFEQFGQ 1383



 Score = 33.1 bits (72), Expect = 0.77
 Identities = 11/46 (23%), Positives = 28/46 (60%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           ++KH++FE+ L A + ++  +     +L++  H+A   +++R + L
Sbjct: 506 LKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRRDAL 551



 Score = 33.1 bits (72), Expect = 0.77
 Identities = 15/61 (24%), Positives = 29/61 (47%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            ++D+   D T     +++HQ    E+ A           G++LL   H+A P+I  +++ 
Sbjct: 1343 SSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDI 1402

Query: 290  L 288
            L
Sbjct: 1403 L 1403



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 16/67 (23%), Positives = 32/67 (47%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            TD+   D  ++    +KH+ FE++L A   +V+ +    +RL++    +   +  +  EL
Sbjct: 1238 TDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTEL 1297

Query: 287  GGIWERL 267
               W  L
Sbjct: 1298 NQAWSSL 1304


>J05243-1|AAA51790.1| 2472|Homo sapiens SPTAN1 protein.
          Length = 2472

 Score =  116 bits (278), Expect = 8e-26
 Identities = 54/70 (77%), Positives = 62/70 (88%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           ELKG KL+EA QQQQ+NR VEDIELWL EVEG L S+DYGKDLT+VQNLQKKHALLEADV
Sbjct: 668 ELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADV 727

Query: 75  SSHAERIDAI 46
           ++H +RID +
Sbjct: 728 AAHQDRIDGV 737



 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 40/65 (61%), Positives = 49/65 (75%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K  KL+EA +QQ +N  ++DI  WLSEVE  L SEDYGKDL SV NL KKH LLEAD+S+
Sbjct: 1650 KSQKLKEANKQQNFNTGIKDIAFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISA 1709

Query: 69   HAERI 55
            H +R+
Sbjct: 1710 HEDRL 1714



 Score = 85.4 bits (202), Expect = 1e-16
 Identities = 33/77 (42%), Positives = 59/77 (76%)
 Frame = -1

Query: 485 ES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQIS 306
           E  K ATD++Y DP+NL GKVQKHQ FE EL AN+ R+D +   G++L+++ H+A+ +++
Sbjct: 591 EKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVA 650

Query: 305 SRVEELGGIWERLVQSS 255
           +R+ E+  +W++L++++
Sbjct: 651 ARMNEVISLWKKLLEAT 667



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 32/76 (42%), Positives = 48/76 (63%)
 Frame = -1

Query: 488 RES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQI 309
           +E  + A+D++Y DPTNL GK+QKHQ FE E+QAN   + ++   G  ++   HFA   I
Sbjct: 61  QEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETI 120

Query: 308 SSRVEELGGIWERLVQ 261
            +R+ EL   WE L++
Sbjct: 121 RTRLMELHRQWELLLE 136



 Score = 66.5 bits (155), Expect = 7e-11
 Identities = 31/73 (42%), Positives = 48/73 (65%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL E+ +  Q+ R ++D E W+ E +  + SEDYG+DLT VQNL+KKH  LEA++++H  
Sbjct: 1759 KLNESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELAAHEP 1818

Query: 60   RIDAIREPGRASS 22
             I  + + G+  S
Sbjct: 1819 AIQGVLDTGKKLS 1831



 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 32/71 (45%), Positives = 43/71 (60%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           KL ++ + QQ  R VED E W+ E E    S + GKDL  VQNL KKH  L+A+++ H  
Sbjct: 779 KLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEP 838

Query: 60  RIDAIREPGRA 28
           RI A+ + G A
Sbjct: 839 RIKAVTQKGNA 849



 Score = 59.7 bits (138), Expect = 8e-09
 Identities = 31/75 (41%), Positives = 44/75 (58%), Gaps = 2/75 (2%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFA--QPQISSRV 297
            A+D+SY DPTN+  K QKHQ FE EL AN  R+  +  +G  L+E    A  +  + +R+
Sbjct: 1574 ASDESYKDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGNEDAVKARL 1633

Query: 296  EELGGIWERLVQSSS 252
              L   W+ LVQ S+
Sbjct: 1634 AALADQWQFLVQKSA 1648



 Score = 57.2 bits (132), Expect = 4e-08
 Identities = 28/74 (37%), Positives = 48/74 (64%)
 Frame = -3

Query: 267 GAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALL 88
           G   + +G KL  AA+ Q++NR V++   W+ E E  + S+D+G+DL SVQ L +KH  L
Sbjct: 242 GLALQRQG-KLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGL 300

Query: 87  EADVSSHAERIDAI 46
           E D+++  +++ A+
Sbjct: 301 ERDLAALEDKVKAL 314



 Score = 56.4 bits (130), Expect = 7e-08
 Identities = 26/70 (37%), Positives = 43/70 (61%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG KL +A    QY R  ED+  W+++ E  + SE+ G+DL  V+ LQKK    + D+++
Sbjct: 141 KGIKLLQAQNLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAA 200

Query: 69  HAERIDAIRE 40
           H ER++ + +
Sbjct: 201 HEERVNEVNQ 210



 Score = 56.4 bits (130), Expect = 7e-08
 Identities = 25/73 (34%), Positives = 43/73 (58%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +G +L+E+ + QQ+   VE+ E W++E    + SEDYG  L ++Q L KKH   E   + 
Sbjct: 1862 RGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETAFTV 1921

Query: 69   HAERIDAIREPGR 31
            H +R++ +   G+
Sbjct: 1922 HKDRVNDVCTNGQ 1934



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/70 (38%), Positives = 41/70 (58%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L+++ Q QQY     + E W+ E E  + S DYGKD  S + L KKH  L +D+S++   
Sbjct: 886  LEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSS 945

Query: 57   IDAIREPGRA 28
            I A+RE  ++
Sbjct: 946  IQALREQAQS 955



 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 27/74 (36%), Positives = 49/74 (66%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K +KL E+   QQ++R V++IE W+SE + Q  S++  KD T++Q+  +KH   EA++ +
Sbjct: 1543 KRSKLGESQTLQQFSRDVDEIEAWISE-KLQTASDESYKDPTNIQSKHQKHQAFEAELHA 1601

Query: 69   HAERIDAIREPGRA 28
            +A+RI  + + G +
Sbjct: 1602 NADRIRGVIDMGNS 1615



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 26/74 (35%), Positives = 43/74 (58%)
 Frame = -3

Query: 261 VFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEA 82
           ++EL+  + ++    Q + R  E ++ W+S+ E  LL+ED G  L SV+ L KKH   E 
Sbjct: 455 LWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDFLDSVEALLKKHEDFEK 514

Query: 81  DVSSHAERIDAIRE 40
            +S+  E+I A+ E
Sbjct: 515 SLSAQEEKITALDE 528



 Score = 50.0 bits (114), Expect = 6e-06
 Identities = 22/72 (30%), Positives = 44/72 (61%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L  A + Q+++R  ++ + W+ E    L +++YG DL SVQ LQ+KH   E D+
Sbjct: 1223 EERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDL 1282

Query: 75   SSHAERIDAIRE 40
            ++  ++++++ E
Sbjct: 1283 AALGDKVNSLGE 1294



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
            D   +   ++KHQ  + E+  ++PR+  +T  G  ++E  HFA   + +++ EL   WE 
Sbjct: 815  DLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEA 874

Query: 269  LVQSSS*R 246
            L   +S R
Sbjct: 875  LKAKASQR 882



 Score = 44.8 bits (101), Expect = 2e-04
 Identities = 24/77 (31%), Positives = 40/77 (51%)
 Frame = -3

Query: 300  RGRAGRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTS 121
            +G  G+      A  + K N + E +   Q+N   + +E W+ E E  L ++DYG+DL+S
Sbjct: 1952 KGLNGKVSDLEKAAAQRKAN-VDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSS 2010

Query: 120  VQNLQKKHALLEADVSS 70
            VQ L  K    +A + +
Sbjct: 2011 VQTLLTKQETFDAGLQA 2027



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 23/73 (31%), Positives = 44/73 (60%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           L+  KL+++ + Q + R  E++E W+ E + Q+ S++  KD T++Q   +KH   EA+V 
Sbjct: 35  LRRQKLEDSYRFQFFQRDAEELEKWIQE-KLQIASDENYKDPTNLQGKLQKHQAFEAEVQ 93

Query: 72  SHAERIDAIREPG 34
           +++  I  + E G
Sbjct: 94  ANSGAIVKLDETG 106



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 21/70 (30%), Positives = 42/70 (60%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L ++   QQ+ R  ++++ W++E       E Y KD +++Q   +KH   EA++S++  
Sbjct: 568 QLADSFHLQQFFRDSDELKSWVNEKMKTATDEAY-KDPSNLQGKVQKHQAFEAELSANQS 626

Query: 60  RIDAIREPGR 31
           RIDA+ + G+
Sbjct: 627 RIDALEKAGQ 636



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/72 (27%), Positives = 39/72 (54%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L+++ ++    R   +++ W++E E  L SE+ G DL  V+ LQKK    + D+
Sbjct: 1081 EKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDL 1140

Query: 75   SSHAERIDAIRE 40
             ++  R+  I +
Sbjct: 1141 KANESRLKDINK 1152



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 21/65 (32%), Positives = 35/65 (53%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L +  + Q ++R  E  E W++  E  L +ED G  L SV+ L KKH   +  ++   E+
Sbjct: 1441 LDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEK 1500

Query: 57   IDAIR 43
            I A++
Sbjct: 1501 IAALQ 1505



 Score = 38.7 bits (86), Expect = 0.016
 Identities = 17/67 (25%), Positives = 36/67 (53%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            T+D      ++   ++KH++F++ +   + ++  + A   +L+   H+A+  ISSR  E+
Sbjct: 1470 TEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGDISSRRNEV 1529

Query: 287  GGIWERL 267
               W RL
Sbjct: 1530 LDRWRRL 1536



 Score = 38.3 bits (85), Expect = 0.021
 Identities = 20/68 (29%), Positives = 34/68 (50%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A+DD   D TN+    +KH   E ++ A++ R+D +T   ++  +  HF    I  + E 
Sbjct: 702 ASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGVTIQARQFQDAGHFDAENIKKKQEA 761

Query: 290 LGGIWERL 267
           L   +E L
Sbjct: 762 LVARYEAL 769



 Score = 37.1 bits (82), Expect = 0.047
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A+DD   D  ++   ++KH+  E++L A + +V  + A   RL +    +  QI  + EE
Sbjct: 279 ASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSATQIQVKREE 338

Query: 290 LGGIWERL 267
           L   WE++
Sbjct: 339 LITNWEQI 346



 Score = 37.1 bits (82), Expect = 0.047
 Identities = 19/74 (25%), Positives = 37/74 (50%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            ++D   D T +    +KH+  E EL A++P +  +   GK+L +     + +I  R+ + 
Sbjct: 1789 SEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQF 1848

Query: 287  GGIWERLVQSSS*R 246
               W+ L Q ++ R
Sbjct: 1849 VEHWKELKQLAAAR 1862



 Score = 35.9 bits (79), Expect = 0.11
 Identities = 17/67 (25%), Positives = 39/67 (58%)
 Frame = -1

Query: 437  LNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQS 258
            + G ++KH+ FE     +K RV+++   G+ L++  +  +  ISS+++ L G    L ++
Sbjct: 1905 IQGLLKKHEAFETAFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKA 1964

Query: 257  SS*RETS 237
            ++ R+ +
Sbjct: 1965 AAQRKAN 1971



 Score = 35.9 bits (79), Expect = 0.11
 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 1/86 (1%)
 Frame = -1

Query: 497  LGKRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQA-NKPRVDEITAVGKRLLELEHFA 321
            +G++E+    TDD   D +++   + K + F+  LQA  +  +  ITA+  +LL  +H  
Sbjct: 1992 IGEKEN-SLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHVQ 2050

Query: 320  QPQISSRVEELGGIWERLVQSSS*RE 243
               I +R   L   W +L+ +S+ R+
Sbjct: 2051 SKAIEARHASLMKRWSQLLANSAARK 2076



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 15/70 (21%), Positives = 35/70 (50%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL ++   Q++     D+  W++ + G + S++  KD+T  + L ++H     ++ + A 
Sbjct: 1334 KLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAG 1393

Query: 60   RIDAIREPGR 31
               A  + G+
Sbjct: 1394 TFQAFEQFGQ 1403



 Score = 33.1 bits (72), Expect = 0.77
 Identities = 11/46 (23%), Positives = 28/46 (60%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           ++KH++FE+ L A + ++  +     +L++  H+A   +++R + L
Sbjct: 506 LKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRRDAL 551



 Score = 33.1 bits (72), Expect = 0.77
 Identities = 15/61 (24%), Positives = 29/61 (47%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            ++D+   D T     +++HQ    E+ A           G++LL   H+A P+I  +++ 
Sbjct: 1363 SSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDI 1422

Query: 290  L 288
            L
Sbjct: 1423 L 1423



 Score = 31.1 bits (67), Expect = 3.1
 Identities = 16/67 (23%), Positives = 31/67 (46%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            TD+   D  ++    +KH+ FE++L A   +V+ +    +RL +    +   +  +  EL
Sbjct: 1258 TDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLTQSHPESAEDLQEKCTEL 1317

Query: 287  GGIWERL 267
               W  L
Sbjct: 1318 NQAWSSL 1324


>M24773-1|AAA52468.1|  920|Homo sapiens alpha-fodrin protein.
          Length = 920

 Score =  105 bits (251), Expect = 2e-22
 Identities = 48/62 (77%), Positives = 55/62 (88%)
 Frame = -3

Query: 231 EAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERID 52
           EA QQQQ+NR VEDIELWL EVEG L S+DYGKDLT+VQNLQKKHALLEADV++H +RID
Sbjct: 1   EANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRID 60

Query: 51  AI 46
            +
Sbjct: 61  GV 62



 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 32/71 (45%), Positives = 43/71 (60%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           KL ++ + QQ  R VED E W+ E E    S + GKDL  VQNL KKH  L+A+++ H  
Sbjct: 104 KLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEP 163

Query: 60  RIDAIREPGRA 28
           RI A+ + G A
Sbjct: 164 RIKAVTQKGNA 174



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/70 (38%), Positives = 41/70 (58%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L+++ Q QQY     + E W+ E E  + S DYGKD  S + L KKH  L +D+S++   
Sbjct: 211 LEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSS 270

Query: 57  IDAIREPGRA 28
           I A+RE  ++
Sbjct: 271 IQALREQAQS 280



 Score = 50.0 bits (114), Expect = 6e-06
 Identities = 22/72 (30%), Positives = 44/72 (61%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E +   L  A + Q+++R  ++ + W+ E    L +++YG DL SVQ LQ+KH   E D+
Sbjct: 548 EERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDL 607

Query: 75  SSHAERIDAIRE 40
           ++  ++++++ E
Sbjct: 608 AALGDKVNSLGE 619



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = -1

Query: 449 DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
           D   +   ++KHQ  + E+  ++PR+  +T  G  ++E  HFA   + +++ EL   WE 
Sbjct: 140 DLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEA 199

Query: 269 LVQSSS*R 246
           L   +S R
Sbjct: 200 LKAKASQR 207



 Score = 42.3 bits (95), Expect = 0.001
 Identities = 21/51 (41%), Positives = 35/51 (68%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
            K +KL E+   QQ++R V++IE W+SE + Q  S++  KD T++Q+  +KH
Sbjct: 868  KRSKLGESQTLQQFSRDVDEIEAWISE-KLQTASDESYKDPTNIQSKHQKH 917



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/72 (27%), Positives = 39/72 (54%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E +   L+++ ++    R   +++ W++E E  L SE+ G DL  V+ LQKK    + D+
Sbjct: 406 EKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDL 465

Query: 75  SSHAERIDAIRE 40
            ++  R+  I +
Sbjct: 466 KANESRLKDINK 477



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 21/65 (32%), Positives = 35/65 (53%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L +  + Q ++R  E  E W++  E  L +ED G  L SV+ L KKH   +  ++   E+
Sbjct: 766 LDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEK 825

Query: 57  IDAIR 43
           I A++
Sbjct: 826 IAALQ 830



 Score = 38.7 bits (86), Expect = 0.016
 Identities = 17/67 (25%), Positives = 36/67 (53%)
 Frame = -1

Query: 467 TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           T+D      ++   ++KH++F++ +   + ++  + A   +L+   H+A+  ISSR  E+
Sbjct: 795 TEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGDISSRRNEV 854

Query: 287 GGIWERL 267
              W RL
Sbjct: 855 LDRWRRL 861



 Score = 38.3 bits (85), Expect = 0.021
 Identities = 20/68 (29%), Positives = 34/68 (50%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A+DD   D TN+    +KH   E ++ A++ R+D +T   ++  +  HF    I  + E 
Sbjct: 27  ASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGVTIQARQFQDAGHFDAENIKKKQEA 86

Query: 290 LGGIWERL 267
           L   +E L
Sbjct: 87  LVARYEAL 94



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 15/70 (21%), Positives = 35/70 (50%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           KL ++   Q++     D+  W++ + G + S++  KD+T  + L ++H     ++ + A 
Sbjct: 659 KLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAG 718

Query: 60  RIDAIREPGR 31
              A  + G+
Sbjct: 719 TFQAFEQFGQ 728



 Score = 33.5 bits (73), Expect = 0.58
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQ 411
           A+D+SY DPTN+  K QKHQ
Sbjct: 899 ASDESYKDPTNIQSKHQKHQ 918



 Score = 33.1 bits (72), Expect = 0.77
 Identities = 15/61 (24%), Positives = 29/61 (47%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           ++D+   D T     +++HQ    E+ A           G++LL   H+A P+I  +++ 
Sbjct: 688 SSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDI 747

Query: 290 L 288
           L
Sbjct: 748 L 748



 Score = 31.1 bits (67), Expect = 3.1
 Identities = 16/67 (23%), Positives = 31/67 (46%)
 Frame = -1

Query: 467 TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           TD+   D  ++    +KH+ FE++L A   +V+ +    +RL +    +   +  +  EL
Sbjct: 583 TDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLTQSHPESAEDLQEKCTEL 642

Query: 287 GGIWERL 267
              W  L
Sbjct: 643 NQAWSSL 649


>M18627-1|AAA51702.1|  920|Homo sapiens SPTAN1 protein.
          Length = 920

 Score =  105 bits (251), Expect = 2e-22
 Identities = 48/62 (77%), Positives = 55/62 (88%)
 Frame = -3

Query: 231 EAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERID 52
           EA QQQQ+NR VEDIELWL EVEG L S+DYGKDLT+VQNLQKKHALLEADV++H +RID
Sbjct: 1   EANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRID 60

Query: 51  AI 46
            +
Sbjct: 61  GV 62



 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 32/71 (45%), Positives = 43/71 (60%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           KL ++ + QQ  R VED E W+ E E    S + GKDL  VQNL KKH  L+A+++ H  
Sbjct: 104 KLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEP 163

Query: 60  RIDAIREPGRA 28
           RI A+ + G A
Sbjct: 164 RIKAVTQKGNA 174



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/70 (38%), Positives = 41/70 (58%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L+++ Q QQY     + E W+ E E  + S DYGKD  S + L KKH  L +D+S++   
Sbjct: 211 LEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSS 270

Query: 57  IDAIREPGRA 28
           I A+RE  ++
Sbjct: 271 IQALREQAQS 280



 Score = 50.0 bits (114), Expect = 6e-06
 Identities = 22/72 (30%), Positives = 44/72 (61%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E +   L  A + Q+++R  ++ + W+ E    L +++YG DL SVQ LQ+KH   E D+
Sbjct: 548 EERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDL 607

Query: 75  SSHAERIDAIRE 40
           ++  ++++++ E
Sbjct: 608 AALGDKVNSLGE 619



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = -1

Query: 449 DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
           D   +   ++KHQ  + E+  ++PR+  +T  G  ++E  HFA   + +++ EL   WE 
Sbjct: 140 DLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEA 199

Query: 269 LVQSSS*R 246
           L   +S R
Sbjct: 200 LKAKASQR 207



 Score = 42.3 bits (95), Expect = 0.001
 Identities = 21/51 (41%), Positives = 35/51 (68%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
            K +KL E+   QQ++R V++IE W+SE + Q  S++  KD T++Q+  +KH
Sbjct: 868  KRSKLGESQTLQQFSRDVDEIEAWISE-KLQTASDESYKDPTNIQSKHQKH 917



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/72 (27%), Positives = 39/72 (54%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E +   L+++ ++    R   +++ W++E E  L SE+ G DL  V+ LQKK    + D+
Sbjct: 406 EKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDL 465

Query: 75  SSHAERIDAIRE 40
            ++  R+  I +
Sbjct: 466 KANESRLKDINK 477



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 21/65 (32%), Positives = 35/65 (53%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L +  + Q ++R  E  E W++  E  L +ED G  L SV+ L KKH   +  ++   E+
Sbjct: 766 LDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEK 825

Query: 57  IDAIR 43
           I A++
Sbjct: 826 IAALQ 830



 Score = 38.7 bits (86), Expect = 0.016
 Identities = 17/67 (25%), Positives = 36/67 (53%)
 Frame = -1

Query: 467 TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           T+D      ++   ++KH++F++ +   + ++  + A   +L+   H+A+  ISSR  E+
Sbjct: 795 TEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGDISSRRNEV 854

Query: 287 GGIWERL 267
              W RL
Sbjct: 855 LDRWRRL 861



 Score = 38.3 bits (85), Expect = 0.021
 Identities = 20/68 (29%), Positives = 34/68 (50%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A+DD   D TN+    +KH   E ++ A++ R+D +T   ++  +  HF    I  + E 
Sbjct: 27  ASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGVTIQARQFQDAGHFDAENIKKKQEA 86

Query: 290 LGGIWERL 267
           L   +E L
Sbjct: 87  LVARYEAL 94



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 15/70 (21%), Positives = 35/70 (50%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           KL ++   Q++     D+  W++ + G + S++  KD+T  + L ++H     ++ + A 
Sbjct: 659 KLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAG 718

Query: 60  RIDAIREPGR 31
              A  + G+
Sbjct: 719 TFQAFEQFGQ 728



 Score = 33.5 bits (73), Expect = 0.58
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQ 411
           A+D+SY DPTN+  K QKHQ
Sbjct: 899 ASDESYKDPTNIQSKHQKHQ 918



 Score = 33.1 bits (72), Expect = 0.77
 Identities = 15/61 (24%), Positives = 29/61 (47%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           ++D+   D T     +++HQ    E+ A           G++LL   H+A P+I  +++ 
Sbjct: 688 SSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDI 747

Query: 290 L 288
           L
Sbjct: 748 L 748



 Score = 31.1 bits (67), Expect = 3.1
 Identities = 16/67 (23%), Positives = 31/67 (46%)
 Frame = -1

Query: 467 TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           TD+   D  ++    +KH+ FE++L A   +V+ +    +RL +    +   +  +  EL
Sbjct: 583 TDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLTQSHPESAEDLQEKCTEL 642

Query: 287 GGIWERL 267
              W  L
Sbjct: 643 NQAWSSL 649


>M61877-1|AAA60577.1| 2429|Homo sapiens erythroid alpha spectrin
           protein.
          Length = 2429

 Score = 73.3 bits (172), Expect = 6e-13
 Identities = 32/70 (45%), Positives = 47/70 (67%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG +L EA QQ Q+    ED++ WL +VE Q+ SEDYGK L  VQN  +KH LLE+ V++
Sbjct: 679 KGTQLHEANQQLQFENNAEDLQRWLEDVEWQVTSEDYGKGLAEVQNRLRKHGLLESAVAA 738

Query: 69  HAERIDAIRE 40
             +++D + +
Sbjct: 739 RQDQVDILTD 748



 Score = 66.9 bits (156), Expect = 5e-11
 Identities = 28/79 (35%), Positives = 49/79 (62%)
 Frame = -1

Query: 476 KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRV 297
           K A D+ Y D  NL  +VQK Q FE+EL  NK +++ I   G+ ++E  H+A   +++R+
Sbjct: 603 KLADDEDYKDIQNLKSRVQKQQVFEKELAVNKTQLENIQKTGQEMIEGGHYASDNVTTRL 662

Query: 296 EELGGIWERLVQSSS*RET 240
            E+  +WE L++++  + T
Sbjct: 663 SEVASLWEELLEATKQKGT 681



 Score = 66.1 bits (154), Expect = 9e-11
 Identities = 32/70 (45%), Positives = 46/70 (65%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KG KL EA++QQ++N ++ D E WLSE E  L  +D  +DL S  NL KKH LLE ++ +
Sbjct: 1598 KGKKLNEASRQQRFNTSIRDFEFWLSEAETLLAMKDQARDLASAGNLLKKHQLLEREMLA 1657

Query: 69   HAERIDAIRE 40
               R DA+++
Sbjct: 1658 ---REDALKD 1664



 Score = 58.8 bits (136), Expect = 1e-08
 Identities = 29/81 (35%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = -1

Query: 497 LGK--RES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHF 324
           LGK   E     TD SY DPTN+ GK QKHQ+ E E+Q     + E+    +    + H 
Sbjct: 65  LGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHS 124

Query: 323 AQPQISSRVEELGGIWERLVQ 261
           A  +  + +EEL  +W+ L++
Sbjct: 125 AHEETKAHIEELRHLWDLLLE 145



 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 26/65 (40%), Positives = 40/65 (61%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL+EA    Q+ + ++D E W+ E   ++ S+DYG+DL  VQNL KKH  LE ++ +H  
Sbjct: 1707 KLKEAYALFQFFQDLDDEESWIEEKLIRVSSQDYGRDLQGVQNLLKKHKRLEGELVAHEP 1766

Query: 60   RIDAI 46
             I  +
Sbjct: 1767 AIQNV 1771



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/61 (36%), Positives = 35/61 (57%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L  AA  Q++ R V +   W+ E E  L SEDYGKDL + + L   H  LE +++  +++
Sbjct: 260 LSNAANLQRFKRDVTEAIQWIKEKEPVLTSEDYGKDLVASEGLFHSHKGLERNLAVMSDK 319

Query: 57  I 55
           +
Sbjct: 320 V 320



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +G KL+E+ +  Q+ +  E+ E W++E     +  D G  L + Q+L  KH  LE D + 
Sbjct: 1810 RGLKLEESLEYLQFMQNAEEEEAWINEKNALAVRGDCGDTLAATQSLLMKHEALENDFAV 1869

Query: 69   HAERIDAIREPG 34
            H  R+  +   G
Sbjct: 1870 HETRVQNVCAQG 1881



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 24/69 (34%), Positives = 34/69 (49%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           KL +    Q   R  ED E W+ E E    S   GKDL + + L  +H ++  +++SH  
Sbjct: 788 KLLDLLHLQLICRDTEDEEAWIQETEPSATSTYLGKDLIASKKLLNRHRVILENIASHEP 847

Query: 60  RIDAIREPG 34
           RI  I E G
Sbjct: 848 RIQEITERG 856



 Score = 43.6 bits (98), Expect = 5e-04
 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 1/99 (1%)
 Frame = -3

Query: 321  STSNIVSRGRA-GRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSE 145
            +  ++ SR ++  +NM +  A    + N L+   Q QQY   + + E W+ E E  + + 
Sbjct: 866  AAEDVASRVKSLNQNMESLRARAARRQNDLEANVQFQQYLADLHEAETWIREKEPIVDNT 925

Query: 144  DYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPGRA 28
            +YG D  +   L KKH     D++S  + + A+R    A
Sbjct: 926  NYGADEEAAGALLKKHEAFLLDLNSFGDSMKALRNQANA 964



 Score = 43.6 bits (98), Expect = 5e-04
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 1/88 (1%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQ-ISSRVE 294
            A D+SY D TN+  K  KHQ F  E+     +V  +  +G  L+E       + +  ++E
Sbjct: 1523 ACDESYKDATNIQRKYLKHQTFAHEVDGRSEQVHGVINLGNSLIERSCDGNEEAMKEQLE 1582

Query: 293  ELGGIWERLVQSSS*RETSCRKRLNNSS 210
            +L   W+ L++    R     K+LN +S
Sbjct: 1583 QLKEHWDHLLE----RTNDKGKKLNEAS 1606



 Score = 41.5 bits (93), Expect = 0.002
 Identities = 21/71 (29%), Positives = 37/71 (52%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL + A  +Q+ R +E++E W+SE+      E Y KD T++Q    KH     +V   +E
Sbjct: 1495 KLGDYANLKQFYRDLEELEEWISEMLPTACDESY-KDATNIQRKYLKHQTFAHEVDGRSE 1553

Query: 60   RIDAIREPGRA 28
            ++  +   G +
Sbjct: 1554 QVHGVINLGNS 1564



 Score = 40.3 bits (90), Expect = 0.005
 Identities = 19/70 (27%), Positives = 38/70 (54%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           +G KL+++   Q + R  +D+  W+ E    L  + Y +D T++Q   +KH  LEA+V +
Sbjct: 45  RGQKLEDSYHLQVFKRDADDLGKWIMEKVNILTDKSY-EDPTNIQGKYQKHQSLEAEVQT 103

Query: 69  HAERIDAIRE 40
            +  +  + +
Sbjct: 104 KSRLMSELEK 113



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 17/53 (32%), Positives = 32/53 (60%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
           + +H+   + + +++PR+ EIT  G +++E  HFA   ++SRV+ L    E L
Sbjct: 832 LNRHRVILENIASHEPRIQEITERGNKMVEEGHFAAEDVASRVKSLNQNMESL 884



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 17/66 (25%), Positives = 35/66 (53%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L EA +   +     D++ W+S + G + S++  +DLT ++ L ++H    AD+ + A  
Sbjct: 1285 LNEAQKFYLFLSKARDLQNWISSIGGMVSSQELAEDLTGIEILLERHQEHRADMEAEAPT 1344

Query: 57   IDAIRE 40
              A+ +
Sbjct: 1345 FQALED 1350



 Score = 34.3 bits (75), Expect = 0.33
 Identities = 17/52 (32%), Positives = 27/52 (51%)
 Frame = -3

Query: 210 YNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
           + R  E ++ W+S  E  L +ED G  L S + L +KH   E   ++  E+I
Sbjct: 481 FYRDSEQVDSWMSRQEAFLENEDLGNSLGSAEALLQKHEDFEEAFTAQEEKI 532



 Score = 33.5 bits (73), Expect = 0.58
 Identities = 18/70 (25%), Positives = 34/70 (48%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG++L  A + QQY +   DI  W+ + E    S + G+D    + L KK    + ++ +
Sbjct: 150 KGDQLLRALKFQQYVQECADILEWIGDKEAIATSVELGEDWERTEVLHKKFEDFQVELVA 209

Query: 69  HAERIDAIRE 40
              R+  + +
Sbjct: 210 KEGRVVEVNQ 219



 Score = 31.1 bits (67), Expect = 3.1
 Identities = 18/66 (27%), Positives = 33/66 (50%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L  A   + ++R  +D +  + +    L + D G DL SVQ LQ++H   E D+    ++
Sbjct: 1179 LGSAHAVEVFHREADDTKEQIEKKCQALSAADPGSDLFSVQALQRRHEGFERDLVPLGDK 1238

Query: 57   IDAIRE 40
            +  + E
Sbjct: 1239 VTILGE 1244



 Score = 29.5 bits (63), Expect = 9.5
 Identities = 17/67 (25%), Positives = 27/67 (40%)
 Frame = -1

Query: 467 TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           ++D   D     G    H+  E+ L     +V E+ A  ++L        PQI    E+L
Sbjct: 289 SEDYGKDLVASEGLFHSHKGLERNLAVMSDKVKELCAKAEKLTLSHPSDAPQIQEMKEDL 348

Query: 287 GGIWERL 267
              WE +
Sbjct: 349 VSSWEHI 355



 Score = 29.5 bits (63), Expect = 9.5
 Identities = 11/52 (21%), Positives = 25/52 (48%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVE 294
            D T +   +++HQ    +++A  P    +      L++  H A P+I  +++
Sbjct: 1320 DLTGIEILLERHQEHRADMEAEAPTFQALEDFSAELIDSGHHASPEIEKKLQ 1371


>M61826-1|AAA60994.1| 2429|Homo sapiens alpha-spectrin protein.
          Length = 2429

 Score = 73.3 bits (172), Expect = 6e-13
 Identities = 32/70 (45%), Positives = 47/70 (67%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG +L EA QQ Q+    ED++ WL +VE Q+ SEDYGK L  VQN  +KH LLE+ V++
Sbjct: 679 KGTQLHEANQQLQFENNAEDLQRWLEDVEWQVTSEDYGKGLAEVQNRLRKHGLLESAVAA 738

Query: 69  HAERIDAIRE 40
             +++D + +
Sbjct: 739 RQDQVDILTD 748



 Score = 66.9 bits (156), Expect = 5e-11
 Identities = 28/79 (35%), Positives = 49/79 (62%)
 Frame = -1

Query: 476 KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRV 297
           K A D+ Y D  NL  +VQK Q FE+EL  NK +++ I   G+ ++E  H+A   +++R+
Sbjct: 603 KLADDEDYKDIQNLKSRVQKQQVFEKELAVNKTQLENIQKTGQEMIEGGHYASDNVTTRL 662

Query: 296 EELGGIWERLVQSSS*RET 240
            E+  +WE L++++  + T
Sbjct: 663 SEVASLWEELLEATKQKGT 681



 Score = 66.1 bits (154), Expect = 9e-11
 Identities = 32/70 (45%), Positives = 46/70 (65%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KG KL EA++QQ++N ++ D E WLSE E  L  +D  +DL S  NL KKH LLE ++ +
Sbjct: 1598 KGKKLNEASRQQRFNTSIRDFEFWLSEAETLLAMKDQARDLASAGNLLKKHQLLEREMLA 1657

Query: 69   HAERIDAIRE 40
               R DA+++
Sbjct: 1658 ---REDALKD 1664



 Score = 58.8 bits (136), Expect = 1e-08
 Identities = 29/81 (35%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = -1

Query: 497 LGK--RES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHF 324
           LGK   E     TD SY DPTN+ GK QKHQ+ E E+Q     + E+    +    + H 
Sbjct: 65  LGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHS 124

Query: 323 AQPQISSRVEELGGIWERLVQ 261
           A  +  + +EEL  +W+ L++
Sbjct: 125 AHEETKAHIEELRHLWDLLLE 145



 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 26/65 (40%), Positives = 40/65 (61%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL+EA    Q+ + ++D E W+ E   ++ S+DYG+DL  VQNL KKH  LE ++ +H  
Sbjct: 1707 KLKEAYALFQFFQDLDDEESWIEEKLIRVSSQDYGRDLQGVQNLLKKHKRLEGELVAHEP 1766

Query: 60   RIDAI 46
             I  +
Sbjct: 1767 AIQNV 1771



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/61 (36%), Positives = 35/61 (57%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L  AA  Q++ R V +   W+ E E  L SEDYGKDL + + L   H  LE +++  +++
Sbjct: 260 LSNAANLQRFKRDVTEAIQWIKEKEPVLTSEDYGKDLVASEGLFHSHKGLERNLAVMSDK 319

Query: 57  I 55
           +
Sbjct: 320 V 320



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +G KL+E+ +  Q+ +  E+ E W++E     +  D G  L + Q+L  KH  LE D + 
Sbjct: 1810 RGLKLEESLEYLQFMQNAEEEEAWINEKNALAVRGDCGDTLAATQSLLMKHEALENDFAV 1869

Query: 69   HAERIDAIREPG 34
            H  R+  +   G
Sbjct: 1870 HETRVQNVCAQG 1881



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 24/69 (34%), Positives = 34/69 (49%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           KL +    Q   R  ED E W+ E E    S   GKDL + + L  +H ++  +++SH  
Sbjct: 788 KLLDLLHLQLICRDTEDEEAWIQETEPSATSTYLGKDLIASKKLLNRHRVILENIASHEP 847

Query: 60  RIDAIREPG 34
           RI  I E G
Sbjct: 848 RIQEITERG 856



 Score = 43.6 bits (98), Expect = 5e-04
 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 1/99 (1%)
 Frame = -3

Query: 321  STSNIVSRGRA-GRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSE 145
            +  ++ SR ++  +NM +  A    + N L+   Q QQY   + + E W+ E E  + + 
Sbjct: 866  AAEDVASRVKSLNQNMESLRARAARRQNDLEANVQFQQYLADLHEAETWIREKEPIVDNT 925

Query: 144  DYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPGRA 28
            +YG D  +   L KKH     D++S  + + A+R    A
Sbjct: 926  NYGADEEAAGALLKKHEAFLLDLNSFGDSMKALRNQANA 964



 Score = 43.6 bits (98), Expect = 5e-04
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 1/88 (1%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQ-ISSRVE 294
            A D+SY D TN+  K  KHQ F  E+     +V  +  +G  L+E       + +  ++E
Sbjct: 1523 ACDESYKDATNIQRKYLKHQTFAHEVDGRSEQVHGVINLGNSLIERSCDGNEEAMKEQLE 1582

Query: 293  ELGGIWERLVQSSS*RETSCRKRLNNSS 210
            +L   W+ L++    R     K+LN +S
Sbjct: 1583 QLKEHWDHLLE----RTNDKGKKLNEAS 1606



 Score = 41.5 bits (93), Expect = 0.002
 Identities = 21/71 (29%), Positives = 37/71 (52%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL + A  +Q+ R +E++E W+SE+      E Y KD T++Q    KH     +V   +E
Sbjct: 1495 KLGDYANLKQFYRDLEELEEWISEMLPTACDESY-KDATNIQRKYLKHQTFAHEVDGRSE 1553

Query: 60   RIDAIREPGRA 28
            ++  +   G +
Sbjct: 1554 QVHGVINLGNS 1564



 Score = 40.3 bits (90), Expect = 0.005
 Identities = 19/70 (27%), Positives = 38/70 (54%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           +G KL+++   Q + R  +D+  W+ E    L  + Y +D T++Q   +KH  LEA+V +
Sbjct: 45  RGQKLEDSYHLQVFKRDADDLGKWIMEKVNILTDKSY-EDPTNIQGKYQKHQSLEAEVQT 103

Query: 69  HAERIDAIRE 40
            +  +  + +
Sbjct: 104 KSRLMSELEK 113



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 17/53 (32%), Positives = 32/53 (60%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
           + +H+   + + +++PR+ EIT  G +++E  HFA   ++SRV+ L    E L
Sbjct: 832 LNRHRVILENIASHEPRIQEITERGNKMVEEGHFAAEDVASRVKSLNQNMESL 884



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 17/66 (25%), Positives = 35/66 (53%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L EA +   +     D++ W+S + G + S++  +DLT ++ L ++H    AD+ + A  
Sbjct: 1285 LNEAQKFYLFLSKARDLQNWISSIGGMVSSQELAEDLTGIEILLERHQEHRADMEAEAPT 1344

Query: 57   IDAIRE 40
              A+ +
Sbjct: 1345 FQALED 1350



 Score = 34.3 bits (75), Expect = 0.33
 Identities = 17/52 (32%), Positives = 27/52 (51%)
 Frame = -3

Query: 210 YNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
           + R  E ++ W+S  E  L +ED G  L S + L +KH   E   ++  E+I
Sbjct: 481 FYRDSEQVDSWMSRQEAFLENEDLGNSLGSAEALLQKHEDFEEAFTAQEEKI 532



 Score = 33.5 bits (73), Expect = 0.58
 Identities = 18/70 (25%), Positives = 34/70 (48%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG++L  A + QQY +   DI  W+ + E    S + G+D    + L KK    + ++ +
Sbjct: 150 KGDQLLRALKFQQYVQECADILEWIGDKEAIATSVELGEDWERTEVLHKKFEDFQVELVA 209

Query: 69  HAERIDAIRE 40
              R+  + +
Sbjct: 210 KEGRVVEVNQ 219



 Score = 31.1 bits (67), Expect = 3.1
 Identities = 18/66 (27%), Positives = 33/66 (50%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L  A   + ++R  +D +  + +    L + D G DL SVQ LQ++H   E D+    ++
Sbjct: 1179 LGSAHAVEVFHREADDTKEQIEKKCQALSAADPGSDLFSVQALQRRHEGFERDLVPLGDK 1238

Query: 57   IDAIRE 40
            +  + E
Sbjct: 1239 VTILGE 1244



 Score = 29.5 bits (63), Expect = 9.5
 Identities = 17/67 (25%), Positives = 27/67 (40%)
 Frame = -1

Query: 467 TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           ++D   D     G    H+  E+ L     +V E+ A  ++L        PQI    E+L
Sbjct: 289 SEDYGKDLVASEGLFHSHKGLERNLAVMSDKVKELCAKAEKLTLSHPSDAPQIQEMKEDL 348

Query: 287 GGIWERL 267
              WE +
Sbjct: 349 VSSWEHI 355



 Score = 29.5 bits (63), Expect = 9.5
 Identities = 11/52 (21%), Positives = 25/52 (48%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVE 294
            D T +   +++HQ    +++A  P    +      L++  H A P+I  +++
Sbjct: 1320 DLTGIEILLERHQEHRADMEAEAPTFQALEDFSAELIDSGHHASPEIEKKLQ 1371


>AL353894-3|CAH73936.1| 2416|Homo sapiens spectrin, alpha,
           erythrocytic 1 (elliptocytosis 2) protein.
          Length = 2416

 Score = 73.3 bits (172), Expect = 6e-13
 Identities = 32/70 (45%), Positives = 47/70 (67%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG +L EA QQ Q+    ED++ WL +VE Q+ SEDYGK L  VQN  +KH LLE+ V++
Sbjct: 679 KGTQLHEANQQLQFENNAEDLQRWLEDVEWQVTSEDYGKGLAEVQNRLRKHGLLESAVAA 738

Query: 69  HAERIDAIRE 40
             +++D + +
Sbjct: 739 RQDQVDILTD 748



 Score = 66.9 bits (156), Expect = 5e-11
 Identities = 28/79 (35%), Positives = 49/79 (62%)
 Frame = -1

Query: 476 KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRV 297
           K A D+ Y D  NL  +VQK Q FE+EL  NK +++ I   G+ ++E  H+A   +++R+
Sbjct: 603 KLADDEDYKDIQNLKSRVQKQQVFEKELAVNKTQLENIQKTGQEMIEGGHYASDNVTTRL 662

Query: 296 EELGGIWERLVQSSS*RET 240
            E+  +WE L++++  + T
Sbjct: 663 SEVASLWEELLEATKQKGT 681



 Score = 66.1 bits (154), Expect = 9e-11
 Identities = 32/70 (45%), Positives = 46/70 (65%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KG KL EA++QQ++N ++ D E WLSE E  L  +D  +DL S  NL KKH LLE ++ +
Sbjct: 1599 KGKKLNEASRQQRFNTSIRDFEFWLSEAETLLAMKDQARDLASAGNLLKKHQLLEREMLA 1658

Query: 69   HAERIDAIRE 40
               R DA+++
Sbjct: 1659 ---REDALKD 1665



 Score = 58.8 bits (136), Expect = 1e-08
 Identities = 29/81 (35%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = -1

Query: 497 LGK--RES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHF 324
           LGK   E     TD SY DPTN+ GK QKHQ+ E E+Q     + E+    +    + H 
Sbjct: 65  LGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHS 124

Query: 323 AQPQISSRVEELGGIWERLVQ 261
           A  +  + +EEL  +W+ L++
Sbjct: 125 AHEETKAHIEELRHLWDLLLE 145



 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 26/65 (40%), Positives = 40/65 (61%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL+EA    Q+ + ++D E W+ E   ++ S+DYG+DL  VQNL KKH  LE ++ +H  
Sbjct: 1708 KLKEAYALFQFFQDLDDEESWIEEKLIRVSSQDYGRDLQGVQNLLKKHKRLEGELVAHEP 1767

Query: 60   RIDAI 46
             I  +
Sbjct: 1768 AIQNV 1772



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/61 (36%), Positives = 35/61 (57%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L  AA  Q++ R V +   W+ E E  L SEDYGKDL + + L   H  LE +++  +++
Sbjct: 260 LSNAANLQRFKRDVTEAIQWIKEKEPVLTSEDYGKDLVASEGLFHSHKGLERNLAVMSDK 319

Query: 57  I 55
           +
Sbjct: 320 V 320



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +G KL+E+ +  Q+ +  E+ E W++E     +  D G  L + Q+L  KH  LE D + 
Sbjct: 1811 RGLKLEESLEYLQFMQNAEEEEAWINEKNALAVRGDCGDTLAATQSLLMKHEALENDFAV 1870

Query: 69   HAERIDAIREPG 34
            H  R+  +   G
Sbjct: 1871 HETRVQNVCAQG 1882



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 24/69 (34%), Positives = 34/69 (49%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           KL +    Q   R  ED E W+ E E    S   GKDL + + L  +H ++  +++SH  
Sbjct: 788 KLLDLLHLQLICRDTEDEEAWIQETEPSATSTYLGKDLIASKKLLNRHRVILENIASHEP 847

Query: 60  RIDAIREPG 34
           RI  I E G
Sbjct: 848 RIQEITERG 856



 Score = 43.6 bits (98), Expect = 5e-04
 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 1/99 (1%)
 Frame = -3

Query: 321  STSNIVSRGRA-GRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSE 145
            +  ++ SR ++  +NM +  A    + N L+   Q QQY   + + E W+ E E  + + 
Sbjct: 866  AAEDVASRVKSLNQNMESLRARAARRQNDLEANVQFQQYLADLHEAETWIREKEPIVDNT 925

Query: 144  DYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPGRA 28
            +YG D  +   L KKH     D++S  + + A+R    A
Sbjct: 926  NYGADEEAAGALLKKHEAFLLDLNSFGDSMKALRNQANA 964



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 2/89 (2%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELE--HFAQPQISSRV 297
            A D+SY D TN+  K  KHQ F  E+     +V  +  +G  L+E       +  +  ++
Sbjct: 1523 ACDESYKDATNIQRKYLKHQTFAHEVDGRSEQVHGVINLGNSLIECSACDGNEEAMKEQL 1582

Query: 296  EELGGIWERLVQSSS*RETSCRKRLNNSS 210
            E+L   W+ L++    R     K+LN +S
Sbjct: 1583 EQLKEHWDHLLE----RTNDKGKKLNEAS 1607



 Score = 41.5 bits (93), Expect = 0.002
 Identities = 21/71 (29%), Positives = 37/71 (52%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL + A  +Q+ R +E++E W+SE+      E Y KD T++Q    KH     +V   +E
Sbjct: 1495 KLGDYANLKQFYRDLEELEEWISEMLPTACDESY-KDATNIQRKYLKHQTFAHEVDGRSE 1553

Query: 60   RIDAIREPGRA 28
            ++  +   G +
Sbjct: 1554 QVHGVINLGNS 1564



 Score = 40.3 bits (90), Expect = 0.005
 Identities = 19/70 (27%), Positives = 38/70 (54%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           +G KL+++   Q + R  +D+  W+ E    L  + Y +D T++Q   +KH  LEA+V +
Sbjct: 45  RGQKLEDSYHLQVFKRDADDLGKWIMEKVNILTDKSY-EDPTNIQGKYQKHQSLEAEVQT 103

Query: 69  HAERIDAIRE 40
            +  +  + +
Sbjct: 104 KSRLMSELEK 113



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 17/53 (32%), Positives = 32/53 (60%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
           + +H+   + + +++PR+ EIT  G +++E  HFA   ++SRV+ L    E L
Sbjct: 832 LNRHRVILENIASHEPRIQEITERGNKMVEEGHFAAEDVASRVKSLNQNMESL 884



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 17/66 (25%), Positives = 35/66 (53%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L EA +   +     D++ W+S + G + S++  +DLT ++ L ++H    AD+ + A  
Sbjct: 1285 LNEAQKFYLFLSKARDLQNWISSIGGMVSSQELAEDLTGIEILLERHQEHRADMEAEAPT 1344

Query: 57   IDAIRE 40
              A+ +
Sbjct: 1345 FQALED 1350



 Score = 34.3 bits (75), Expect = 0.33
 Identities = 17/52 (32%), Positives = 27/52 (51%)
 Frame = -3

Query: 210 YNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
           + R  E ++ W+S  E  L +ED G  L S + L +KH   E   ++  E+I
Sbjct: 481 FYRDSEQVDSWMSRQEAFLENEDLGNSLGSAEALLQKHEDFEEAFTAQEEKI 532



 Score = 33.5 bits (73), Expect = 0.58
 Identities = 18/70 (25%), Positives = 34/70 (48%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG++L  A + QQY +   DI  W+ + E    S + G+D    + L KK    + ++ +
Sbjct: 150 KGDQLLRALKFQQYVQECADILEWIGDKEAIATSVELGEDWERTEVLHKKFEDFQVELVA 209

Query: 69  HAERIDAIRE 40
              R+  + +
Sbjct: 210 KEGRVVEVNQ 219



 Score = 32.7 bits (71), Expect = 1.0
 Identities = 14/46 (30%), Positives = 25/46 (54%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            + KH+  E +   ++ RV  + A G+ +L  E     +ISS++E L
Sbjct: 1858 LMKHEALENDFAVHETRVQNVCAQGEDILNKEESQNKEISSKIEAL 1903



 Score = 31.1 bits (67), Expect = 3.1
 Identities = 18/66 (27%), Positives = 33/66 (50%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L  A   + ++R  +D +  + +    L + D G DL SVQ LQ++H   E D+    ++
Sbjct: 1179 LGSAHAVEVFHREADDTKEQIEKKCQALSAADPGSDLFSVQALQRRHEGFERDLVPLGDK 1238

Query: 57   IDAIRE 40
            +  + E
Sbjct: 1239 VTILGE 1244



 Score = 29.5 bits (63), Expect = 9.5
 Identities = 17/67 (25%), Positives = 27/67 (40%)
 Frame = -1

Query: 467 TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           ++D   D     G    H+  E+ L     +V E+ A  ++L        PQI    E+L
Sbjct: 289 SEDYGKDLVASEGLFHSHKGLERNLAVMSDKVKELCAKAEKLTLSHPSDAPQIQEMKEDL 348

Query: 287 GGIWERL 267
              WE +
Sbjct: 349 VSSWEHI 355



 Score = 29.5 bits (63), Expect = 9.5
 Identities = 11/52 (21%), Positives = 25/52 (48%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVE 294
            D T +   +++HQ    +++A  P    +      L++  H A P+I  +++
Sbjct: 1320 DLTGIEILLERHQEHRADMEAEAPTFQALEDFSAELIDSGHHASPEIEKKLQ 1371


>AL353894-2|CAH73937.1| 2419|Homo sapiens spectrin, alpha,
           erythrocytic 1 (elliptocytosis 2) protein.
          Length = 2419

 Score = 73.3 bits (172), Expect = 6e-13
 Identities = 32/70 (45%), Positives = 47/70 (67%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG +L EA QQ Q+    ED++ WL +VE Q+ SEDYGK L  VQN  +KH LLE+ V++
Sbjct: 679 KGTQLHEANQQLQFENNAEDLQRWLEDVEWQVTSEDYGKGLAEVQNRLRKHGLLESAVAA 738

Query: 69  HAERIDAIRE 40
             +++D + +
Sbjct: 739 RQDQVDILTD 748



 Score = 66.9 bits (156), Expect = 5e-11
 Identities = 28/79 (35%), Positives = 49/79 (62%)
 Frame = -1

Query: 476 KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRV 297
           K A D+ Y D  NL  +VQK Q FE+EL  NK +++ I   G+ ++E  H+A   +++R+
Sbjct: 603 KLADDEDYKDIQNLKSRVQKQQVFEKELAVNKTQLENIQKTGQEMIEGGHYASDNVTTRL 662

Query: 296 EELGGIWERLVQSSS*RET 240
            E+  +WE L++++  + T
Sbjct: 663 SEVASLWEELLEATKQKGT 681



 Score = 66.1 bits (154), Expect = 9e-11
 Identities = 32/70 (45%), Positives = 46/70 (65%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KG KL EA++QQ++N ++ D E WLSE E  L  +D  +DL S  NL KKH LLE ++ +
Sbjct: 1599 KGKKLNEASRQQRFNTSIRDFEFWLSEAETLLAMKDQARDLASAGNLLKKHQLLEREMLA 1658

Query: 69   HAERIDAIRE 40
               R DA+++
Sbjct: 1659 ---REDALKD 1665



 Score = 58.8 bits (136), Expect = 1e-08
 Identities = 29/81 (35%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = -1

Query: 497 LGK--RES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHF 324
           LGK   E     TD SY DPTN+ GK QKHQ+ E E+Q     + E+    +    + H 
Sbjct: 65  LGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHS 124

Query: 323 AQPQISSRVEELGGIWERLVQ 261
           A  +  + +EEL  +W+ L++
Sbjct: 125 AHEETKAHIEELRHLWDLLLE 145



 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 26/65 (40%), Positives = 40/65 (61%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL+EA    Q+ + ++D E W+ E   ++ S+DYG+DL  VQNL KKH  LE ++ +H  
Sbjct: 1708 KLKEAYALFQFFQDLDDEESWIEEKLIRVSSQDYGRDLQGVQNLLKKHKRLEGELVAHEP 1767

Query: 60   RIDAI 46
             I  +
Sbjct: 1768 AIQNV 1772



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/61 (36%), Positives = 35/61 (57%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L  AA  Q++ R V +   W+ E E  L SEDYGKDL + + L   H  LE +++  +++
Sbjct: 260 LSNAANLQRFKRDVTEAIQWIKEKEPVLTSEDYGKDLVASEGLFHSHKGLERNLAVMSDK 319

Query: 57  I 55
           +
Sbjct: 320 V 320



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +G KL+E+ +  Q+ +  E+ E W++E     +  D G  L + Q+L  KH  LE D + 
Sbjct: 1811 RGLKLEESLEYLQFMQNAEEEEAWINEKNALAVRGDCGDTLAATQSLLMKHEALENDFAV 1870

Query: 69   HAERIDAIREPG 34
            H  R+  +   G
Sbjct: 1871 HETRVQNVCAQG 1882



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 24/69 (34%), Positives = 34/69 (49%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           KL +    Q   R  ED E W+ E E    S   GKDL + + L  +H ++  +++SH  
Sbjct: 788 KLLDLLHLQLICRDTEDEEAWIQETEPSATSTYLGKDLIASKKLLNRHRVILENIASHEP 847

Query: 60  RIDAIREPG 34
           RI  I E G
Sbjct: 848 RIQEITERG 856



 Score = 43.6 bits (98), Expect = 5e-04
 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 1/99 (1%)
 Frame = -3

Query: 321  STSNIVSRGRA-GRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSE 145
            +  ++ SR ++  +NM +  A    + N L+   Q QQY   + + E W+ E E  + + 
Sbjct: 866  AAEDVASRVKSLNQNMESLRARAARRQNDLEANVQFQQYLADLHEAETWIREKEPIVDNT 925

Query: 144  DYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPGRA 28
            +YG D  +   L KKH     D++S  + + A+R    A
Sbjct: 926  NYGADEEAAGALLKKHEAFLLDLNSFGDSMKALRNQANA 964



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 2/89 (2%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELE--HFAQPQISSRV 297
            A D+SY D TN+  K  KHQ F  E+     +V  +  +G  L+E       +  +  ++
Sbjct: 1523 ACDESYKDATNIQRKYLKHQTFAHEVDGRSEQVHGVINLGNSLIECSACDGNEEAMKEQL 1582

Query: 296  EELGGIWERLVQSSS*RETSCRKRLNNSS 210
            E+L   W+ L++    R     K+LN +S
Sbjct: 1583 EQLKEHWDHLLE----RTNDKGKKLNEAS 1607



 Score = 41.5 bits (93), Expect = 0.002
 Identities = 21/71 (29%), Positives = 37/71 (52%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL + A  +Q+ R +E++E W+SE+      E Y KD T++Q    KH     +V   +E
Sbjct: 1495 KLGDYANLKQFYRDLEELEEWISEMLPTACDESY-KDATNIQRKYLKHQTFAHEVDGRSE 1553

Query: 60   RIDAIREPGRA 28
            ++  +   G +
Sbjct: 1554 QVHGVINLGNS 1564



 Score = 40.3 bits (90), Expect = 0.005
 Identities = 19/70 (27%), Positives = 38/70 (54%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           +G KL+++   Q + R  +D+  W+ E    L  + Y +D T++Q   +KH  LEA+V +
Sbjct: 45  RGQKLEDSYHLQVFKRDADDLGKWIMEKVNILTDKSY-EDPTNIQGKYQKHQSLEAEVQT 103

Query: 69  HAERIDAIRE 40
            +  +  + +
Sbjct: 104 KSRLMSELEK 113



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 17/53 (32%), Positives = 32/53 (60%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
           + +H+   + + +++PR+ EIT  G +++E  HFA   ++SRV+ L    E L
Sbjct: 832 LNRHRVILENIASHEPRIQEITERGNKMVEEGHFAAEDVASRVKSLNQNMESL 884



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 17/66 (25%), Positives = 35/66 (53%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L EA +   +     D++ W+S + G + S++  +DLT ++ L ++H    AD+ + A  
Sbjct: 1285 LNEAQKFYLFLSKARDLQNWISSIGGMVSSQELAEDLTGIEILLERHQEHRADMEAEAPT 1344

Query: 57   IDAIRE 40
              A+ +
Sbjct: 1345 FQALED 1350



 Score = 34.3 bits (75), Expect = 0.33
 Identities = 17/52 (32%), Positives = 27/52 (51%)
 Frame = -3

Query: 210 YNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
           + R  E ++ W+S  E  L +ED G  L S + L +KH   E   ++  E+I
Sbjct: 481 FYRDSEQVDSWMSRQEAFLENEDLGNSLGSAEALLQKHEDFEEAFTAQEEKI 532



 Score = 33.5 bits (73), Expect = 0.58
 Identities = 18/70 (25%), Positives = 34/70 (48%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG++L  A + QQY +   DI  W+ + E    S + G+D    + L KK    + ++ +
Sbjct: 150 KGDQLLRALKFQQYVQECADILEWIGDKEAIATSVELGEDWERTEVLHKKFEDFQVELVA 209

Query: 69  HAERIDAIRE 40
              R+  + +
Sbjct: 210 KEGRVVEVNQ 219



 Score = 31.1 bits (67), Expect = 3.1
 Identities = 18/66 (27%), Positives = 33/66 (50%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L  A   + ++R  +D +  + +    L + D G DL SVQ LQ++H   E D+    ++
Sbjct: 1179 LGSAHAVEVFHREADDTKEQIEKKCQALSAADPGSDLFSVQALQRRHEGFERDLVPLGDK 1238

Query: 57   IDAIRE 40
            +  + E
Sbjct: 1239 VTILGE 1244



 Score = 29.5 bits (63), Expect = 9.5
 Identities = 17/67 (25%), Positives = 27/67 (40%)
 Frame = -1

Query: 467 TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           ++D   D     G    H+  E+ L     +V E+ A  ++L        PQI    E+L
Sbjct: 289 SEDYGKDLVASEGLFHSHKGLERNLAVMSDKVKELCAKAEKLTLSHPSDAPQIQEMKEDL 348

Query: 287 GGIWERL 267
              WE +
Sbjct: 349 VSSWEHI 355



 Score = 29.5 bits (63), Expect = 9.5
 Identities = 11/52 (21%), Positives = 25/52 (48%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVE 294
            D T +   +++HQ    +++A  P    +      L++  H A P+I  +++
Sbjct: 1320 DLTGIEILLERHQEHRADMEAEAPTFQALEDFSAELIDSGHHASPEIEKKLQ 1371


>M11049-1|AAA60569.1|  237|Homo sapiens SPTA1 protein.
          Length = 237

 Score = 66.1 bits (154), Expect = 9e-11
 Identities = 32/70 (45%), Positives = 46/70 (65%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG KL EA++QQ++N ++ D E WLSE E  L  +D  +DL S  NL KKH LLE ++ +
Sbjct: 148 KGKKLNEASRQQRFNTSIRDFEFWLSEAETLLAMKDQARDLASAGNLLKKHQLLEREMLA 207

Query: 69  HAERIDAIRE 40
              R DA+++
Sbjct: 208 ---REDALKD 214



 Score = 43.6 bits (98), Expect = 5e-04
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 1/88 (1%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQ-ISSRVE 294
           A D+SY D TN+  K  KHQ F  E+     +V  +  +G  L+E       + +  ++E
Sbjct: 73  ACDESYKDATNIQRKYLKHQTFAHEVDGRSEQVHGVINLGNSLIERSCDGNEEAMKEQLE 132

Query: 293 ELGGIWERLVQSSS*RETSCRKRLNNSS 210
           +L   W+ L++    R     K+LN +S
Sbjct: 133 QLKEHWDHLLE----RTNDKGKKLNEAS 156



 Score = 41.5 bits (93), Expect = 0.002
 Identities = 21/71 (29%), Positives = 37/71 (52%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           KL + A  +Q+ R +E++E W+SE+      E Y KD T++Q    KH     +V   +E
Sbjct: 45  KLGDYANLKQFYRDLEELEEWISEMLPTACDESY-KDATNIQRKYLKHQTFAHEVDGRSE 103

Query: 60  RIDAIREPGRA 28
           ++  +   G +
Sbjct: 104 QVHGVINLGNS 114


>AB008567-1|BAA32700.1| 2390|Homo sapiens beta-spectrin III protein.
          Length = 2390

 Score = 58.8 bits (136), Expect = 1e-08
 Identities = 30/71 (42%), Positives = 44/71 (61%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +LQ + +Q Q++R VED  LW++E      S ++GKDL SVQ L KK+  L+ ++  H  
Sbjct: 1483 RLQASREQHQFHRDVEDEILWVTERLPMASSMEHGKDLPSVQLLMKKNQTLQKEIQGHEP 1542

Query: 60   RIDAIREPGRA 28
            RI  +RE  RA
Sbjct: 1543 RIADLRERQRA 1553



 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 26/76 (34%), Positives = 46/76 (60%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            + K   L +A + + + ++   +E WL  ++ QL S+DYGKDLTSV  L KK  +LE ++
Sbjct: 1373 QAKARSLFDANRAELFAQSCCALESWLESLQAQLHSDDYGKDLTSVNILLKKQQMLEWEM 1432

Query: 75   SSHAERIDAIREPGRA 28
            +   + ++AI+   +A
Sbjct: 1433 AVREKEVEAIQAQAKA 1448



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 24/71 (33%), Positives = 41/71 (57%)
 Frame = -3

Query: 267  GAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALL 88
            G   EL+G +L++A + QQ+ R   + E W+ E E  ++ ++  KD  S Q   KKH +L
Sbjct: 1574 GHELELRGKRLEDALRAQQFYRDAAEAEAWMGEQELHMMGQEKAKDELSAQAEVKKHQVL 1633

Query: 87   EADVSSHAERI 55
            E  ++ +A+ I
Sbjct: 1634 EQALADYAQTI 1644



 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 26/79 (32%), Positives = 41/79 (51%)
 Frame = -3

Query: 264 AVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLE 85
           A+ E +  +L +AA   Q+     D+E WL +    + S + G D  S Q L ++H  LE
Sbjct: 734 ALAEERAQRLAQAASLYQFQADANDMEAWLVDALRLVSSPELGHDEFSTQALARQHRALE 793

Query: 84  ADVSSHAERIDAIREPGRA 28
            ++ SH   +DA+RE   A
Sbjct: 794 EEIRSHRPTLDALREQAAA 812



 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 19/45 (42%), Positives = 33/45 (73%)
 Frame = -3

Query: 180 WLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
           W+ E++G+L S+D G+ L  V++L + H L+EAD++  AER+ A+
Sbjct: 546 WMEEMKGRLQSQDLGRHLAGVEDLLQLHELVEADIAVQAERVRAV 590



 Score = 43.6 bits (98), Expect = 5e-04
 Identities = 24/68 (35%), Positives = 37/68 (54%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A D SY +  NL+ K QKHQ F  EL ANK  +D++   G+ L   +   +  +S ++ +
Sbjct: 1301 AQDVSYDEARNLHTKWQKHQAFMAELAANKDWLDKVDKEGRELTLEKPELKALVSEKLRD 1360

Query: 290  LGGIWERL 267
            L   W+ L
Sbjct: 1361 LHRRWDEL 1368



 Score = 40.3 bits (90), Expect = 0.005
 Identities = 18/69 (26%), Positives = 41/69 (59%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL++ A +  ++R     E WLSE +  +  +++G +L +V+   +KH  +E D+ 
Sbjct: 418 IRQEKLEQLAAR--FDRKAAMRETWLSENQRLVSQDNFGLELAAVEAAVRKHEAIETDIV 475

Query: 72  SHAERIDAI 46
           +++ R+ A+
Sbjct: 476 AYSGRVQAV 484



 Score = 38.3 bits (85), Expect = 0.021
 Identities = 20/70 (28%), Positives = 34/70 (48%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+E+ +  ++   V + E W+ E +  L S D G+DLT    L  KH  L  ++S    
Sbjct: 636 RLEESRRLWRFLWEVGEAEAWVREQQHLLASADTGRDLTGALRLLNKHTALRGEMSGRLG 695

Query: 60  RIDAIREPGR 31
            +    E G+
Sbjct: 696 PLKLTLEQGQ 705



 Score = 36.3 bits (80), Expect = 0.083
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 1/65 (1%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS-HA 64
            +LQE  +  Q  R ++D+E W+ E E    S + G+D   V  L+ K      D S+   
Sbjct: 1689 RLQEHLRLCQLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFSRDTSTIGQ 1748

Query: 63   ERIDA 49
            ER+D+
Sbjct: 1749 ERVDS 1753



 Score = 35.9 bits (79), Expect = 0.11
 Identities = 19/77 (24%), Positives = 33/77 (42%)
 Frame = -3

Query: 264  AVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLE 85
            A    +   L EA + Q + R+++D + WL   +  + SE+    L   + L  +HA L 
Sbjct: 1052 ATMRRREESLGEARRLQDFLRSLDDFQAWLGRTQTAVASEEGPATLPEAEALLAQHAALR 1111

Query: 84   ADVSSHAERIDAIREPG 34
             +V         +R  G
Sbjct: 1112 GEVERAQSEYSRLRALG 1128



 Score = 31.9 bits (69), Expect = 1.8
 Identities = 18/78 (23%), Positives = 38/78 (48%), Gaps = 2/78 (2%)
 Frame = -3

Query: 261  VFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEG--QLLSEDYGKDLTSVQNLQKKHALL 88
            + EL   + Q  A   +  R +      L+ V+   Q L +  G+DL + + LQ++H   
Sbjct: 1786 LLELLDTRGQVLAAAYELQRFLHGARQALARVQHKQQQLPDGTGRDLNAAEALQRRHCAY 1845

Query: 87   EADVSSHAERIDAIREPG 34
            E D+ + + ++  +++ G
Sbjct: 1846 EHDIQALSPQVQQVQDDG 1863



 Score = 31.9 bits (69), Expect = 1.8
 Identities = 13/46 (28%), Positives = 24/46 (52%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            ++  Q  + E++A   R      +GK LL   H+A  +IS ++ +L
Sbjct: 1946 IKNQQGIKAEIEARADRFSSCIDMGKELLARSHYAAEEISEKLSQL 1991



 Score = 30.3 bits (65), Expect = 5.4
 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 1/71 (1%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            L  A   Q Y+    + + W+ E    + S +  G DL  V  LQ+K A  E D+ + A 
Sbjct: 954  LTSALSIQNYHLECTETQAWMREKTKVIESTQGLGNDLAGVLALQRKLAGTERDLEAIAA 1013

Query: 60   RIDAIREPGRA 28
            R+  +     A
Sbjct: 1014 RVGELTREANA 1024



 Score = 30.3 bits (65), Expect = 5.4
 Identities = 15/71 (21%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKD-LTSVQNLQKKHALLEADVSSHA 64
            +L++  +QQ + +   +++LW+   E  L ++D   D   ++    +KH    A+++++ 
Sbjct: 1273 RLRDNREQQHFLQDCHELKLWID--EKMLTAQDVSYDEARNLHTKWQKHQAFMAELAANK 1330

Query: 63   ERIDAIREPGR 31
            + +D + + GR
Sbjct: 1331 DWLDKVDKEGR 1341


>AF233523-1|AAF65317.1| 3674|Homo sapiens beta V spectrin protein.
          Length = 3674

 Score = 57.2 bits (132), Expect = 4e-08
 Identities = 31/87 (35%), Positives = 46/87 (52%)
 Frame = -1

Query: 488  RES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQI 309
            RE    A ++  LD   L  ++QK QNF+ EL A+  +  E+   G+RLL+  H A   I
Sbjct: 2699 REKNLVALEEGLLDTAMLPAQLQKQQNFQAELDASMHQQQELQREGQRLLQGGHPASEAI 2758

Query: 308  SSRVEELGGIWERLVQSSS*RETSCRK 228
              R+EELG +W  L  +S  +    +K
Sbjct: 2759 QERLEELGALWGELQDNSQKKVAKLQK 2785



 Score = 56.4 bits (130), Expect = 7e-08
 Identities = 27/68 (39%), Positives = 46/68 (67%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +G++LQ+A QQ+Q  R ++D +  L ++EG L S + G+DL S Q LQK+H  LE++  +
Sbjct: 1411 RGDELQQAGQQEQLLRQLQDAKEQLEQLEGALQSSETGQDLRSSQRLQKRHQQLESESRT 1470

Query: 69   HAERIDAI 46
             A ++ A+
Sbjct: 1471 LAAKMAAL 1478



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 1/78 (1%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSH-AE 61
           L++  Q+ ++ R  E+ E WL E   ++ +   G+DL+ +    +KH  LEA+V  H A 
Sbjct: 635 LEQTLQRAEFLRNCEEEEAWLKECGQRVGNAALGRDLSQIAGALQKHKALEAEVHRHQAV 694

Query: 60  RIDAIREPGRASS*KREP 7
            +D +R  GR  S +R P
Sbjct: 695 CVDLVRR-GRDLSARRPP 711



 Score = 43.2 bits (97), Expect = 7e-04
 Identities = 24/70 (34%), Positives = 36/70 (51%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +LQ+A + Q +  +VE +E WL   E  L SE     L  ++ L  KH +LE D+   A 
Sbjct: 2571 QLQQALELQLFLSSVEKMERWLCSKEDSLASEGLWDPLAPMEPLLWKHKMLEWDLEVQAG 2630

Query: 60   RIDAIREPGR 31
            +I A+    R
Sbjct: 2631 KISALEATAR 2640



 Score = 41.5 bits (93), Expect = 0.002
 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +G+ LQE  Q  Q  R    ++ WL+       S+DYG+DL  V+ L++K      +V
Sbjct: 3095 EARGHGLQEQLQLHQLERETLLLDAWLTTKAATAESQDYGQDLEGVKVLEEKFDAFRKEV 3154

Query: 75   SSHAE-RIDAIRE 40
             S  + ++ A+R+
Sbjct: 3155 QSLGQAKVYALRK 3167



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 20/61 (32%), Positives = 32/61 (52%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   LQ+A   QQY   V ++E W+ E    + S DYG+D  +   L  KH  L+ ++
Sbjct: 1616 EARAQCLQQAVTFQQYFLDVSELEGWVEEKRPLVSSRDYGRDEAATLRLINKHQALQEEL 1675

Query: 75   S 73
            +
Sbjct: 1676 A 1676



 Score = 40.3 bits (90), Expect = 0.005
 Identities = 23/71 (32%), Positives = 41/71 (57%), Gaps = 1/71 (1%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L+ A +    +R ++++   + E E  + + D GKDL SVQ L +KH  LE +V     
Sbjct: 2359 QLEGALEIHVLSRELDNVTKRIQEKEALIQALDCGKDLESVQRLLRKHEELEREVHPIQA 2418

Query: 60   RIDAI-REPGR 31
            +++++ RE GR
Sbjct: 2419 QVESLEREVGR 2429



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 25/77 (32%), Positives = 41/77 (53%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KLQ+A +  +  R++E++E WL  +E +L +   G+ L  V  L      LEA V   A 
Sbjct: 2782 KLQKACEALRLRRSMEELENWLEPIEVELRAPTVGQALPGVGELLGTQRELEAAVDKKAR 2841

Query: 60   RIDAIREPGRASS*KRE 10
            + +A+   G+A +  RE
Sbjct: 2842 QAEALL--GQAQAFVRE 2856



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 22/76 (28%), Positives = 35/76 (46%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           +G +LQ A    QY     +   WL E    L     G+D  + + L ++H  LE  + +
Sbjct: 737 RGARLQTALLVLQYFADAAEAASWLRERRSSLERASCGQDQAAAETLLRRHVRLERVLRA 796

Query: 69  HAERIDAIREPGRASS 22
            A  +  + E GRA+S
Sbjct: 797 FAAELRRLEEQGRAAS 812



 Score = 39.1 bits (87), Expect = 0.012
 Identities = 16/49 (32%), Positives = 33/49 (67%)
 Frame = -3

Query: 213  QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSH 67
            ++ R  ++   W+ E      ++DYG+ L++V++LQ++H  LE+++SSH
Sbjct: 2897 KFFRDADEEMAWVQEKLPLAAAQDYGQSLSAVRHLQEQHQNLESEMSSH 2945



 Score = 37.9 bits (84), Expect = 0.027
 Identities = 20/65 (30%), Positives = 35/65 (53%)
 Frame = -3

Query: 252  LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
            L+  +  E+   Q+  + +E  E WL+  EG LL  DYG  ++ V+ L  +H  LE  ++
Sbjct: 3411 LRWQRCAESWGLQKLRQRLEQAEAWLACWEGLLLKPDYGHSVSDVELLLHRHQDLEKLLA 3470

Query: 72   SHAER 58
            +  E+
Sbjct: 3471 AQEEK 3475



 Score = 36.7 bits (81), Expect = 0.063
 Identities = 13/45 (28%), Positives = 29/45 (64%)
 Frame = -1

Query: 422  QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            ++HQN E E+ +++     +   G +L++  HFA  ++++RV++L
Sbjct: 2933 EQHQNLESEMSSHEALTRVVLGTGYKLVQAGHFAAHEVAARVQQL 2977



 Score = 36.3 bits (80), Expect = 0.083
 Identities = 18/58 (31%), Positives = 30/58 (51%)
 Frame = -1

Query: 440  NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
            N+   +++H+  E EL A +  V+ +  VG+ LL      Q  I +R++ L   WE L
Sbjct: 1347 NILQTLKRHEAAESELLATRRHVEALQQVGRELLSRRPCGQEDIQTRLQGLRSKWEAL 1404



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 19/76 (25%), Positives = 40/76 (52%), Gaps = 1/76 (1%)
 Frame = -3

Query: 252  LKGNKLQEAAQQQQYNRAVEDIEL-WLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            ++G +LQ + +  Q+   + ++EL W++E         Y + L   Q+L +KH  L+ +V
Sbjct: 1511 IRGLQLQASVELHQFCH-LSNMELSWVAEHMPHGSPTSYTECLNGAQSLHRKHKELQVEV 1569

Query: 75   SSHAERIDAIREPGRA 28
             +H  ++  +   GR+
Sbjct: 1570 KAHQGQVQRVLSSGRS 1585



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 20/79 (25%), Positives = 39/79 (49%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            LQ+A + QQ+   + +   WL+E    L SED G    + Q L ++    + D+ + + R
Sbjct: 2995 LQQAQEAQQFLTELLEAGSWLAERGHVLDSEDMGHSAEATQALLRRLEATKRDLEAFSPR 3054

Query: 57   IDAIREPGRASS*KREPLS 1
            I+ +++       ++ P S
Sbjct: 3055 IERLQQTAALLESRKNPES 3073



 Score = 33.9 bits (74), Expect = 0.44
 Identities = 14/53 (26%), Positives = 30/53 (56%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
            +Q+H+ F + L    PR + + A G++L++ +H A   +  +++ +   W RL
Sbjct: 1247 LQQHREFGRLLSTLGPRAEALRAHGEKLVQSQHPAAHTVREQLQSIQAQWTRL 1299



 Score = 33.1 bits (72), Expect = 0.77
 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 2/73 (2%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN--RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
           L+G + Q A  Q   +  + VE     L E++    S   G+ L  V  L ++H LLEA 
Sbjct: 522 LQGQRKQVADMQAVLSLLQEVEAASHQLEELQEPARSTACGQQLAEVVELLQRHDLLEAQ 581

Query: 78  VSSHAERIDAIRE 40
           VS+H   +  + +
Sbjct: 582 VSAHGAHVSHLAQ 594



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 16/61 (26%), Positives = 26/61 (42%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
            DP +      K   F+ +++    RV     + + LLE  H A P +  R ++L   W  
Sbjct: 1762 DPEHALHLCTKFAKFQHQVEMGSQRVAACRLLAESLLERGHSAGPMVRQRQQDLQTAWSE 1821

Query: 269  L 267
            L
Sbjct: 1822 L 1822



 Score = 31.1 bits (67), Expect = 3.1
 Identities = 19/76 (25%), Positives = 31/76 (40%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +G+ L  +     + +A    E W+     QL       DL        KH   EA+V
Sbjct: 2139 ESRGHALHASLLMASFTQAATQAEDWIQAWAQQLKEPVPPGDLRDKLKPLLKHQAFEAEV 2198

Query: 75   SSHAERIDAIREPGRA 28
             +H E + ++ + G A
Sbjct: 2199 QAHEEVMTSVAKKGEA 2214



 Score = 30.7 bits (66), Expect = 4.1
 Identities = 13/62 (20%), Positives = 34/62 (54%)
 Frame = -1

Query: 419  KHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*RET 240
            +H+   QE++  + +  ++   G++L++  HF   +++  ++EL G  + L ++ + R  
Sbjct: 3355 QHEELGQEIRECRLQAQDLRQEGQQLVDNSHFMSAEVTECLQELEGRLQELEEAWALRWQ 3414

Query: 239  SC 234
             C
Sbjct: 3415 RC 3416



 Score = 29.5 bits (63), Expect = 9.5
 Identities = 16/61 (26%), Positives = 28/61 (45%)
 Frame = -1

Query: 449 DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
           D + + G +QKH+  E E+  ++    ++   G+ L       QP    R E + G W+ 
Sbjct: 670 DLSQIAGALQKHKALEAEVHRHQAVCVDLVRRGRDLSARRPPTQPDPGERAEAVQGGWQL 729

Query: 269 L 267
           L
Sbjct: 730 L 730


>S65762-1|AAB28324.1| 1252|Homo sapiens beta-fodrin protein.
          Length = 1252

 Score = 56.4 bits (130), Expect = 7e-08
 Identities = 26/78 (33%), Positives = 46/78 (58%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            + K  +L +A + + + ++  D++ WL  +E Q+ S+DYGKDLTSV  L KK  +LE  +
Sbjct: 1078 QTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQM 1137

Query: 75   SSHAERIDAIREPGRASS 22
                + I+ ++   +A S
Sbjct: 1138 EVRKKEIEELQSQAQALS 1155



 Score = 50.0 bits (114), Expect = 6e-06
 Identities = 20/45 (44%), Positives = 32/45 (71%)
 Frame = -3

Query: 180 WLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
           W+ E++  +LS+DYGK L  V++L +KH L+EAD+   AER+  +
Sbjct: 251 WMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGV 295



 Score = 47.2 bits (107), Expect = 4e-05
 Identities = 25/66 (37%), Positives = 37/66 (56%)
 Frame = -3

Query: 243  NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHA 64
            + L  + +  Q+NR VED  LW+ E      S D+G +L +VQ L KK+  L+ ++  H 
Sbjct: 1187 HNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQ 1246

Query: 63   ERIDAI 46
             RID I
Sbjct: 1247 PRIDDI 1252



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/69 (30%), Positives = 43/69 (62%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL++ A++  ++R     E WLSE +  +  +++G DL +V+   KKH  +E D++
Sbjct: 123 IRQEKLEQLARR--FDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIA 180

Query: 72  SHAERIDAI 46
           ++ ER+ A+
Sbjct: 181 AYEERVQAV 189



 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 25/68 (36%), Positives = 40/68 (58%), Gaps = 1/68 (1%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+E+ +  ++   + + E W+ E E  L S+DYGKDLTSV  L  KH   E ++S  + 
Sbjct: 341 RLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSG 400

Query: 60  RID-AIRE 40
             + AI+E
Sbjct: 401 HFEQAIKE 408



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 20/75 (26%), Positives = 41/75 (54%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  +L+EA+   Q+    +DI+ W+ ++   + S D G D  S Q+L KKH  +  +++
Sbjct: 443 IRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIA 502

Query: 72  SHAERIDAIREPGRA 28
           ++   +D + E   A
Sbjct: 503 NYRPTLDTLHEQASA 517



 Score = 44.8 bits (101), Expect = 2e-04
 Identities = 20/68 (29%), Positives = 38/68 (55%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L EA++ QQ+ R ++D + WLS  +  + SED    LT  + L  +H  ++ ++ ++ E 
Sbjct: 766 LGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEED 825

Query: 57  IDAIREPG 34
              +R+ G
Sbjct: 826 YQKMRDMG 833



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 27/94 (28%), Positives = 44/94 (46%), Gaps = 1/94 (1%)
 Frame = -1

Query: 488 RES*KFATDDSY-LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQ 312
           RE  K  + D Y  D T++   + KH+ FE E+       ++    G+ ++  EHF   +
Sbjct: 363 REKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEK 422

Query: 311 ISSRVEELGGIWERLVQSSS*RETSCRKRLNNSS 210
           I  R+  +   W  L Q S+ R    +KRL  +S
Sbjct: 423 IRERIIYIREQWANLEQLSAIR----KKRLEEAS 452



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 23/68 (33%), Positives = 36/68 (52%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A D SY +  NL+ K  KHQ F  EL +NK  +D+I   G +L+  +   +  +  ++  
Sbjct: 1006 AQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTG 1065

Query: 290  LGGIWERL 267
            L  +WE L
Sbjct: 1066 LHKMWEVL 1073



 Score = 30.7 bits (66), Expect = 4.1
 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 2/78 (2%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEAD-V 76
           K + L  A   Q Y+    + + W+ E    + S +D G DL  V  LQ+K   +E D V
Sbjct: 655 KKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLV 714

Query: 75  SSHAERIDAIREPGRASS 22
           +  A+  D  +E  +  S
Sbjct: 715 AIEAKLSDLQKEAEKLES 732


>M19725-1|AAA59904.1|  475|Homo sapiens SPTAN1 protein.
          Length = 475

 Score = 56.4 bits (130), Expect = 7e-08
 Identities = 25/73 (34%), Positives = 43/73 (58%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           +G +L+E+ + QQ+   VE+ E W++E    + SEDYG  L ++Q L KKH   E D + 
Sbjct: 92  RGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTV 151

Query: 69  HAERIDAIREPGR 31
             +R++ +   G+
Sbjct: 152 QKDRVNDVCTNGQ 164



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 25/58 (43%), Positives = 38/58 (65%)
 Frame = -3

Query: 204 RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPGR 31
           R ++D E W+ E +  + SEDYG+DLT VQNL+KKH  LE  +++H   I  + + G+
Sbjct: 1   RDMDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEGRLAAHEPAIQGVLDTGK 58



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 21/57 (36%), Positives = 33/57 (57%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KL E +   Q+N   + +E W+ E E  L ++DYG+DL+SVQ L  K    +A + +
Sbjct: 201 KLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQA 257



 Score = 36.3 bits (80), Expect = 0.083
 Identities = 15/52 (28%), Positives = 31/52 (59%)
 Frame = -1

Query: 437 LNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGG 282
           + G ++KH+ FE +    K RV+++   G+ L++  +  +  ISS+++ L G
Sbjct: 135 IQGLLKKHEAFETDFTVQKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNG 186



 Score = 35.9 bits (79), Expect = 0.11
 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 1/86 (1%)
 Frame = -1

Query: 497 LGKRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQA-NKPRVDEITAVGKRLLELEHFA 321
           +G++E+    TDD   D +++   + K + F+  LQA  +  +  ITA+  +LL  +H  
Sbjct: 222 IGEKEN-SLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHVQ 280

Query: 320 QPQISSRVEELGGIWERLVQSSS*RE 243
              I +R   L   W +L+ +S+ R+
Sbjct: 281 SKAIEARHASLMKRWSQLLANSAARK 306



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 17/74 (22%), Positives = 36/74 (48%)
 Frame = -1

Query: 467 TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           ++D   D T +    +KH+  E  L A++P +  +   GK+L +     + +I  R+ + 
Sbjct: 19  SEDYGRDLTGVQNLRKKHKRLEGRLAAHEPAIQGVLDTGKKLTDDNTIGKEEIQQRLAQF 78

Query: 287 GGIWERLVQSSS*R 246
              W+ L + ++ R
Sbjct: 79  VEHWKELTELAAAR 92


>AC093110-1|AAY24229.1| 2314|Homo sapiens unknown protein.
          Length = 2314

 Score = 56.4 bits (130), Expect = 7e-08
 Identities = 26/78 (33%), Positives = 46/78 (58%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            + K  +L +A + + + ++  D++ WL  +E Q+ S+DYGKDLTSV  L KK  +LE  +
Sbjct: 1320 QTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQM 1379

Query: 75   SSHAERIDAIREPGRASS 22
                + I+ ++   +A S
Sbjct: 1380 EVRKKEIEELQSQAQALS 1397



 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 27/76 (35%), Positives = 43/76 (56%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +  +L+EA + QQY     + E W+SE E  ++SE+  KD  S  ++ KKH +LE  V
Sbjct: 1532 EKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAV 1591

Query: 75   SSHAERIDAIREPGRA 28
              +AE +  + +  RA
Sbjct: 1592 EDYAETVHQLSKTSRA 1607



 Score = 50.0 bits (114), Expect = 6e-06
 Identities = 20/45 (44%), Positives = 32/45 (71%)
 Frame = -3

Query: 180 WLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
           W+ E++  +LS+DYGK L  V++L +KH L+EAD+   AER+  +
Sbjct: 493 WMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGV 537



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/68 (38%), Positives = 38/68 (55%)
 Frame = -3

Query: 243  NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHA 64
            + L  + +  Q+NR VED  LW+ E      S D+G +L +VQ L KK+  L+ ++  H 
Sbjct: 1429 HNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQ 1488

Query: 63   ERIDAIRE 40
             RID I E
Sbjct: 1489 PRIDDIFE 1496



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/69 (30%), Positives = 43/69 (62%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL++ A++  ++R     E WLSE +  +  +++G DL +V+   KKH  +E D++
Sbjct: 365 IRQEKLEQLARR--FDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIA 422

Query: 72  SHAERIDAI 46
           ++ ER+ A+
Sbjct: 423 AYEERVQAV 431



 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 25/68 (36%), Positives = 40/68 (58%), Gaps = 1/68 (1%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+E+ +  ++   + + E W+ E E  L S+DYGKDLTSV  L  KH   E ++S  + 
Sbjct: 583 RLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSG 642

Query: 60  RID-AIRE 40
             + AI+E
Sbjct: 643 HFEQAIKE 650



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 20/75 (26%), Positives = 41/75 (54%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  +L+EA+   Q+    +DI+ W+ ++   + S D G D  S Q+L KKH  +  +++
Sbjct: 685 IRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIA 744

Query: 72  SHAERIDAIREPGRA 28
           ++   +D + E   A
Sbjct: 745 NYRPTLDTLHEQASA 759



 Score = 44.8 bits (101), Expect = 2e-04
 Identities = 20/68 (29%), Positives = 38/68 (55%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L EA++ QQ+ R ++D + WLS  +  + SED    LT  + L  +H  ++ ++ ++ E 
Sbjct: 1008 LGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEED 1067

Query: 57   IDAIREPG 34
               +R+ G
Sbjct: 1068 YQKMRDMG 1075



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 27/94 (28%), Positives = 44/94 (46%), Gaps = 1/94 (1%)
 Frame = -1

Query: 488 RES*KFATDDSY-LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQ 312
           RE  K  + D Y  D T++   + KH+ FE E+       ++    G+ ++  EHF   +
Sbjct: 605 REKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEK 664

Query: 311 ISSRVEELGGIWERLVQSSS*RETSCRKRLNNSS 210
           I  R+  +   W  L Q S+ R    +KRL  +S
Sbjct: 665 IRERIIYIREQWANLEQLSAIR----KKRLEEAS 694



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 23/68 (33%), Positives = 36/68 (52%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A D SY +  NL+ K  KHQ F  EL +NK  +D+I   G +L+  +   +  +  ++  
Sbjct: 1248 AQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTG 1307

Query: 290  LGGIWERL 267
            L  +WE L
Sbjct: 1308 LHKMWEVL 1315



 Score = 39.1 bits (87), Expect = 0.012
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 1/71 (1%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +  KL E  +  Q NR V+D+E W++E E    S + G+D   V  LQ++      D 
Sbjct: 1638 EERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDT 1697

Query: 75   SS-HAERIDAI 46
             +   ER+D +
Sbjct: 1698 GNIGQERVDTV 1708



 Score = 34.3 bits (75), Expect = 0.33
 Identities = 17/56 (30%), Positives = 27/56 (48%)
 Frame = -3

Query: 213  QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
            Q++R     E WL   E  L S + G+ +  V+ L K+H   E   ++  ER  A+
Sbjct: 1971 QFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSAL 2026



 Score = 33.5 bits (73), Expect = 0.58
 Identities = 14/61 (22%), Positives = 35/61 (57%), Gaps = 1/61 (1%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLL-ELEHFAQPQISSRVEELGGIWERLVQSSS* 249
            ++K+Q  ++E+Q ++PR+D+I    + ++ +    +   I  R+ +L  +W  L++ +  
Sbjct: 1474 IKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEK 1533

Query: 248  R 246
            R
Sbjct: 1534 R 1534



 Score = 30.7 bits (66), Expect = 4.1
 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 2/78 (2%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEAD-V 76
            K + L  A   Q Y+    + + W+ E    + S +D G DL  V  LQ+K   +E D V
Sbjct: 897  KKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLV 956

Query: 75   SSHAERIDAIREPGRASS 22
            +  A+  D  +E  +  S
Sbjct: 957  AIEAKLSDLQKEAEKLES 974


>AB209748-1|BAD92985.1| 2377|Homo sapiens spectrin, beta,
            non-erythrocytic 1 isoform 1 variant protein.
          Length = 2377

 Score = 56.4 bits (130), Expect = 7e-08
 Identities = 26/78 (33%), Positives = 46/78 (58%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            + K  +L +A + + + ++  D++ WL  +E Q+ S+DYGKDLTSV  L KK  +LE  +
Sbjct: 1383 QTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQM 1442

Query: 75   SSHAERIDAIREPGRASS 22
                + I+ ++   +A S
Sbjct: 1443 EVRKKEIEELQSQAQALS 1460



 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 27/76 (35%), Positives = 43/76 (56%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +  +L+EA + QQY     + E W+SE E  ++SE+  KD  S  ++ KKH +LE  V
Sbjct: 1595 EKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAV 1654

Query: 75   SSHAERIDAIREPGRA 28
              +AE +  + +  RA
Sbjct: 1655 EDYAETVHQLSKTSRA 1670



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/68 (38%), Positives = 38/68 (55%)
 Frame = -3

Query: 243  NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHA 64
            + L  + +  Q+NR VED  LW+ E      S D+G +L +VQ L KK+  L+ ++  H 
Sbjct: 1492 HNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQ 1551

Query: 63   ERIDAIRE 40
             RID I E
Sbjct: 1552 PRIDDIFE 1559



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/69 (30%), Positives = 43/69 (62%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL++ A++  ++R     E WLSE +  +  +++G DL +V+   KKH  +E D++
Sbjct: 428 IRQEKLEQLARR--FDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIA 485

Query: 72  SHAERIDAI 46
           ++ ER+ A+
Sbjct: 486 AYEERVQAV 494



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 19/45 (42%), Positives = 31/45 (68%)
 Frame = -3

Query: 180 WLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
           W+ E++  +LS+DYGK L  V++L +KH L+EAD+   AE +  +
Sbjct: 556 WMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAEWVRGV 600



 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 25/68 (36%), Positives = 40/68 (58%), Gaps = 1/68 (1%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+E+ +  ++   + + E W+ E E  L S+DYGKDLTSV  L  KH   E ++S  + 
Sbjct: 646 RLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSG 705

Query: 60  RID-AIRE 40
             + AI+E
Sbjct: 706 HFEQAIKE 713



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 20/75 (26%), Positives = 41/75 (54%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  +L+EA+   Q+    +DI+ W+ ++   + S D G D  S Q+L KKH  +  +++
Sbjct: 748 IRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIA 807

Query: 72  SHAERIDAIREPGRA 28
           ++   +D + E   A
Sbjct: 808 NYRPTLDTLHEQASA 822



 Score = 44.8 bits (101), Expect = 2e-04
 Identities = 20/68 (29%), Positives = 38/68 (55%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L EA++ QQ+ R ++D + WLS  +  + SED    LT  + L  +H  ++ ++ ++ E 
Sbjct: 1071 LGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEED 1130

Query: 57   IDAIREPG 34
               +R+ G
Sbjct: 1131 YQKMRDMG 1138



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 27/94 (28%), Positives = 44/94 (46%), Gaps = 1/94 (1%)
 Frame = -1

Query: 488 RES*KFATDDSY-LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQ 312
           RE  K  + D Y  D T++   + KH+ FE E+       ++    G+ ++  EHF   +
Sbjct: 668 REKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEK 727

Query: 311 ISSRVEELGGIWERLVQSSS*RETSCRKRLNNSS 210
           I  R+  +   W  L Q S+ R    +KRL  +S
Sbjct: 728 IRERIIYIREQWANLEQLSAIR----KKRLEEAS 757



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 23/68 (33%), Positives = 36/68 (52%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A D SY +  NL+ K  KHQ F  EL +NK  +D+I   G +L+  +   +  +  ++  
Sbjct: 1311 AQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTG 1370

Query: 290  LGGIWERL 267
            L  +WE L
Sbjct: 1371 LHKMWEVL 1378



 Score = 39.1 bits (87), Expect = 0.012
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 1/71 (1%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +  KL E  +  Q NR V+D+E W++E E    S + G+D   V  LQ++      D 
Sbjct: 1701 EERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDT 1760

Query: 75   SS-HAERIDAI 46
             +   ER+D +
Sbjct: 1761 GNIGQERVDTV 1771



 Score = 34.3 bits (75), Expect = 0.33
 Identities = 17/56 (30%), Positives = 27/56 (48%)
 Frame = -3

Query: 213  QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
            Q++R     E WL   E  L S + G+ +  V+ L K+H   E   ++  ER  A+
Sbjct: 2034 QFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSAL 2089



 Score = 33.5 bits (73), Expect = 0.58
 Identities = 14/61 (22%), Positives = 35/61 (57%), Gaps = 1/61 (1%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLL-ELEHFAQPQISSRVEELGGIWERLVQSSS* 249
            ++K+Q  ++E+Q ++PR+D+I    + ++ +    +   I  R+ +L  +W  L++ +  
Sbjct: 1537 IKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEK 1596

Query: 248  R 246
            R
Sbjct: 1597 R 1597



 Score = 30.7 bits (66), Expect = 4.1
 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 2/78 (2%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEAD-V 76
            K + L  A   Q Y+    + + W+ E    + S +D G DL  V  LQ+K   +E D V
Sbjct: 960  KKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLV 1019

Query: 75   SSHAERIDAIREPGRASS 22
            +  A+  D  +E  +  S
Sbjct: 1020 AIEAKLSDLQKEAEKLES 1037


>U26396-1|AAB60364.1|  719|Homo sapiens alpha II spectrin protein.
          Length = 719

 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 27/70 (38%), Positives = 41/70 (58%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L+++ Q QQY     + E W+ E E  + S DYGKD  S + L KKH  L +D+S++   
Sbjct: 76  LEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSS 135

Query: 57  IDAIREPGRA 28
           I A+RE  ++
Sbjct: 136 IQALREQAQS 145



 Score = 50.0 bits (114), Expect = 6e-06
 Identities = 22/72 (30%), Positives = 44/72 (61%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E +   L  A + Q+++R  ++ + W+ E    L +++YG DL SVQ LQ+KH   E D+
Sbjct: 413 EERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDL 472

Query: 75  SSHAERIDAIRE 40
           ++  ++++++ E
Sbjct: 473 AALGDKVNSLGE 484



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = -1

Query: 449 DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
           D   +   ++KHQ  + E+  ++PR+  +T  G  ++E  HFA   + +++ EL   WE 
Sbjct: 5   DLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEA 64

Query: 269 LVQSSS*R 246
           L   +S R
Sbjct: 65  LKAKASQR 72



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 19/37 (51%), Positives = 25/37 (67%)
 Frame = -3

Query: 138 GKDLTSVQNLQKKHALLEADVSSHAERIDAIREPGRA 28
           GKDL  VQNL KKH  L+A+++ H  RI A+ + G A
Sbjct: 3   GKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNA 39



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/72 (27%), Positives = 39/72 (54%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E +   L+++ ++    R   +++ W++E E  L SE+ G DL  V+ LQKK    + D+
Sbjct: 271 EKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDL 330

Query: 75  SSHAERIDAIRE 40
            ++  R+  I +
Sbjct: 331 KANESRLKDINK 342



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 21/65 (32%), Positives = 35/65 (53%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L +  + Q ++R  E  E W++  E  L +ED G  L SV+ L KKH   +  ++   E+
Sbjct: 631 LDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEK 690

Query: 57  IDAIR 43
           I A++
Sbjct: 691 IAALQ 695



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 15/70 (21%), Positives = 35/70 (50%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           KL ++   Q++     D+  W++ + G + S++  KD+T  + L ++H     ++ + A 
Sbjct: 524 KLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAG 583

Query: 60  RIDAIREPGR 31
              A  + G+
Sbjct: 584 TFQAFEQFGQ 593



 Score = 33.9 bits (74), Expect = 0.44
 Identities = 14/60 (23%), Positives = 33/60 (55%)
 Frame = -1

Query: 467 TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           T+D      ++   ++KH++F++ +   + ++  + A   +L+   H+A+  ISSR  E+
Sbjct: 660 TEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGDISSRRNEV 719



 Score = 33.1 bits (72), Expect = 0.77
 Identities = 15/61 (24%), Positives = 29/61 (47%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           ++D+   D T     +++HQ    E+ A           G++LL   H+A P+I  +++ 
Sbjct: 553 SSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDI 612

Query: 290 L 288
           L
Sbjct: 613 L 613



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 16/67 (23%), Positives = 32/67 (47%)
 Frame = -1

Query: 467 TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           TD+   D  ++    +KH+ FE++L A   +V+ +    +RL++    +   +  +  EL
Sbjct: 448 TDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTEL 507

Query: 287 GGIWERL 267
              W  L
Sbjct: 508 NQAWSSL 514


>M96803-1|AAA60580.1| 2364|Homo sapiens beta-spectrin protein.
          Length = 2364

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 27/76 (35%), Positives = 43/76 (56%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +  +L+EA + QQY     + E W+SE E  ++SE+  KD  S  ++ KKH +LE  V
Sbjct: 1582 EKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAV 1641

Query: 75   SSHAERIDAIREPGRA 28
              +AE +  + +  RA
Sbjct: 1642 EDYAETVHQLSKTSRA 1657



 Score = 53.6 bits (123), Expect = 5e-07
 Identities = 25/78 (32%), Positives = 45/78 (57%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            + K  +L +A + + + ++  D++ WL  +E Q+ S+DYGK LTSV  L KK  +LE  +
Sbjct: 1370 QTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKHLTSVNILLKKQQMLENQM 1429

Query: 75   SSHAERIDAIREPGRASS 22
                + I+ ++   +A S
Sbjct: 1430 EVRKKEIEELQSQAQALS 1447



 Score = 50.0 bits (114), Expect = 6e-06
 Identities = 20/45 (44%), Positives = 32/45 (71%)
 Frame = -3

Query: 180 WLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
           W+ E++  +LS+DYGK L  V++L +KH L+EAD+   AER+  +
Sbjct: 543 WMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGV 587



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/68 (38%), Positives = 38/68 (55%)
 Frame = -3

Query: 243  NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHA 64
            + L  + +  Q+NR VED  LW+ E      S D+G +L +VQ L KK+  L+ ++  H 
Sbjct: 1479 HNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQ 1538

Query: 63   ERIDAIRE 40
             RID I E
Sbjct: 1539 PRIDDIFE 1546



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/69 (30%), Positives = 43/69 (62%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL++ A++  ++R     E WLSE +  +  +++G DL +V+   KKH  +E D++
Sbjct: 415 IRQEKLEQLARR--FDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIA 472

Query: 72  SHAERIDAI 46
           ++ ER+ A+
Sbjct: 473 AYEERVQAV 481



 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 25/68 (36%), Positives = 40/68 (58%), Gaps = 1/68 (1%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+E+ +  ++   + + E W+ E E  L S+DYGKDLTSV  L  KH   E ++S  + 
Sbjct: 633 RLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSG 692

Query: 60  RID-AIRE 40
             + AI+E
Sbjct: 693 HFEQAIKE 700



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 20/75 (26%), Positives = 41/75 (54%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  +L+EA+   Q+    +DI+ W+ ++   + S D G D  S Q+L KKH  +  +++
Sbjct: 735 IRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIA 794

Query: 72  SHAERIDAIREPGRA 28
           ++   +D + E   A
Sbjct: 795 NYRPTLDTLHEQASA 809



 Score = 44.8 bits (101), Expect = 2e-04
 Identities = 20/68 (29%), Positives = 38/68 (55%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L EA++ QQ+ R ++D + WLS  +  + SED    LT  + L  +H  ++ ++ ++ E 
Sbjct: 1058 LGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEED 1117

Query: 57   IDAIREPG 34
               +R+ G
Sbjct: 1118 YQKMRDMG 1125



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 27/94 (28%), Positives = 44/94 (46%), Gaps = 1/94 (1%)
 Frame = -1

Query: 488 RES*KFATDDSY-LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQ 312
           RE  K  + D Y  D T++   + KH+ FE E+       ++    G+ ++  EHF   +
Sbjct: 655 REKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEK 714

Query: 311 ISSRVEELGGIWERLVQSSS*RETSCRKRLNNSS 210
           I  R+  +   W  L Q S+ R    +KRL  +S
Sbjct: 715 IRERIIYIREQWANLEQLSAIR----KKRLEEAS 744



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 23/68 (33%), Positives = 36/68 (52%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A D SY +  NL+ K  KHQ F  EL +NK  +D+I   G +L+  +   +  +  ++  
Sbjct: 1298 AQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTG 1357

Query: 290  LGGIWERL 267
            L  +WE L
Sbjct: 1358 LHKMWEVL 1365



 Score = 39.1 bits (87), Expect = 0.012
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 1/71 (1%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +  KL E  +  Q NR V+D+E W++E E    S + G+D   V  LQ++      D 
Sbjct: 1688 EERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDT 1747

Query: 75   SS-HAERIDAI 46
             +   ER+D +
Sbjct: 1748 GNIGQERVDTV 1758



 Score = 34.3 bits (75), Expect = 0.33
 Identities = 17/56 (30%), Positives = 27/56 (48%)
 Frame = -3

Query: 213  QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
            Q++R     E WL   E  L S + G+ +  V+ L K+H   E   ++  ER  A+
Sbjct: 2021 QFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSAL 2076



 Score = 33.5 bits (73), Expect = 0.58
 Identities = 14/61 (22%), Positives = 35/61 (57%), Gaps = 1/61 (1%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLL-ELEHFAQPQISSRVEELGGIWERLVQSSS* 249
            ++K+Q  ++E+Q ++PR+D+I    + ++ +    +   I  R+ +L  +W  L++ +  
Sbjct: 1524 IKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEK 1583

Query: 248  R 246
            R
Sbjct: 1584 R 1584



 Score = 30.7 bits (66), Expect = 4.1
 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 2/78 (2%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEAD-V 76
            K + L  A   Q Y+    + + W+ E    + S +D G DL  V  LQ+K   +E D V
Sbjct: 947  KKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLV 1006

Query: 75   SSHAERIDAIREPGRASS 22
            +  A+  D  +E  +  S
Sbjct: 1007 AIEAKLSDLQKEAEKLES 1024


>AF327441-1|AAO15362.1| 2155|Homo sapiens beta-spectrin 2 isoform 2
            protein.
          Length = 2155

 Score = 54.4 bits (125), Expect = 3e-07
 Identities = 27/76 (35%), Positives = 43/76 (56%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +  +L+EA + QQY     + E W+SE E  ++SE+  KD  S  ++ KKH +LE  V
Sbjct: 1569 EKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAV 1628

Query: 75   SSHAERIDAIREPGRA 28
              +AE +  + +  RA
Sbjct: 1629 EDYAETVHQLSKTSRA 1644



 Score = 53.6 bits (123), Expect = 5e-07
 Identities = 25/78 (32%), Positives = 45/78 (57%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            + K  +L +A + + + ++  D++ WL  +E Q+ S+DYGK LTSV  L KK  +LE  +
Sbjct: 1357 QTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKHLTSVNILLKKQQMLENQM 1416

Query: 75   SSHAERIDAIREPGRASS 22
                + I+ ++   +A S
Sbjct: 1417 EVRKKEIEELQSQAQALS 1434



 Score = 50.0 bits (114), Expect = 6e-06
 Identities = 20/45 (44%), Positives = 32/45 (71%)
 Frame = -3

Query: 180 WLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
           W+ E++  +LS+DYGK L  V++L +KH L+EAD+   AER+  +
Sbjct: 530 WMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGV 574



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/68 (38%), Positives = 38/68 (55%)
 Frame = -3

Query: 243  NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHA 64
            + L  + +  Q+NR VED  LW+ E      S D+G +L +VQ L KK+  L+ ++  H 
Sbjct: 1466 HNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQ 1525

Query: 63   ERIDAIRE 40
             RID I E
Sbjct: 1526 PRIDDIFE 1533



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 21/69 (30%), Positives = 43/69 (62%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL++ A++  ++R     E WLSE +  +  +++G DL +V+   KKH  +E D++
Sbjct: 402 IRQEKLEQLARR--FDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIA 459

Query: 72  SHAERIDAI 46
           ++ ER+ A+
Sbjct: 460 AYEERVQAV 468



 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 25/68 (36%), Positives = 40/68 (58%), Gaps = 1/68 (1%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+E+ +  ++   + + E W+ E E  L S+DYGKDLTSV  L  KH   E ++S  + 
Sbjct: 620 RLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSG 679

Query: 60  RID-AIRE 40
             + AI+E
Sbjct: 680 HFEQAIKE 687



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 20/75 (26%), Positives = 41/75 (54%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  +L+EA+   Q+    +DI+ W+ ++   + S D G D  S Q+L KKH  +  +++
Sbjct: 722 IRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIA 781

Query: 72  SHAERIDAIREPGRA 28
           ++   +D + E   A
Sbjct: 782 NYRPTLDTLHEQASA 796



 Score = 44.8 bits (101), Expect = 2e-04
 Identities = 20/68 (29%), Positives = 38/68 (55%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L EA++ QQ+ R ++D + WLS  +  + SED    LT  + L  +H  ++ ++ ++ E 
Sbjct: 1045 LGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEED 1104

Query: 57   IDAIREPG 34
               +R+ G
Sbjct: 1105 YQKMRDMG 1112



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 27/94 (28%), Positives = 44/94 (46%), Gaps = 1/94 (1%)
 Frame = -1

Query: 488 RES*KFATDDSY-LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQ 312
           RE  K  + D Y  D T++   + KH+ FE E+       ++    G+ ++  EHF   +
Sbjct: 642 REKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEK 701

Query: 311 ISSRVEELGGIWERLVQSSS*RETSCRKRLNNSS 210
           I  R+  +   W  L Q S+ R    +KRL  +S
Sbjct: 702 IRERIIYIREQWANLEQLSAIR----KKRLEEAS 731



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 23/68 (33%), Positives = 36/68 (52%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A D SY +  NL+ K  KHQ F  EL +NK  +D+I   G +L+  +   +  +  ++  
Sbjct: 1285 AQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTG 1344

Query: 290  LGGIWERL 267
            L  +WE L
Sbjct: 1345 LHKMWEVL 1352



 Score = 39.1 bits (87), Expect = 0.012
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 1/71 (1%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +  KL E  +  Q NR V+D+E W++E E    S + G+D   V  LQ++      D 
Sbjct: 1675 EERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDT 1734

Query: 75   SS-HAERIDAI 46
             +   ER+D +
Sbjct: 1735 GNIGQERVDTV 1745



 Score = 34.3 bits (75), Expect = 0.33
 Identities = 17/56 (30%), Positives = 27/56 (48%)
 Frame = -3

Query: 213  QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
            Q++R     E WL   E  L S + G+ +  V+ L K+H   E   ++  ER  A+
Sbjct: 2008 QFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSAL 2063



 Score = 33.5 bits (73), Expect = 0.58
 Identities = 14/61 (22%), Positives = 35/61 (57%), Gaps = 1/61 (1%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLL-ELEHFAQPQISSRVEELGGIWERLVQSSS* 249
            ++K+Q  ++E+Q ++PR+D+I    + ++ +    +   I  R+ +L  +W  L++ +  
Sbjct: 1511 IKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEK 1570

Query: 248  R 246
            R
Sbjct: 1571 R 1571



 Score = 30.7 bits (66), Expect = 4.1
 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 2/78 (2%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEAD-V 76
            K + L  A   Q Y+    + + W+ E    + S +D G DL  V  LQ+K   +E D V
Sbjct: 934  KKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLV 993

Query: 75   SSHAERIDAIREPGRASS 22
            +  A+  D  +E  +  S
Sbjct: 994  AIEAKLSDLQKEAEKLES 1011


>AY004227-1|AAF93173.1| 2149|Homo sapiens betaIV spectrin isoform
           sigma4 protein.
          Length = 2149

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 25/75 (33%), Positives = 44/75 (58%)
 Frame = -3

Query: 270 TGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHAL 91
           TG V   +    Q  A Q+ +   V  ++ W+ E++ QLLS + G+ L    +L +KH L
Sbjct: 521 TGLVGARRTRLEQNLALQKVFQEMVYMVD-WMEEMQAQLLSRECGQHLVEADDLLQKHGL 579

Query: 90  LEADVSSHAERIDAI 46
           LE D+++ +ER++A+
Sbjct: 580 LEGDIAAQSERVEAL 594



 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 30/76 (39%), Positives = 39/76 (51%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L  A Q +QY   V ++E WL E E  ++SED GKD  S   L KKH  LE  V
Sbjct: 1606 ERRQQVLDAAFQVEQYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGV 1665

Query: 75   SSHAERIDAIREPGRA 28
             ++ E I  +    RA
Sbjct: 1666 ENYEESIAQLSRQCRA 1681



 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 22/75 (29%), Positives = 45/75 (60%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL+  AQ+  +  A+   E WL+E +  +  +++G +L +V+   KKH  +EAD++
Sbjct: 422 IRQEKLELLAQRFDHKVAMR--ESWLNENQRLVSQDNFGYELPAVEAAMKKHEAIEADIA 479

Query: 72  SHAERIDAIREPGRA 28
           ++ ER+  + E  +A
Sbjct: 480 AYEERVQGVAELAQA 494



 Score = 36.3 bits (80), Expect = 0.083
 Identities = 17/66 (25%), Positives = 32/66 (48%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +LQEA    Q+   ++ +  WL +      + D+G D  S + L ++H  L  +V +H  
Sbjct: 763 RLQEARALHQFGADLDGLLDWLRDAYRLAAAGDFGHDEASSRRLARQHRALTGEVEAHRG 822

Query: 60  RIDAIR 43
            +  +R
Sbjct: 823 PVSGLR 828



 Score = 31.9 bits (69), Expect = 1.8
 Identities = 21/74 (28%), Positives = 39/74 (52%), Gaps = 5/74 (6%)
 Frame = -3

Query: 246  GNKLQEAAQQQ----QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
            G + + A +QQ    Q +R V ++E W++E E    S + G+D   V  LQ+K +   ++
Sbjct: 1711 GEERRVALEQQYWLYQLSRQVSELEHWIAEKEVVAGSPELGQDFEHVSVLQEKFSEFASE 1770

Query: 78   VS-SHAERIDAIRE 40
               +  ER+ A+ +
Sbjct: 1771 TGMAGRERLAAVNQ 1784



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 15/61 (24%), Positives = 31/61 (50%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*R 246
            ++K+Q   +E+QA+ PR++E+      L  L       +   +E+L   W  L +++  R
Sbjct: 1549 IKKNQGLRREIQAHGPRLEEVLERAGALASLRSPEAEAVRRGLEQLQSAWAGLREAAERR 1608

Query: 245  E 243
            +
Sbjct: 1609 Q 1609



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 15/65 (23%), Positives = 30/65 (46%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            LQ+  +  Q+ +     + WL+  E  L S + G  +  V+ L ++H       ++  ER
Sbjct: 2039 LQQMLEVHQFAQEAVVADAWLTAQEPLLQSRELGSSVDEVEQLIRRHEAFRKAAAAWEER 2098

Query: 57   IDAIR 43
              ++R
Sbjct: 2099 FSSLR 2103


>AY004226-1|AAF93171.1| 1304|Homo sapiens betaIV spectrin isoform
           sigma2 protein.
          Length = 1304

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 25/75 (33%), Positives = 44/75 (58%)
 Frame = -3

Query: 270 TGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHAL 91
           TG V   +    Q  A Q+ +   V  ++ W+ E++ QLLS + G+ L    +L +KH L
Sbjct: 521 TGLVGARRTRLEQNLALQKVFQEMVYMVD-WMEEMQAQLLSRECGQHLVEADDLLQKHGL 579

Query: 90  LEADVSSHAERIDAI 46
           LE D+++ +ER++A+
Sbjct: 580 LEGDIAAQSERVEAL 594



 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 22/75 (29%), Positives = 45/75 (60%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL+  AQ+  +  A+   E WL+E +  +  +++G +L +V+   KKH  +EAD++
Sbjct: 422 IRQEKLELLAQRFDHKVAMR--ESWLNENQRLVSQDNFGYELPAVEAAMKKHEAIEADIA 479

Query: 72  SHAERIDAIREPGRA 28
           ++ ER+  + E  +A
Sbjct: 480 AYEERVQGVAELAQA 494



 Score = 36.3 bits (80), Expect = 0.083
 Identities = 17/66 (25%), Positives = 32/66 (48%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +LQEA    Q+   ++ +  WL +      + D+G D  S + L ++H  L  +V +H  
Sbjct: 763 RLQEARALHQFGADLDGLLDWLRDAYRLAAAGDFGHDEASSRRLARQHRALTGEVEAHRG 822

Query: 60  RIDAIR 43
            +  +R
Sbjct: 823 PVSGLR 828


>AF324064-1|AAQ14859.1| 2002|Homo sapiens beta spectrin IV protein.
          Length = 2002

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 25/75 (33%), Positives = 44/75 (58%)
 Frame = -3

Query: 270 TGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHAL 91
           TG V   +    Q  A Q+ +   V  ++ W+ E++ QLLS + G+ L    +L +KH L
Sbjct: 521 TGLVGARRTRLEQNLALQKVFQEMVYMVD-WMEEMQAQLLSRECGQHLVEADDLLQKHGL 579

Query: 90  LEADVSSHAERIDAI 46
           LE D+++ +ER++A+
Sbjct: 580 LEGDIAAQSERVEAL 594



 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 30/76 (39%), Positives = 39/76 (51%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L  A Q +QY   V ++E WL E E  ++SED GKD  S   L KKH  LE  V
Sbjct: 1611 ERRQQVLDAAFQVEQYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGV 1670

Query: 75   SSHAERIDAIREPGRA 28
             ++ E I  +    RA
Sbjct: 1671 ENYEESIAQLSRQCRA 1686



 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 22/75 (29%), Positives = 45/75 (60%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL+  AQ+  +  A+   E WL+E +  +  +++G +L +V+   KKH  +EAD++
Sbjct: 422 IRQEKLELLAQRFDHKVAMR--ESWLNENQRLVSQDNFGYELPAVEAAMKKHEAIEADIA 479

Query: 72  SHAERIDAIREPGRA 28
           ++ ER+  + E  +A
Sbjct: 480 AYEERVQGVAELAQA 494



 Score = 36.3 bits (80), Expect = 0.083
 Identities = 17/66 (25%), Positives = 32/66 (48%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +LQEA    Q+   ++ +  WL +      + D+G D  S + L ++H  L  +V +H  
Sbjct: 768 RLQEARALHQFGADLDGLLDWLRDAYRLAAAGDFGHDEASSRRLARQHRALTGEVEAHRG 827

Query: 60  RIDAIR 43
            +  +R
Sbjct: 828 PVSGLR 833



 Score = 31.9 bits (69), Expect = 1.8
 Identities = 21/74 (28%), Positives = 39/74 (52%), Gaps = 5/74 (6%)
 Frame = -3

Query: 246  GNKLQEAAQQQ----QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
            G + + A +QQ    Q +R V ++E W++E E    S + G+D   V  LQ+K +   ++
Sbjct: 1716 GEERRVALEQQYWLYQLSRQVSELEHWIAEKEVVAGSPELGQDFEHVSVLQEKFSEFASE 1775

Query: 78   VS-SHAERIDAIRE 40
               +  ER+ A+ +
Sbjct: 1776 TGMAGRERLAAVNQ 1789



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 15/61 (24%), Positives = 31/61 (50%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*R 246
            ++K+Q   +E+QA+ PR++E+      L  L       +   +E+L   W  L +++  R
Sbjct: 1554 IKKNQGLRREIQAHGPRLEEVLERAGALASLRSPEAEAVRRGLEQLQSAWAGLREAAERR 1613

Query: 245  E 243
            +
Sbjct: 1614 Q 1614


>AF324063-1|AAQ14860.1| 2564|Homo sapiens non-erythrocytic
           beta-spectrin 4 protein.
          Length = 2564

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 25/75 (33%), Positives = 44/75 (58%)
 Frame = -3

Query: 270 TGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHAL 91
           TG V   +    Q  A Q+ +   V  ++ W+ E++ QLLS + G+ L    +L +KH L
Sbjct: 521 TGLVGARRTRLEQNLALQKVFQEMVYMVD-WMEEMQAQLLSRECGQHLVEADDLLQKHGL 579

Query: 90  LEADVSSHAERIDAI 46
           LE D+++ +ER++A+
Sbjct: 580 LEGDIAAQSERVEAL 594



 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 30/76 (39%), Positives = 39/76 (51%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L  A Q +QY   V ++E WL E E  ++SED GKD  S   L KKH  LE  V
Sbjct: 1611 ERRQQVLDAAFQVEQYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGV 1670

Query: 75   SSHAERIDAIREPGRA 28
             ++ E I  +    RA
Sbjct: 1671 ENYEESIAQLSRQCRA 1686



 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 22/75 (29%), Positives = 45/75 (60%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL+  AQ+  +  A+   E WL+E +  +  +++G +L +V+   KKH  +EAD++
Sbjct: 422 IRQEKLELLAQRFDHKVAMR--ESWLNENQRLVSQDNFGYELPAVEAAMKKHEAIEADIA 479

Query: 72  SHAERIDAIREPGRA 28
           ++ ER+  + E  +A
Sbjct: 480 AYEERVQGVAELAQA 494



 Score = 36.3 bits (80), Expect = 0.083
 Identities = 17/66 (25%), Positives = 32/66 (48%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +LQEA    Q+   ++ +  WL +      + D+G D  S + L ++H  L  +V +H  
Sbjct: 768 RLQEARALHQFGADLDGLLDWLRDAYRLAAAGDFGHDEASSRRLARQHRALTGEVEAHRG 827

Query: 60  RIDAIR 43
            +  +R
Sbjct: 828 PVSGLR 833



 Score = 31.9 bits (69), Expect = 1.8
 Identities = 21/74 (28%), Positives = 39/74 (52%), Gaps = 5/74 (6%)
 Frame = -3

Query: 246  GNKLQEAAQQQ----QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
            G + + A +QQ    Q +R V ++E W++E E    S + G+D   V  LQ+K +   ++
Sbjct: 1716 GEERRVALEQQYWLYQLSRQVSELEHWIAEKEVVAGSPELGQDFEHVSVLQEKFSEFASE 1775

Query: 78   VS-SHAERIDAIRE 40
               +  ER+ A+ +
Sbjct: 1776 TGMAGRERLAAVNQ 1789



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 15/61 (24%), Positives = 31/61 (50%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*R 246
            ++K+Q   +E+QA+ PR++E+      L  L       +   +E+L   W  L +++  R
Sbjct: 1554 IKKNQGLRREIQAHGPRLEEVLERAGALASLRSPEAEAVRRGLEQLQSAWAGLREAAERR 1613

Query: 245  E 243
            +
Sbjct: 1614 Q 1614



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 15/65 (23%), Positives = 30/65 (46%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            LQ+  +  Q+ +     + WL+  E  L S + G  +  V+ L ++H       ++  ER
Sbjct: 2044 LQQMLEVHQFAQEAVVADAWLTAQEPLLQSRELGSSVDEVEQLIRRHEAFRKAAAAWEER 2103

Query: 57   IDAIR 43
              ++R
Sbjct: 2104 FSSLR 2108


>AF311855-1|AAG42473.1| 2564|Homo sapiens spectrin beta IV protein.
          Length = 2564

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 25/75 (33%), Positives = 44/75 (58%)
 Frame = -3

Query: 270 TGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHAL 91
           TG V   +    Q  A Q+ +   V  ++ W+ E++ QLLS + G+ L    +L +KH L
Sbjct: 521 TGLVGARRTRLEQNLALQKVFQEMVYMVD-WMEEMQAQLLSRECGQHLVEADDLLQKHGL 579

Query: 90  LEADVSSHAERIDAI 46
           LE D+++ +ER++A+
Sbjct: 580 LEGDIAAQSERVEAL 594



 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 30/76 (39%), Positives = 39/76 (51%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L  A Q +QY   V ++E WL E E  ++SED GKD  S   L KKH  LE  V
Sbjct: 1611 ERRQQVLDAAFQVEQYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGV 1670

Query: 75   SSHAERIDAIREPGRA 28
             ++ E I  +    RA
Sbjct: 1671 ENYEESIAQLSRQCRA 1686



 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 22/75 (29%), Positives = 45/75 (60%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL+  AQ+  +  A+   E WL+E +  +  +++G +L +V+   KKH  +EAD++
Sbjct: 422 IRQEKLELLAQRFDHKVAMR--ESWLNENQRLVSQDNFGYELPAVEAAMKKHEAIEADIA 479

Query: 72  SHAERIDAIREPGRA 28
           ++ ER+  + E  +A
Sbjct: 480 AYEERVQGVAELAQA 494



 Score = 36.3 bits (80), Expect = 0.083
 Identities = 17/66 (25%), Positives = 32/66 (48%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +LQEA    Q+   ++ +  WL +      + D+G D  S + L ++H  L  +V +H  
Sbjct: 768 RLQEARALHQFGADLDGLLDWLRDAYRLAAAGDFGHDEASSRRLARQHRALTGEVEAHRG 827

Query: 60  RIDAIR 43
            +  +R
Sbjct: 828 PVSGLR 833



 Score = 31.9 bits (69), Expect = 1.8
 Identities = 21/74 (28%), Positives = 39/74 (52%), Gaps = 5/74 (6%)
 Frame = -3

Query: 246  GNKLQEAAQQQ----QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
            G + + A +QQ    Q +R V ++E W++E E    S + G+D   V  LQ+K +   ++
Sbjct: 1716 GEERRVALEQQYWLYQLSRQVSELEHWIAEKEVVAGSPELGQDFEHVSVLQEKFSEFASE 1775

Query: 78   VS-SHAERIDAIRE 40
               +  ER+ A+ +
Sbjct: 1776 TGMAGRERLAAVNQ 1789



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 15/61 (24%), Positives = 31/61 (50%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*R 246
            ++K+Q   +E+QA+ PR++E+      L  L       +   +E+L   W  L +++  R
Sbjct: 1554 IKKNQGLRREIQAHGPRLEEVLERAGALASLRSPEAEAVRRGLEQLQSAWAGLREAAERR 1613

Query: 245  E 243
            +
Sbjct: 1614 Q 1614



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 15/65 (23%), Positives = 30/65 (46%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            LQ+  +  Q+ +     + WL+  E  L S + G  +  V+ L ++H       ++  ER
Sbjct: 2044 LQQMLEVHQFAQEAVVADAWLTAQEPLLQSRELGSSVDEVEQLIRRHEAFRKAAAAWEER 2103

Query: 57   IDAIR 43
              ++R
Sbjct: 2104 FSSLR 2108


>AF082075-1|AAG38874.1| 2559|Homo sapiens beta4sigma1 spectrin
           protein.
          Length = 2559

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 25/75 (33%), Positives = 44/75 (58%)
 Frame = -3

Query: 270 TGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHAL 91
           TG V   +    Q  A Q+ +   V  ++ W+ E++ QLLS + G+ L    +L +KH L
Sbjct: 521 TGLVGARRTRLEQNLALQKVFQEMVYMVD-WMEEMQAQLLSRECGQHLVEADDLLQKHGL 579

Query: 90  LEADVSSHAERIDAI 46
           LE D+++ +ER++A+
Sbjct: 580 LEGDIAAQSERVEAL 594



 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 30/76 (39%), Positives = 39/76 (51%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L  A Q +QY   V ++E WL E E  ++SED GKD  S   L KKH  LE  V
Sbjct: 1606 ERRQQVLDAAFQVEQYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGV 1665

Query: 75   SSHAERIDAIREPGRA 28
             ++ E I  +    RA
Sbjct: 1666 ENYEESIAQLSRQCRA 1681



 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 22/75 (29%), Positives = 45/75 (60%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL+  AQ+  +  A+   E WL+E +  +  +++G +L +V+   KKH  +EAD++
Sbjct: 422 IRQEKLELLAQRFDHKVAMR--ESWLNENQRLVSQDNFGYELPAVEAAMKKHEAIEADIA 479

Query: 72  SHAERIDAIREPGRA 28
           ++ ER+  + E  +A
Sbjct: 480 AYEERVQGVAELAQA 494



 Score = 36.3 bits (80), Expect = 0.083
 Identities = 17/66 (25%), Positives = 32/66 (48%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +LQEA    Q+   ++ +  WL +      + D+G D  S + L ++H  L  +V +H  
Sbjct: 763 RLQEARALHQFGADLDGLLDWLRDAYRLAAAGDFGHDEASSRRLARQHRALTGEVEAHRG 822

Query: 60  RIDAIR 43
            +  +R
Sbjct: 823 PVSGLR 828



 Score = 31.9 bits (69), Expect = 1.8
 Identities = 21/74 (28%), Positives = 39/74 (52%), Gaps = 5/74 (6%)
 Frame = -3

Query: 246  GNKLQEAAQQQ----QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
            G + + A +QQ    Q +R V ++E W++E E    S + G+D   V  LQ+K +   ++
Sbjct: 1711 GEERRVALEQQYWLYQLSRQVSELEHWIAEKEVVAGSPELGQDFEHVSVLQEKFSEFASE 1770

Query: 78   VS-SHAERIDAIRE 40
               +  ER+ A+ +
Sbjct: 1771 TGMAGRERLAAVNQ 1784



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 15/61 (24%), Positives = 31/61 (50%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*R 246
            ++K+Q   +E+QA+ PR++E+      L  L       +   +E+L   W  L +++  R
Sbjct: 1549 IKKNQGLRREIQAHGPRLEEVLERAGALASLRSPEAEAVRRGLEQLQSAWAGLREAAERR 1608

Query: 245  E 243
            +
Sbjct: 1609 Q 1609



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 15/65 (23%), Positives = 30/65 (46%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            LQ+  +  Q+ +     + WL+  E  L S + G  +  V+ L ++H       ++  ER
Sbjct: 2039 LQQMLEVHQFAQEAVVADAWLTAQEPLLQSRELGSSVDEVEQLIRRHEAFRKAAAAWEER 2098

Query: 57   IDAIR 43
              ++R
Sbjct: 2099 FSSLR 2103


>AB046862-1|BAB13468.1| 1997|Homo sapiens KIAA1642 protein protein.
          Length = 1997

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 25/75 (33%), Positives = 44/75 (58%)
 Frame = -3

Query: 270 TGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHAL 91
           TG V   +    Q  A Q+ +   V  ++ W+ E++ QLLS + G+ L    +L +KH L
Sbjct: 136 TGLVGARRTRLEQNLALQKVFQEMVYMVD-WMEEMQAQLLSRECGQHLVEADDLLQKHGL 194

Query: 90  LEADVSSHAERIDAI 46
           LE D+++ +ER++A+
Sbjct: 195 LEGDIAAQSERVEAL 209



 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 30/76 (39%), Positives = 39/76 (51%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L  A Q +QY   V ++E WL E E  ++SED GKD  S   L KKH  LE  V
Sbjct: 1226 ERRQQVLDAAFQVEQYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGV 1285

Query: 75   SSHAERIDAIREPGRA 28
             ++ E I  +    RA
Sbjct: 1286 ENYEESIAQLSRQCRA 1301



 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 22/75 (29%), Positives = 45/75 (60%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL+  AQ+  +  A+   E WL+E +  +  +++G +L +V+   KKH  +EAD++
Sbjct: 37  IRQEKLELLAQRFDHKVAMR--ESWLNENQRLVSQDNFGYELPAVEAAMKKHEAIEADIA 94

Query: 72  SHAERIDAIREPGRA 28
           ++ ER+  + E  +A
Sbjct: 95  AYEERVQGVAELAQA 109



 Score = 36.3 bits (80), Expect = 0.083
 Identities = 17/66 (25%), Positives = 32/66 (48%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +LQEA    Q+   ++ +  WL +      + D+G D  S + L ++H  L  +V +H  
Sbjct: 383 RLQEARALHQFGADLDGLLDWLRDAYRLAAAGDFGHDEASSRRLARQHRALTGEVEAHRG 442

Query: 60  RIDAIR 43
            +  +R
Sbjct: 443 PVSGLR 448



 Score = 31.9 bits (69), Expect = 1.8
 Identities = 21/74 (28%), Positives = 39/74 (52%), Gaps = 5/74 (6%)
 Frame = -3

Query: 246  GNKLQEAAQQQ----QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
            G + + A +QQ    Q +R V ++E W++E E    S + G+D   V  LQ+K +   ++
Sbjct: 1331 GEERRVALEQQYWLYQLSRQVSELEHWIAEKEVVAGSPELGQDFEHVSVLQEKFSEFASE 1390

Query: 78   VS-SHAERIDAIRE 40
               +  ER+ A+ +
Sbjct: 1391 TGMAGRERLAAVNQ 1404



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 15/61 (24%), Positives = 31/61 (50%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*R 246
            ++K+Q   +E+QA+ PR++E+      L  L       +   +E+L   W  L +++  R
Sbjct: 1169 IKKNQGLRREIQAHGPRLEEVLERAGALASLRSPEAEAVRRGLEQLQSAWAGLREAAERR 1228

Query: 245  E 243
            +
Sbjct: 1229 Q 1229



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 15/65 (23%), Positives = 30/65 (46%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            LQ+  +  Q+ +     + WL+  E  L S + G  +  V+ L ++H       ++  ER
Sbjct: 1659 LQQMLEVHQFAQEAVVADAWLTAQEPLLQSRELGSSVDEVEQLIRRHEAFRKAAAAWEER 1718

Query: 57   IDAIR 43
              ++R
Sbjct: 1719 FSSLR 1723


>AY004226-2|AAF93172.1| 1307|Homo sapiens betaIV spectrin isoform
           sigma3 protein.
          Length = 1307

 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 30/76 (39%), Positives = 39/76 (51%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E +   L  A Q +QY   V ++E WL E E  ++SED GKD  S   L KKH  LE  V
Sbjct: 354 ERRQQVLDAAFQVEQYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGV 413

Query: 75  SSHAERIDAIREPGRA 28
            ++ E I  +    RA
Sbjct: 414 ENYEESIAQLSRQCRA 429



 Score = 31.9 bits (69), Expect = 1.8
 Identities = 21/74 (28%), Positives = 39/74 (52%), Gaps = 5/74 (6%)
 Frame = -3

Query: 246 GNKLQEAAQQQ----QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
           G + + A +QQ    Q +R V ++E W++E E    S + G+D   V  LQ+K +   ++
Sbjct: 459 GEERRVALEQQYWLYQLSRQVSELEHWIAEKEVVAGSPELGQDFEHVSVLQEKFSEFASE 518

Query: 78  VS-SHAERIDAIRE 40
              +  ER+ A+ +
Sbjct: 519 TGMAGRERLAAVNQ 532



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 15/61 (24%), Positives = 31/61 (50%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*R 246
           ++K+Q   +E+QA+ PR++E+      L  L       +   +E+L   W  L +++  R
Sbjct: 297 IKKNQGLRREIQAHGPRLEEVLERAGALASLRSPEAEAVRRGLEQLQSAWAGLREAAERR 356

Query: 245 E 243
           +
Sbjct: 357 Q 357



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 15/65 (23%), Positives = 30/65 (46%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           LQ+  +  Q+ +     + WL+  E  L S + G  +  V+ L ++H       ++  ER
Sbjct: 787 LQQMLEVHQFAQEAVVADAWLTAQEPLLQSRELGSSVDEVEQLIRRHEAFRKAAAAWEER 846

Query: 57  IDAIR 43
             ++R
Sbjct: 847 FSSLR 851


>AL133093-1|CAB61407.1|  441|Homo sapiens hypothetical protein
           protein.
          Length = 441

 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 30/76 (39%), Positives = 39/76 (51%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E +   L  A Q +QY   V ++E WL E E  ++SED GKD  S   L KKH  LE  V
Sbjct: 50  ERRQQVLDAAFQVEQYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGV 109

Query: 75  SSHAERIDAIREPGRA 28
            ++ E I  +    RA
Sbjct: 110 ENYEESIAQLSRQCRA 125



 Score = 31.9 bits (69), Expect = 1.8
 Identities = 21/74 (28%), Positives = 39/74 (52%), Gaps = 5/74 (6%)
 Frame = -3

Query: 246 GNKLQEAAQQQ----QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
           G + + A +QQ    Q +R V ++E W++E E    S + G+D   V  LQ+K +   ++
Sbjct: 155 GEERRVALEQQYWLYQLSRQVSELEHWIAEKEVVAGSPELGQDFEHVSVLQEKFSEFASE 214

Query: 78  VS-SHAERIDAIRE 40
              +  ER+ A+ +
Sbjct: 215 TGMAGRERLAAVNQ 228


>AF311856-1|AAG42474.1|  678|Homo sapiens spectrin beta IV protein.
          Length = 678

 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 30/76 (39%), Positives = 39/76 (51%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E +   L  A Q +QY   V ++E WL E E  ++SED GKD  S   L KKH  LE  V
Sbjct: 287 ERRQQVLDAAFQVEQYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGV 346

Query: 75  SSHAERIDAIREPGRA 28
            ++ E I  +    RA
Sbjct: 347 ENYEESIAQLSRQCRA 362



 Score = 31.9 bits (69), Expect = 1.8
 Identities = 21/74 (28%), Positives = 39/74 (52%), Gaps = 5/74 (6%)
 Frame = -3

Query: 246 GNKLQEAAQQQ----QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
           G + + A +QQ    Q +R V ++E W++E E    S + G+D   V  LQ+K +   ++
Sbjct: 392 GEERRVALEQQYWLYQLSRQVSELEHWIAEKEVVAGSPELGQDFEHVSVLQEKFSEFASE 451

Query: 78  VS-SHAERIDAIRE 40
              +  ER+ A+ +
Sbjct: 452 TGMAGRERLAAVNQ 465



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 15/61 (24%), Positives = 31/61 (50%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*R 246
           ++K+Q   +E+QA+ PR++E+      L  L       +   +E+L   W  L +++  R
Sbjct: 230 IKKNQGLRREIQAHGPRLEEVLERAGALASLRSPEAEAVRRGLEQLQSAWAGLREAAERR 289

Query: 245 E 243
           +
Sbjct: 290 Q 290


>AF148808-1|AAF26672.1|  277|Homo sapiens nonerythroid
           alpha-spectrin protein.
          Length = 277

 Score = 50.0 bits (114), Expect = 6e-06
 Identities = 22/72 (30%), Positives = 44/72 (61%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E +   L  A + Q+++R  ++ + W+ E    L +++YG DL SVQ LQ+KH   E D+
Sbjct: 151 EERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDL 210

Query: 75  SSHAERIDAIRE 40
           ++  ++++++ E
Sbjct: 211 AALGDKVNSLGE 222



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/72 (27%), Positives = 39/72 (54%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E +   L+++ ++    R   +++ W++E E  L SE+ G DL  V+ LQKK    + D+
Sbjct: 9   EKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDL 68

Query: 75  SSHAERIDAIRE 40
            ++  R+  I +
Sbjct: 69  KANESRLKDINK 80



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 16/67 (23%), Positives = 32/67 (47%)
 Frame = -1

Query: 467 TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           TD+   D  ++    +KH+ FE++L A   +V+ +    +RL++    +   +  +  EL
Sbjct: 186 TDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTEL 245

Query: 287 GGIWERL 267
              W  L
Sbjct: 246 NQAWSSL 252


>J05500-2|AAA60578.1| 2106|Homo sapiens SPTB protein.
          Length = 2106

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 21/60 (35%), Positives = 39/60 (65%)
 Frame = -3

Query: 225 AQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
           A Q+ +   +  I+ W+ E++  LLS ++GK L  V++L +KH L+EAD++   +++ AI
Sbjct: 529 ALQKLFQDMLHSID-WMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAI 587



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 26/78 (33%), Positives = 40/78 (51%)
 Frame = -3

Query: 258  FELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
            +E +  +L+   +  Q++R     E WL   E  L S D+G  + SV+ L K+H   E  
Sbjct: 1998 WEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASGDFGHTVDSVEKLIKRHEAFEKS 2057

Query: 78   VSSHAERIDAIREPGRAS 25
             +S AER  A+ +P  AS
Sbjct: 2058 TASWAERFAALEKPTTAS 2075



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/71 (28%), Positives = 44/71 (61%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL++ A++  ++R     E WL+E +  +  +++G DL +V+  +KKH  +E D +
Sbjct: 415 IRQEKLEQLARR--FDRKAAMRETWLNENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTA 472

Query: 72  SHAERIDAIRE 40
           ++ ER+ A+ +
Sbjct: 473 AYEERVRALED 483



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 21/70 (30%), Positives = 39/70 (55%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L+ +  + Q +R +ED  LW+ E      S DYG +L +VQ   KK+  L+ ++  H  
Sbjct: 1473 QLESSRAKLQISRDLEDETLWVEERLPLAQSADYGTNLQTVQLFMKKNQTLQNEILGHTP 1532

Query: 60   RIDAIREPGR 31
            R++ + + G+
Sbjct: 1533 RVEDVLQRGQ 1542



 Score = 43.2 bits (97), Expect = 7e-04
 Identities = 23/65 (35%), Positives = 39/65 (60%), Gaps = 3/65 (4%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD---VSS 70
           +L+++ +  ++   +++ E W+ E E    S DYGKDLTSV  LQ+KH   E +   + +
Sbjct: 632 QLEQSKRLWKFFWEMDEAESWIKEKEQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDA 691

Query: 69  HAERI 55
           H E+I
Sbjct: 692 HLEQI 696



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 18/68 (26%), Positives = 37/68 (54%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L E +Q Q + + ++D + WLS  +  + SED  + L   + L ++HA ++ ++  H + 
Sbjct: 1057 LGEVSQLQAFLQDLDDFQAWLSITQKAVASEDMPESLPEAEQLLQQHAGIKDEIDGHQDS 1116

Query: 57   IDAIREPG 34
               ++E G
Sbjct: 1117 YQRVKESG 1124



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 22/66 (33%), Positives = 38/66 (57%)
 Frame = -1

Query: 464  DDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELG 285
            D SY +  NL+ K  KHQ F  EL +++  ++ I A GK+L++ +      +S ++E L 
Sbjct: 1299 DVSYDEARNLHNKWLKHQAFVAELASHEGWLENIDAEGKQLMDEKPQFTALVSQKLEALH 1358

Query: 284  GIWERL 267
             +W+ L
Sbjct: 1359 RLWDEL 1364



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 19/46 (41%), Positives = 27/46 (58%)
 Frame = -3

Query: 192  DIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
            D+  W+S +E QL S+D GKDLTSV  +  K   +E  V+   E +
Sbjct: 1390 DLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEEL 1435



 Score = 38.3 bits (85), Expect = 0.021
 Identities = 18/70 (25%), Positives = 38/70 (54%)
 Frame = -1

Query: 422 QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*RE 243
           +KH+ FE EL+     +++I      ++  + F  PQI +R++E+   W++L   ++   
Sbjct: 677 RKHKAFEDELRGLDAHLEQIFQEAHGMVARKQFGHPQIEARIKEVSAQWDQLKDLAA--- 733

Query: 242 TSCRKRLNNS 213
             C+K L ++
Sbjct: 734 -FCKKNLQDA 742



 Score = 35.9 bits (79), Expect = 0.11
 Identities = 15/60 (25%), Positives = 34/60 (56%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*R 246
            ++K+Q  + E+  + PRV+++   G++L+E        +  R+  L   W+RL ++++ R
Sbjct: 1517 MKKNQTLQNEILGHTPRVEDVLQRGQQLVEAAEIDCQDLEERLGHLQSSWDRLREAAAGR 1576



 Score = 34.3 bits (75), Expect = 0.33
 Identities = 16/47 (34%), Positives = 25/47 (53%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LQ+A    Q+    +D++ WL +    L  ED G+D  + + L KKH
Sbjct: 739 LQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRALGKKH 785



 Score = 33.9 bits (74), Expect = 0.44
 Identities = 16/62 (25%), Positives = 31/62 (50%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L++A + QQY    ++ E W+ E E  ++S++  KD      + K+H   +  V  +  
Sbjct: 1579 RLRDANEAQQYYLDADEAEAWIGEQELYVISDEIPKDEEGAIVMLKRHLRQQRAVEDYGR 1638

Query: 60   RI 55
             I
Sbjct: 1639 NI 1640



 Score = 33.5 bits (73), Expect = 0.58
 Identities = 22/86 (25%), Positives = 38/86 (44%), Gaps = 1/86 (1%)
 Frame = -3

Query: 300  RGRAGRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTS 121
            +G+  ++      V E +  KL+      Q  R  +D+E W+SE E    S + G+D   
Sbjct: 1665 QGQVDKHYAGLKDVAEERKRKLENMYHLFQLKRETDDLEQWISEKELVASSPEMGQDFDH 1724

Query: 120  VQNLQKKHALLEADVSS-HAERIDAI 46
            V  L+ K      +  +   ER+D +
Sbjct: 1725 VTLLRDKFRDFARETGAIGQERVDNV 1750



 Score = 31.9 bits (69), Expect = 1.8
 Identities = 16/51 (31%), Positives = 31/51 (60%), Gaps = 1/51 (1%)
 Frame = -3

Query: 195  EDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
            E+   W+++    + S +D G+DL  +  +Q+K + LE DV++   R+DA+
Sbjct: 964  EETSKWITDKTKVVESTKDLGRDLAGIIAIQRKLSGLERDVAAIQARVDAL 1014



 Score = 30.7 bits (66), Expect = 4.1
 Identities = 23/104 (22%), Positives = 46/104 (44%), Gaps = 1/104 (0%)
 Frame = -3

Query: 354  RQASA*ARTFCSTSNIVSRGRAGRNM-GATGAVFELKGNKLQEAAQQQQYNRAVEDIELW 178
            +QA      F  + ++  R +A R +     A  +L+  +LQEA          +  ELW
Sbjct: 804  QQAQGFPEEFRDSPDVTHRLQALRELYQQVVAQADLRQQRLQEALDLYTVFGETDACELW 863

Query: 177  LSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
            + E E  L   +    L  ++ +Q +  +L+ ++ +   +ID +
Sbjct: 864  MGEKEKWLAEMEMPDTLEDLEVVQHRFDILDQEMKTLMTQIDGV 907


>J05500-1|AAA60579.1| 2137|Homo sapiens SPTB protein.
          Length = 2137

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 21/60 (35%), Positives = 39/60 (65%)
 Frame = -3

Query: 225 AQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
           A Q+ +   +  I+ W+ E++  LLS ++GK L  V++L +KH L+EAD++   +++ AI
Sbjct: 529 ALQKLFQDMLHSID-WMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAI 587



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/71 (28%), Positives = 44/71 (61%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL++ A++  ++R     E WL+E +  +  +++G DL +V+  +KKH  +E D +
Sbjct: 415 IRQEKLEQLARR--FDRKAAMRETWLNENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTA 472

Query: 72  SHAERIDAIRE 40
           ++ ER+ A+ +
Sbjct: 473 AYEERVRALED 483



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 24/74 (32%), Positives = 38/74 (51%)
 Frame = -3

Query: 258  FELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
            +E +  +L+   +  Q++R     E WL   E  L S D+G  + SV+ L K+H   E  
Sbjct: 1998 WEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASGDFGHTVDSVEKLIKRHEAFEKS 2057

Query: 78   VSSHAERIDAIREP 37
             +S AER  A+ +P
Sbjct: 2058 TASWAERFAALEKP 2071



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 21/70 (30%), Positives = 39/70 (55%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L+ +  + Q +R +ED  LW+ E      S DYG +L +VQ   KK+  L+ ++  H  
Sbjct: 1473 QLESSRAKLQISRDLEDETLWVEERLPLAQSADYGTNLQTVQLFMKKNQTLQNEILGHTP 1532

Query: 60   RIDAIREPGR 31
            R++ + + G+
Sbjct: 1533 RVEDVLQRGQ 1542



 Score = 43.2 bits (97), Expect = 7e-04
 Identities = 23/65 (35%), Positives = 39/65 (60%), Gaps = 3/65 (4%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD---VSS 70
           +L+++ +  ++   +++ E W+ E E    S DYGKDLTSV  LQ+KH   E +   + +
Sbjct: 632 QLEQSKRLWKFFWEMDEAESWIKEKEQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDA 691

Query: 69  HAERI 55
           H E+I
Sbjct: 692 HLEQI 696



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 18/68 (26%), Positives = 37/68 (54%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L E +Q Q + + ++D + WLS  +  + SED  + L   + L ++HA ++ ++  H + 
Sbjct: 1057 LGEVSQLQAFLQDLDDFQAWLSITQKAVASEDMPESLPEAEQLLQQHAGIKDEIDGHQDS 1116

Query: 57   IDAIREPG 34
               ++E G
Sbjct: 1117 YQRVKESG 1124



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 22/66 (33%), Positives = 38/66 (57%)
 Frame = -1

Query: 464  DDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELG 285
            D SY +  NL+ K  KHQ F  EL +++  ++ I A GK+L++ +      +S ++E L 
Sbjct: 1299 DVSYDEARNLHNKWLKHQAFVAELASHEGWLENIDAEGKQLMDEKPQFTALVSQKLEALH 1358

Query: 284  GIWERL 267
             +W+ L
Sbjct: 1359 RLWDEL 1364



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 19/46 (41%), Positives = 27/46 (58%)
 Frame = -3

Query: 192  DIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
            D+  W+S +E QL S+D GKDLTSV  +  K   +E  V+   E +
Sbjct: 1390 DLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEEL 1435



 Score = 38.3 bits (85), Expect = 0.021
 Identities = 18/70 (25%), Positives = 38/70 (54%)
 Frame = -1

Query: 422 QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*RE 243
           +KH+ FE EL+     +++I      ++  + F  PQI +R++E+   W++L   ++   
Sbjct: 677 RKHKAFEDELRGLDAHLEQIFQEAHGMVARKQFGHPQIEARIKEVSAQWDQLKDLAA--- 733

Query: 242 TSCRKRLNNS 213
             C+K L ++
Sbjct: 734 -FCKKNLQDA 742



 Score = 35.9 bits (79), Expect = 0.11
 Identities = 15/60 (25%), Positives = 34/60 (56%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*R 246
            ++K+Q  + E+  + PRV+++   G++L+E        +  R+  L   W+RL ++++ R
Sbjct: 1517 MKKNQTLQNEILGHTPRVEDVLQRGQQLVEAAEIDCQDLEERLGHLQSSWDRLREAAAGR 1576



 Score = 34.3 bits (75), Expect = 0.33
 Identities = 16/47 (34%), Positives = 25/47 (53%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LQ+A    Q+    +D++ WL +    L  ED G+D  + + L KKH
Sbjct: 739 LQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRALGKKH 785



 Score = 33.9 bits (74), Expect = 0.44
 Identities = 16/62 (25%), Positives = 31/62 (50%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L++A + QQY    ++ E W+ E E  ++S++  KD      + K+H   +  V  +  
Sbjct: 1579 RLRDANEAQQYYLDADEAEAWIGEQELYVISDEIPKDEEGAIVMLKRHLRQQRAVEDYGR 1638

Query: 60   RI 55
             I
Sbjct: 1639 NI 1640



 Score = 33.5 bits (73), Expect = 0.58
 Identities = 22/86 (25%), Positives = 38/86 (44%), Gaps = 1/86 (1%)
 Frame = -3

Query: 300  RGRAGRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTS 121
            +G+  ++      V E +  KL+      Q  R  +D+E W+SE E    S + G+D   
Sbjct: 1665 QGQVDKHYAGLKDVAEERKRKLENMYHLFQLKRETDDLEQWISEKELVASSPEMGQDFDH 1724

Query: 120  VQNLQKKHALLEADVSS-HAERIDAI 46
            V  L+ K      +  +   ER+D +
Sbjct: 1725 VTLLRDKFRDFARETGAIGQERVDNV 1750



 Score = 31.9 bits (69), Expect = 1.8
 Identities = 16/51 (31%), Positives = 31/51 (60%), Gaps = 1/51 (1%)
 Frame = -3

Query: 195  EDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
            E+   W+++    + S +D G+DL  +  +Q+K + LE DV++   R+DA+
Sbjct: 964  EETSKWITDKTKVVESTKDLGRDLAGIIAIQRKLSGLERDVAAIQARVDAL 1014



 Score = 30.7 bits (66), Expect = 4.1
 Identities = 23/104 (22%), Positives = 46/104 (44%), Gaps = 1/104 (0%)
 Frame = -3

Query: 354  RQASA*ARTFCSTSNIVSRGRAGRNM-GATGAVFELKGNKLQEAAQQQQYNRAVEDIELW 178
            +QA      F  + ++  R +A R +     A  +L+  +LQEA          +  ELW
Sbjct: 804  QQAQGFPEEFRDSPDVTHRLQALRELYQQVVAQADLRQQRLQEALDLYTVFGETDACELW 863

Query: 177  LSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
            + E E  L   +    L  ++ +Q +  +L+ ++ +   +ID +
Sbjct: 864  MGEKEKWLAEMEMPDTLEDLEVVQHRFDILDQEMKTLMTQIDGV 907


>AB209415-1|BAD92652.1| 2332|Homo sapiens spectrin, beta,
           erythrocytic (includes spherocytosis, clinical type I)
           variant protein.
          Length = 2332

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 21/60 (35%), Positives = 39/60 (65%)
 Frame = -3

Query: 225 AQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
           A Q+ +   +  I+ W+ E++  LLS ++GK L  V++L +KH L+EAD++   +++ AI
Sbjct: 533 ALQKLFQDMLHSID-WMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAI 591



 Score = 47.2 bits (107), Expect = 4e-05
 Identities = 21/71 (29%), Positives = 44/71 (61%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL++ A++  ++R     E WLSE +  +  +++G DL +V+  +KKH  +E D +
Sbjct: 419 IRQEKLEQLARR--FDRKAAMRETWLSENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTA 476

Query: 72  SHAERIDAIRE 40
           ++ ER+ A+ +
Sbjct: 477 AYEERVRALED 487



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 24/74 (32%), Positives = 38/74 (51%)
 Frame = -3

Query: 258  FELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
            +E +  +L+   +  Q++R     E WL   E  L S D+G  + SV+ L K+H   E  
Sbjct: 2002 WEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASGDFGHTVDSVEKLIKRHEAFEKS 2061

Query: 78   VSSHAERIDAIREP 37
             +S AER  A+ +P
Sbjct: 2062 TASWAERFAALEKP 2075



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 21/70 (30%), Positives = 39/70 (55%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L+ +  + Q +R +ED  LW+ E      S DYG +L +VQ   KK+  L+ ++  H  
Sbjct: 1477 QLESSRAKLQISRDLEDETLWVEERLPLAQSADYGTNLQTVQLFMKKNQTLQNEILGHTP 1536

Query: 60   RIDAIREPGR 31
            R++ + + G+
Sbjct: 1537 RVEDVLQRGQ 1546



 Score = 43.2 bits (97), Expect = 7e-04
 Identities = 23/65 (35%), Positives = 39/65 (60%), Gaps = 3/65 (4%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD---VSS 70
           +L+++ +  ++   +++ E W+ E E    S DYGKDLTSV  LQ+KH   E +   + +
Sbjct: 636 QLEQSKRLWKFFWEMDEAESWIKEKEQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDA 695

Query: 69  HAERI 55
           H E+I
Sbjct: 696 HLEQI 700



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 18/68 (26%), Positives = 37/68 (54%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L E +Q Q + + ++D + WLS  +  + SED  + L   + L ++HA ++ ++  H + 
Sbjct: 1061 LGEVSQLQAFLQDLDDFQAWLSITQKAVASEDMPESLPEAEQLLQQHAGIKDEIDGHQDS 1120

Query: 57   IDAIREPG 34
               ++E G
Sbjct: 1121 YQRVKESG 1128



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 22/66 (33%), Positives = 38/66 (57%)
 Frame = -1

Query: 464  DDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELG 285
            D SY +  NL+ K  KHQ F  EL +++  ++ I A GK+L++ +      +S ++E L 
Sbjct: 1303 DVSYDEARNLHNKWLKHQAFVAELASHEGWLENIDAEGKQLMDEKPQFTALVSQKLEALH 1362

Query: 284  GIWERL 267
             +W+ L
Sbjct: 1363 RLWDEL 1368



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 19/46 (41%), Positives = 27/46 (58%)
 Frame = -3

Query: 192  DIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
            D+  W+S +E QL S+D GKDLTSV  +  K   +E  V+   E +
Sbjct: 1394 DLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEEL 1439



 Score = 38.3 bits (85), Expect = 0.021
 Identities = 18/70 (25%), Positives = 38/70 (54%)
 Frame = -1

Query: 422 QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*RE 243
           +KH+ FE EL+     +++I      ++  + F  PQI +R++E+   W++L   ++   
Sbjct: 681 RKHKAFEDELRGLDAHLEQIFQEAHGMVARKQFGHPQIEARIKEVSAQWDQLKDLAA--- 737

Query: 242 TSCRKRLNNS 213
             C+K L ++
Sbjct: 738 -FCKKNLQDA 746



 Score = 35.9 bits (79), Expect = 0.11
 Identities = 15/60 (25%), Positives = 34/60 (56%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*R 246
            ++K+Q  + E+  + PRV+++   G++L+E        +  R+  L   W+RL ++++ R
Sbjct: 1521 MKKNQTLQNEILGHTPRVEDVLQRGQQLVEAAEIDCQDLEERLGHLQSSWDRLREAAAGR 1580



 Score = 34.3 bits (75), Expect = 0.33
 Identities = 16/47 (34%), Positives = 25/47 (53%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LQ+A    Q+    +D++ WL +    L  ED G+D  + + L KKH
Sbjct: 743 LQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRALGKKH 789



 Score = 33.9 bits (74), Expect = 0.44
 Identities = 16/62 (25%), Positives = 31/62 (50%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L++A + QQY    ++ E W+ E E  ++S++  KD      + K+H   +  V  +  
Sbjct: 1583 RLRDANEAQQYYLDADEAEAWIGEQELYVISDEIPKDEEGAIVMLKRHLRQQRAVEDYGR 1642

Query: 60   RI 55
             I
Sbjct: 1643 NI 1644



 Score = 33.5 bits (73), Expect = 0.58
 Identities = 22/86 (25%), Positives = 38/86 (44%), Gaps = 1/86 (1%)
 Frame = -3

Query: 300  RGRAGRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTS 121
            +G+  ++      V E +  KL+      Q  R  +D+E W+SE E    S + G+D   
Sbjct: 1669 QGQVDKHYAGLKDVAEERKRKLENMYHLFQLKRETDDLEQWISEKELVASSPEMGQDFDH 1728

Query: 120  VQNLQKKHALLEADVSS-HAERIDAI 46
            V  L+ K      +  +   ER+D +
Sbjct: 1729 VTLLRDKFRDFARETGAIGQERVDNV 1754



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 18/65 (27%), Positives = 35/65 (53%), Gaps = 1/65 (1%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +  A +   Y    E+   W+++    + S +D G+DL  +  +Q+K + LE DV++   
Sbjct: 954  VDSALRVHNYCVDCEETSKWITDKTKVVESTKDLGRDLAGIIAIQRKLSGLERDVAAIQA 1013

Query: 60   RIDAI 46
            R+DA+
Sbjct: 1014 RVDAL 1018



 Score = 30.7 bits (66), Expect = 4.1
 Identities = 23/104 (22%), Positives = 46/104 (44%), Gaps = 1/104 (0%)
 Frame = -3

Query: 354  RQASA*ARTFCSTSNIVSRGRAGRNM-GATGAVFELKGNKLQEAAQQQQYNRAVEDIELW 178
            +QA      F  + ++  R +A R +     A  +L+  +LQEA          +  ELW
Sbjct: 808  QQAQGFPEEFRDSPDVTHRLQALRELYQQVVAQADLRQQRLQEALDLYTVFGETDACELW 867

Query: 177  LSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
            + E E  L   +    L  ++ +Q +  +L+ ++ +   +ID +
Sbjct: 868  MGEKEKWLAEMEMPDTLEDLEVVQHRFDILDQEMKTLMTQIDGV 911


>BC139788-1|AAI39789.1|  934|Homo sapiens SPTBN2 protein protein.
          Length = 934

 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 19/45 (42%), Positives = 33/45 (73%)
 Frame = -3

Query: 180 WLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
           W+ E++G+L S+D G+ L  V++L + H L+EAD++  AER+ A+
Sbjct: 546 WMEEMKGRLQSQDLGRHLAGVEDLLQLHELVEADIAVQAERVRAV 590



 Score = 40.3 bits (90), Expect = 0.005
 Identities = 18/69 (26%), Positives = 41/69 (59%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL++ A +  ++R     E WLSE +  +  +++G +L +V+   +KH  +E D+ 
Sbjct: 418 IRQEKLEQLAAR--FDRKAAMRETWLSENQRLVSQDNFGLELAAVEAAVRKHEAIETDIV 475

Query: 72  SHAERIDAI 46
           +++ R+ A+
Sbjct: 476 AYSGRVQAV 484


>X59511-1|CAA42098.1|  229|Homo sapiens beta-spectrin protein.
          Length = 229

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 24/74 (32%), Positives = 38/74 (51%)
 Frame = -3

Query: 258 FELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
           +E +  +L+   +  Q++R     E WL   E  L S D+G  + SV+ L K+H   E  
Sbjct: 90  WEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASGDFGHTVDSVEKLIKRHEAFEKS 149

Query: 78  VSSHAERIDAIREP 37
            +S AER  A+ +P
Sbjct: 150 TASWAERFAALEKP 163


>M37884-1|AAA63259.1| 1274|Homo sapiens muscle beta spectrin protein.
          Length = 1274

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 24/74 (32%), Positives = 38/74 (51%)
 Frame = -3

Query: 258  FELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
            +E +  +L+   +  Q++R     E WL   E  L S D+G  + SV+ L K+H   E  
Sbjct: 944  WEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASGDFGHTVDSVEKLIKRHEAFEKS 1003

Query: 78   VSSHAERIDAIREP 37
             +S AER  A+ +P
Sbjct: 1004 TASWAERFAALEKP 1017



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 21/70 (30%), Positives = 39/70 (55%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+ +  + Q +R +ED  LW+ E      S DYG +L +VQ   KK+  L+ ++  H  
Sbjct: 419 QLESSRAKLQISRDLEDETLWVEERLPLAQSADYGTNLQTVQLFMKKNQTLQNEILGHTP 478

Query: 60  RIDAIREPGR 31
           R++ + + G+
Sbjct: 479 RVEDVLQRGQ 488



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 18/68 (26%), Positives = 37/68 (54%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L E +Q Q + + ++D + WLS  +  + SED  + L   + L ++HA ++ ++  H + 
Sbjct: 3   LGEVSQLQAFLQDLDDFQAWLSITQKAVASEDMPESLPEAEQLLQQHAGIKDEIDGHQDS 62

Query: 57  IDAIREPG 34
              ++E G
Sbjct: 63  YQRVKESG 70



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 22/66 (33%), Positives = 38/66 (57%)
 Frame = -1

Query: 464 DDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELG 285
           D SY +  NL+ K  KHQ F  EL +++  ++ I A GK+L++ +      +S ++E L 
Sbjct: 245 DVSYDEARNLHNKWLKHQAFVAELASHEGWLENIDAEGKQLMDEKPQFTALVSQKLEALH 304

Query: 284 GIWERL 267
            +W+ L
Sbjct: 305 RLWDEL 310



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 19/46 (41%), Positives = 27/46 (58%)
 Frame = -3

Query: 192 DIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
           D+  W+S +E QL S+D GKDLTSV  +  K   +E  V+   E +
Sbjct: 336 DLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEEL 381



 Score = 35.9 bits (79), Expect = 0.11
 Identities = 15/60 (25%), Positives = 34/60 (56%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*R 246
           ++K+Q  + E+  + PRV+++   G++L+E        +  R+  L   W+RL ++++ R
Sbjct: 463 MKKNQTLQNEILGHTPRVEDVLQRGQQLVEAAEIDCQDLEERLGHLQSSWDRLREAAAGR 522



 Score = 33.9 bits (74), Expect = 0.44
 Identities = 16/62 (25%), Positives = 31/62 (50%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L++A + QQY    ++ E W+ E E  ++S++  KD      + K+H   +  V  +  
Sbjct: 525 RLRDANEAQQYYLDADEAEAWIGEQELYVISDEIPKDEEGAIVMLKRHLRQQRAVEDYGR 584

Query: 60  RI 55
            I
Sbjct: 585 NI 586



 Score = 33.5 bits (73), Expect = 0.58
 Identities = 22/86 (25%), Positives = 38/86 (44%), Gaps = 1/86 (1%)
 Frame = -3

Query: 300 RGRAGRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTS 121
           +G+  ++      V E +  KL+      Q  R  +D+E W+SE E    S + G+D   
Sbjct: 611 QGQVDKHYAGLKDVAEERKRKLENMYHLFQLKRETDDLEQWISEKELVASSPEMGQDFDH 670

Query: 120 VQNLQKKHALLEADVSS-HAERIDAI 46
           V  L+ K      +  +   ER+D +
Sbjct: 671 VTLLRDKFRDFARETGAIGQERVDNV 696


>AF465439-1|AAL73492.1| 1028|Homo sapiens beta I spectrin form betaI
           sigma3 protein.
          Length = 1028

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 24/74 (32%), Positives = 38/74 (51%)
 Frame = -3

Query: 258 FELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
           +E +  +L+   +  Q++R     E WL   E  L S D+G  + SV+ L K+H   E  
Sbjct: 663 WEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASGDFGHTVDSVEKLIKRHEAFEKS 722

Query: 78  VSSHAERIDAIREP 37
            +S AER  A+ +P
Sbjct: 723 TASWAERFAALEKP 736



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 21/70 (30%), Positives = 39/70 (55%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+ +  + Q +R +ED  LW+ E      S DYG +L +VQ   KK+  L+ ++  H  
Sbjct: 138 QLESSRAKLQISRDLEDETLWVEERLPLAQSADYGTNLQTVQLFMKKNQTLQNEILGHTP 197

Query: 60  RIDAIREPGR 31
           R++ + + G+
Sbjct: 198 RVEDVLQRGQ 207



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 19/46 (41%), Positives = 27/46 (58%)
 Frame = -3

Query: 192 DIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
           D+  W+S +E QL S+D GKDLTSV  +  K   +E  V+   E +
Sbjct: 55  DLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEEL 100



 Score = 35.9 bits (79), Expect = 0.11
 Identities = 15/60 (25%), Positives = 34/60 (56%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*R 246
           ++K+Q  + E+  + PRV+++   G++L+E        +  R+  L   W+RL ++++ R
Sbjct: 182 MKKNQTLQNEILGHTPRVEDVLQRGQQLVEAAEIDCQDLEERLGHLQSSWDRLREAAAGR 241



 Score = 33.9 bits (74), Expect = 0.44
 Identities = 16/62 (25%), Positives = 31/62 (50%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L++A + QQY    ++ E W+ E E  ++S++  KD      + K+H   +  V  +  
Sbjct: 244 RLRDANEAQQYYLDADEAEAWIGEQELYVISDEIPKDEEGAIVMLKRHLRQQRAVEDYGR 303

Query: 60  RI 55
            I
Sbjct: 304 NI 305



 Score = 33.5 bits (73), Expect = 0.58
 Identities = 22/86 (25%), Positives = 38/86 (44%), Gaps = 1/86 (1%)
 Frame = -3

Query: 300 RGRAGRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTS 121
           +G+  ++      V E +  KL+      Q  R  +D+E W+SE E    S + G+D   
Sbjct: 330 QGQVDKHYAGLKDVAEERKRKLENMYHLFQLKRETDDLEQWISEKELVASSPEMGQDFDH 389

Query: 120 VQNLQKKHALLEADVSS-HAERIDAI 46
           V  L+ K      +  +   ER+D +
Sbjct: 390 VTLLRDKFRDFARETGAIGQERVDNV 415


>AF013187-1|AAC02793.1|  111|Homo sapiens beta-spectrin protein.
          Length = 111

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 24/74 (32%), Positives = 38/74 (51%)
 Frame = -3

Query: 258 FELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
           +E +  +L+   +  Q++R     E WL   E  L S D+G  + SV+ L K+H   E  
Sbjct: 19  WEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASGDFGHTVDSVEKLIKRHEAFEKS 78

Query: 78  VSSHAERIDAIREP 37
            +S AER  A+ +P
Sbjct: 79  TASWAERFAALEKP 92


>AF013177-1|AAC02789.1|  193|Homo sapiens beta-spectrin protein.
          Length = 193

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/71 (28%), Positives = 44/71 (61%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL++ A++  ++R     E WL+E +  +  +++G DL +V+  +KKH  +E D +
Sbjct: 60  IRQEKLEQLARR--FDRKAAMRETWLNENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTA 117

Query: 72  SHAERIDAIRE 40
           ++ ER+ A+ +
Sbjct: 118 AYEERVRALED 128


>M29994-1|AAA60575.1|  521|Homo sapiens SPTA1 protein.
          Length = 521

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 22/61 (36%), Positives = 35/61 (57%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L  AA  Q++ R V +   W+ E E  L SEDYGKDL + + L   H  LE +++  +++
Sbjct: 248 LSNAANLQRFKRDVTEAIQWIKEKEPVLTSEDYGKDLVASEGLFHSHKGLERNLAVMSDK 307

Query: 57  I 55
           +
Sbjct: 308 V 308



 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 2/58 (3%)
 Frame = -1

Query: 497 LGK--RES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELE 330
           LGK   E     TD SY DPTN+ GK QKHQ+ E E+Q     + E+    +    +E
Sbjct: 65  LGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERAHIE 122



 Score = 40.3 bits (90), Expect = 0.005
 Identities = 19/70 (27%), Positives = 38/70 (54%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           +G KL+++   Q + R  +D+  W+ E    L  + Y +D T++Q   +KH  LEA+V +
Sbjct: 45  RGQKLEDSYHLQVFKRDADDLGKWIMEKVNILTDKSY-EDPTNIQGKYQKHQSLEAEVQT 103

Query: 69  HAERIDAIRE 40
            +  +  + +
Sbjct: 104 KSRLMSELEK 113



 Score = 34.3 bits (75), Expect = 0.33
 Identities = 17/52 (32%), Positives = 27/52 (51%)
 Frame = -3

Query: 210 YNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
           + R  E ++ W+S  E  L +ED G  L S + L +KH   E   ++  E+I
Sbjct: 469 FYRDSEQVDSWMSRQEAFLENEDLGNSLGSAEALLQKHEDFEEAFTAQEEKI 520



 Score = 33.5 bits (73), Expect = 0.58
 Identities = 18/70 (25%), Positives = 34/70 (48%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG++L  A + QQY +   DI  W+ + E    S + G+D    + L KK    + ++ +
Sbjct: 138 KGDQLLRALKFQQYVQECADILEWIGDKEAIATSVELGEDWERTEVLHKKFEDFQVELVA 197

Query: 69  HAERIDAIRE 40
              R+  + +
Sbjct: 198 KEGRVVEVNQ 207



 Score = 29.5 bits (63), Expect = 9.5
 Identities = 17/67 (25%), Positives = 27/67 (40%)
 Frame = -1

Query: 467 TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           ++D   D     G    H+  E+ L     +V E+ A  ++L        PQI    E+L
Sbjct: 277 SEDYGKDLVASEGLFHSHKGLERNLAVMSDKVKELCAKAEKLTLSHPSDAPQIQEMKEDL 336

Query: 287 GGIWERL 267
              WE +
Sbjct: 337 VSSWEHI 343


>EF151925-1|ABL96684.1|   65|Homo sapiens beta-spectrin protein.
          Length = 65

 Score = 43.2 bits (97), Expect = 7e-04
 Identities = 22/59 (37%), Positives = 31/59 (52%)
 Frame = -3

Query: 213 QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREP 37
           Q++R     E WL   E  L S D+G  + SV+ L K+H   E   +S AER  A+ +P
Sbjct: 5   QFSRDASVAEAWLIAQEPYLASGDFGHTVDSVEKLIKRHEPFEKSTASWAERFAALEKP 63


>AF013178-1|AAC02790.1|  289|Homo sapiens beta-spectrin protein.
          Length = 289

 Score = 43.2 bits (97), Expect = 7e-04
 Identities = 23/65 (35%), Positives = 39/65 (60%), Gaps = 3/65 (4%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD---VSS 70
           +L+++ +  ++   +++ E W+ E E    S DYGKDLTSV  LQ+KH   E +   + +
Sbjct: 33  QLEQSKRLWKFFWEMDEAESWIKEKEQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDA 92

Query: 69  HAERI 55
           H E+I
Sbjct: 93  HLEQI 97



 Score = 38.3 bits (85), Expect = 0.021
 Identities = 18/70 (25%), Positives = 38/70 (54%)
 Frame = -1

Query: 422 QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*RE 243
           +KH+ FE EL+     +++I      ++  + F  PQI +R++E+   W++L   ++   
Sbjct: 78  RKHKAFEDELRGLDAHLEQIFQEAHGMVARKQFGHPQIEARIKEVSAQWDQLKDLAA--- 134

Query: 242 TSCRKRLNNS 213
             C+K L ++
Sbjct: 135 -FCKKNLQDA 143



 Score = 34.3 bits (75), Expect = 0.33
 Identities = 16/47 (34%), Positives = 25/47 (53%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LQ+A    Q+    +D++ WL +    L  ED G+D  + + L KKH
Sbjct: 140 LQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRALGKKH 186


>AF013181-1|AAC02791.1|  399|Homo sapiens beta-spectrin protein.
          Length = 399

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 18/68 (26%), Positives = 37/68 (54%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L E +Q Q + + ++D + WLS  +  + SED  + L   + L ++HA ++ ++  H + 
Sbjct: 122 LGEVSQLQAFLQDLDDFQAWLSITQKAVASEDMPESLPEAEQLLQQHAGIKDEIDGHQDS 181

Query: 57  IDAIREPG 34
              ++E G
Sbjct: 182 YQRVKESG 189



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 18/65 (27%), Positives = 35/65 (53%), Gaps = 1/65 (1%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +  A +   Y    E+   W+++    + S +D G+DL  +  +Q+K + LE DV++   
Sbjct: 15  VDSALRVHNYCVDCEETSKWITDKTKVVESTKDLGRDLAGIIAIQRKLSGLERDVAAIQA 74

Query: 60  RIDAI 46
           R+DA+
Sbjct: 75  RVDAL 79


>M18054-1|AAA60572.1|  274|Homo sapiens SPTB protein.
          Length = 274

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 22/66 (33%), Positives = 38/66 (57%)
 Frame = -1

Query: 464 DDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELG 285
           D SY +  NL+ K  KHQ F  EL +++  ++ I A GK+L++ +      +S ++E L 
Sbjct: 91  DVSYDEARNLHNKWLKHQAFVAELASHEGWLENIDAEGKQLMDEKPQFTALVSQKLEALH 150

Query: 284 GIWERL 267
            +W+ L
Sbjct: 151 RLWDEL 156



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 19/46 (41%), Positives = 27/46 (58%)
 Frame = -3

Query: 192 DIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
           D+  W+S +E QL S+D GKDLTSV  +  K   +E  V+   E +
Sbjct: 182 DLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEEL 227


>X59510-1|CAA42097.1|   99|Homo sapiens beta-spectrin protein.
          Length = 99

 Score = 38.3 bits (85), Expect = 0.021
 Identities = 21/59 (35%), Positives = 30/59 (50%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           K  +L  A       +   D+  W+S +E QL S+D GKDLTSV  +  K   +E  V+
Sbjct: 38  KTQRLSAARSSDLRLQTHADLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVN 96


>M86406-1|AAA51583.1|  894|Homo sapiens alpha-actinin protein.
          Length = 894

 Score = 37.9 bits (84), Expect = 0.027
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 1/58 (1%)
 Frame = -3

Query: 216 QQYNRAVEDIELWLSEVEGQLLSEDY-GKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
           +++ +     E W    E  LL +DY    LT V+ L +KH   E+D+++H +R++ I
Sbjct: 404 EKFRQKASTHETWAYGKEQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQI 461


>BC051770-1|AAH51770.2|  894|Homo sapiens actinin, alpha 2 protein.
          Length = 894

 Score = 37.9 bits (84), Expect = 0.027
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 1/58 (1%)
 Frame = -3

Query: 216 QQYNRAVEDIELWLSEVEGQLLSEDY-GKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
           +++ +     E W    E  LL +DY    LT V+ L +KH   E+D+++H +R++ I
Sbjct: 404 EKFRQKASTHETWAYGKEQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQI 461


>BC047901-1|AAH47901.2|  894|Homo sapiens actinin, alpha 2 protein.
          Length = 894

 Score = 37.9 bits (84), Expect = 0.027
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 1/58 (1%)
 Frame = -3

Query: 216 QQYNRAVEDIELWLSEVEGQLLSEDY-GKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
           +++ +     E W    E  LL +DY    LT V+ L +KH   E+D+++H +R++ I
Sbjct: 404 EKFRQKASTHETWAYGKEQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQI 461


>AL359921-13|CAI13778.1|  894|Homo sapiens actinin, alpha 2 protein.
          Length = 894

 Score = 37.9 bits (84), Expect = 0.027
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 1/58 (1%)
 Frame = -3

Query: 216 QQYNRAVEDIELWLSEVEGQLLSEDY-GKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
           +++ +     E W    E  LL +DY    LT V+ L +KH   E+D+++H +R++ I
Sbjct: 404 EKFRQKASTHETWAYGKEQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQI 461


>AL359185-4|CAH73201.1|  894|Homo sapiens actinin, alpha 2 protein.
          Length = 894

 Score = 37.9 bits (84), Expect = 0.027
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 1/58 (1%)
 Frame = -3

Query: 216 QQYNRAVEDIELWLSEVEGQLLSEDY-GKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
           +++ +     E W    E  LL +DY    LT V+ L +KH   E+D+++H +R++ I
Sbjct: 404 EKFRQKASTHETWAYGKEQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQI 461


>AJ249756-1|CAB61269.1|  894|Homo sapiens alpha-actinin 2 protein
           protein.
          Length = 894

 Score = 37.9 bits (84), Expect = 0.027
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 1/58 (1%)
 Frame = -3

Query: 216 QQYNRAVEDIELWLSEVEGQLLSEDY-GKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
           +++ +     E W    E  LL +DY    LT V+ L +KH   E+D+++H +R++ I
Sbjct: 404 EKFRQKASTHETWAYGKEQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQI 461


>AB209521-1|BAD92758.1|  664|Homo sapiens actinin, alpha 2 variant
           protein.
          Length = 664

 Score = 37.9 bits (84), Expect = 0.027
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 1/58 (1%)
 Frame = -3

Query: 216 QQYNRAVEDIELWLSEVEGQLLSEDY-GKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
           +++ +     E W    E  LL +DY    LT V+ L +KH   E+D+++H +R++ I
Sbjct: 174 EKFRQKASTHETWAYGKEQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQI 231


>Z54367-1|CAA91196.1| 4684|Homo sapiens plectin protein.
          Length = 4684

 Score = 36.3 bits (80), Expect = 0.083
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = -1

Query: 443 TNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLV 264
           TN+  K + +    +EL+  + ++ E+   G RLL  +H A+P + S    L   W  ++
Sbjct: 786 TNMTAKKESYSALMRELELKEKKIKELQNAGDRLLREDHPARPTVESFQAALQTQWSWML 845

Query: 263 Q 261
           Q
Sbjct: 846 Q 846


>U63610-1|AAB05428.1| 4574|Homo sapiens plectin protein.
          Length = 4574

 Score = 36.3 bits (80), Expect = 0.083
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = -1

Query: 443 TNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLV 264
           TN+  K + +    +EL+  + ++ E+   G RLL  +H A+P + S    L   W  ++
Sbjct: 676 TNMTAKKESYSALMRELELKEKKIKELQNAGDRLLREDHPARPTVESFQAALQTQWSWML 735

Query: 263 Q 261
           Q
Sbjct: 736 Q 736


>U53204-1|AAB05427.1| 4574|Homo sapiens plectin protein.
          Length = 4574

 Score = 36.3 bits (80), Expect = 0.083
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = -1

Query: 443 TNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLV 264
           TN+  K + +    +EL+  + ++ E+   G RLL  +H A+P + S    L   W  ++
Sbjct: 676 TNMTAKKESYSALMRELELKEKKIKELQNAGDRLLREDHPARPTVESFQAALQTQWSWML 735

Query: 263 Q 261
           Q
Sbjct: 736 Q 736


>AY480051-1|AAR95684.1| 4547|Homo sapiens plectin 11 protein.
          Length = 4547

 Score = 36.3 bits (80), Expect = 0.083
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = -1

Query: 443 TNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLV 264
           TN+  K + +    +EL+  + ++ E+   G RLL  +H A+P + S    L   W  ++
Sbjct: 649 TNMTAKKESYSALMRELELKEKKIKELQNAGDRLLREDHPARPTVESFQAALQTQWSWML 708

Query: 263 Q 261
           Q
Sbjct: 709 Q 709


>AY480050-1|AAR95683.1| 4551|Homo sapiens plectin 10 protein.
          Length = 4551

 Score = 36.3 bits (80), Expect = 0.083
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = -1

Query: 443 TNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLV 264
           TN+  K + +    +EL+  + ++ E+   G RLL  +H A+P + S    L   W  ++
Sbjct: 653 TNMTAKKESYSALMRELELKEKKIKELQNAGDRLLREDHPARPTVESFQAALQTQWSWML 712

Query: 263 Q 261
           Q
Sbjct: 713 Q 713


>AY480049-1|AAR95682.1| 4547|Homo sapiens plectin 8 protein.
          Length = 4547

 Score = 36.3 bits (80), Expect = 0.083
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = -1

Query: 443 TNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLV 264
           TN+  K + +    +EL+  + ++ E+   G RLL  +H A+P + S    L   W  ++
Sbjct: 649 TNMTAKKESYSALMRELELKEKKIKELQNAGDRLLREDHPARPTVESFQAALQTQWSWML 708

Query: 263 Q 261
           Q
Sbjct: 709 Q 709


>AY480048-1|AAR95681.1| 4515|Homo sapiens plectin 7 protein.
          Length = 4515

 Score = 36.3 bits (80), Expect = 0.083
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = -1

Query: 443 TNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLV 264
           TN+  K + +    +EL+  + ++ E+   G RLL  +H A+P + S    L   W  ++
Sbjct: 617 TNMTAKKESYSALMRELELKEKKIKELQNAGDRLLREDHPARPTVESFQAALQTQWSWML 676

Query: 263 Q 261
           Q
Sbjct: 677 Q 677


>AY480047-1|AAR95680.1| 4684|Homo sapiens plectin 6 protein.
          Length = 4684

 Score = 36.3 bits (80), Expect = 0.083
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = -1

Query: 443 TNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLV 264
           TN+  K + +    +EL+  + ++ E+   G RLL  +H A+P + S    L   W  ++
Sbjct: 786 TNMTAKKESYSALMRELELKEKKIKELQNAGDRLLREDHPARPTVESFQAALQTQWSWML 845

Query: 263 Q 261
           Q
Sbjct: 846 Q 846


>AY480046-1|AAR95679.1| 4525|Homo sapiens plectin 3 protein.
          Length = 4525

 Score = 36.3 bits (80), Expect = 0.083
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = -1

Query: 443 TNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLV 264
           TN+  K + +    +EL+  + ++ E+   G RLL  +H A+P + S    L   W  ++
Sbjct: 627 TNMTAKKESYSALMRELELKEKKIKELQNAGDRLLREDHPARPTVESFQAALQTQWSWML 686

Query: 263 Q 261
           Q
Sbjct: 687 Q 687


>AY480045-1|AAR95678.1| 4533|Homo sapiens plectin 2 protein.
          Length = 4533

 Score = 36.3 bits (80), Expect = 0.083
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = -1

Query: 443 TNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLV 264
           TN+  K + +    +EL+  + ++ E+   G RLL  +H A+P + S    L   W  ++
Sbjct: 635 TNMTAKKESYSALMRELELKEKKIKELQNAGDRLLREDHPARPTVESFQAALQTQWSWML 694

Query: 263 Q 261
           Q
Sbjct: 695 Q 695


>AY480044-1|AAR95677.1| 4574|Homo sapiens plectin 1 protein.
          Length = 4574

 Score = 36.3 bits (80), Expect = 0.083
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = -1

Query: 443 TNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLV 264
           TN+  K + +    +EL+  + ++ E+   G RLL  +H A+P + S    L   W  ++
Sbjct: 676 TNMTAKKESYSALMRELELKEKKIKELQNAGDRLLREDHPARPTVESFQAALQTQWSWML 735

Query: 263 Q 261
           Q
Sbjct: 736 Q 736


>X55187-1|CAA38970.1|  596|Homo sapiens alpha-actinin protein.
          Length = 596

 Score = 35.5 bits (78), Expect = 0.14
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = -3

Query: 186 ELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEADVSSHAERIDAI 46
           E W    E  L  +DY    L+ ++ L KKH   E+D+++H +R++ I
Sbjct: 111 EAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQI 158


>X15804-1|CAA33803.1|  892|Homo sapiens protein ( Human mRNA for
           alpha-actinin. ).
          Length = 892

 Score = 35.5 bits (78), Expect = 0.14
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = -3

Query: 186 ELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEADVSSHAERIDAI 46
           E W    E  L  +DY    L+ ++ L KKH   E+D+++H +R++ I
Sbjct: 407 EAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQI 454


>M95178-1|AAA51582.1|  892|Homo sapiens alpha-actinin protein.
          Length = 892

 Score = 35.5 bits (78), Expect = 0.14
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = -3

Query: 186 ELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEADVSSHAERIDAI 46
           E W    E  L  +DY    L+ ++ L KKH   E+D+++H +R++ I
Sbjct: 407 EAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQI 454


>DQ496098-1|ABF50047.1|  914|Homo sapiens actinin alpha 1 isoform b
           protein.
          Length = 914

 Score = 35.5 bits (78), Expect = 0.14
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = -3

Query: 186 ELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEADVSSHAERIDAI 46
           E W    E  L  +DY    L+ ++ L KKH   E+D+++H +R++ I
Sbjct: 407 EAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQI 454


>BT007207-1|AAP35871.1|  892|Homo sapiens actinin, alpha 1 protein.
          Length = 892

 Score = 35.5 bits (78), Expect = 0.14
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = -3

Query: 186 ELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEADVSSHAERIDAI 46
           E W    E  L  +DY    L+ ++ L KKH   E+D+++H +R++ I
Sbjct: 407 EAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQI 454


>BC015766-1|AAH15766.1|  892|Homo sapiens actinin, alpha 1 protein.
          Length = 892

 Score = 35.5 bits (78), Expect = 0.14
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = -3

Query: 186 ELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEADVSSHAERIDAI 46
           E W    E  L  +DY    L+ ++ L KKH   E+D+++H +R++ I
Sbjct: 407 EAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQI 454


>BC003576-1|AAH03576.1|  892|Homo sapiens actinin, alpha 1 protein.
          Length = 892

 Score = 35.5 bits (78), Expect = 0.14
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = -3

Query: 186 ELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEADVSSHAERIDAI 46
           E W    E  L  +DY    L+ ++ L KKH   E+D+++H +R++ I
Sbjct: 407 EAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQI 454


>AL442071-4|CAH73671.1| 5938|Homo sapiens microtubule-actin
            crosslinking factor 1 protein.
          Length = 5938

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ-PQISSRVEELGGIWE 273
            DP  +  ++ KH   + ++ A++  V+ +   G  LLE         + SR+E +   WE
Sbjct: 4799 DPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLEAMNQCWE 4858

Query: 272  RLVQSSS*RETSCRKRLNNS 213
             ++Q +  RE   +  L  +
Sbjct: 4859 SVLQKTEEREQQLQSTLQQA 4878


>AL442071-2|CAH73669.1| 4433|Homo sapiens microtubule-actin
            crosslinking factor 1 protein.
          Length = 4433

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ-PQISSRVEELGGIWE 273
            DP  +  ++ KH   + ++ A++  V+ +   G  LLE         + SR+E +   WE
Sbjct: 3300 DPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLEAMNQCWE 3359

Query: 272  RLVQSSS*RETSCRKRLNNS 213
             ++Q +  RE   +  L  +
Sbjct: 3360 SVLQKTEEREQQLQSTLQQA 3379


>AL442071-1|CAH73668.1| 5430|Homo sapiens microtubule-actin
            crosslinking factor 1 protein.
          Length = 5430

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ-PQISSRVEELGGIWE 273
            DP  +  ++ KH   + ++ A++  V+ +   G  LLE         + SR+E +   WE
Sbjct: 4297 DPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLEAMNQCWE 4356

Query: 272  RLVQSSS*RETSCRKRLNNS 213
             ++Q +  RE   +  L  +
Sbjct: 4357 SVLQKTEEREQQLQSTLQQA 4376


>AL365277-12|CAI16422.1| 5938|Homo sapiens microtubule-actin
            crosslinking factor 1 protein.
          Length = 5938

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ-PQISSRVEELGGIWE 273
            DP  +  ++ KH   + ++ A++  V+ +   G  LLE         + SR+E +   WE
Sbjct: 4799 DPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLEAMNQCWE 4858

Query: 272  RLVQSSS*RETSCRKRLNNS 213
             ++Q +  RE   +  L  +
Sbjct: 4859 SVLQKTEEREQQLQSTLQQA 4878


>AL365277-10|CAI16420.1| 4433|Homo sapiens microtubule-actin
            crosslinking factor 1 protein.
          Length = 4433

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ-PQISSRVEELGGIWE 273
            DP  +  ++ KH   + ++ A++  V+ +   G  LLE         + SR+E +   WE
Sbjct: 3300 DPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLEAMNQCWE 3359

Query: 272  RLVQSSS*RETSCRKRLNNS 213
             ++Q +  RE   +  L  +
Sbjct: 3360 SVLQKTEEREQQLQSTLQQA 3379


>AL365277-7|CAI16417.1| 5430|Homo sapiens microtubule-actin
            crosslinking factor 1 protein.
          Length = 5430

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ-PQISSRVEELGGIWE 273
            DP  +  ++ KH   + ++ A++  V+ +   G  LLE         + SR+E +   WE
Sbjct: 4297 DPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLEAMNQCWE 4356

Query: 272  RLVQSSS*RETSCRKRLNNS 213
             ++Q +  RE   +  L  +
Sbjct: 4357 SVLQKTEEREQQLQSTLQQA 4376


>AL355477-1|CAH70156.1| 5430|Homo sapiens microtubule-actin
            crosslinking factor 1 protein.
          Length = 5430

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ-PQISSRVEELGGIWE 273
            DP  +  ++ KH   + ++ A++  V+ +   G  LLE         + SR+E +   WE
Sbjct: 4297 DPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLEAMNQCWE 4356

Query: 272  RLVQSSS*RETSCRKRLNNS 213
             ++Q +  RE   +  L  +
Sbjct: 4357 SVLQKTEEREQQLQSTLQQA 4376


>AL137853-3|CAI21816.1| 5938|Homo sapiens microtubule-actin
            crosslinking factor 1 protein.
          Length = 5938

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ-PQISSRVEELGGIWE 273
            DP  +  ++ KH   + ++ A++  V+ +   G  LLE         + SR+E +   WE
Sbjct: 4799 DPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLEAMNQCWE 4858

Query: 272  RLVQSSS*RETSCRKRLNNS 213
             ++Q +  RE   +  L  +
Sbjct: 4859 SVLQKTEEREQQLQSTLQQA 4878


>AL137853-2|CAI21815.1| 4433|Homo sapiens microtubule-actin
            crosslinking factor 1 protein.
          Length = 4433

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ-PQISSRVEELGGIWE 273
            DP  +  ++ KH   + ++ A++  V+ +   G  LLE         + SR+E +   WE
Sbjct: 3300 DPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLEAMNQCWE 3359

Query: 272  RLVQSSS*RETSCRKRLNNS 213
             ++Q +  RE   +  L  +
Sbjct: 3360 SVLQKTEEREQQLQSTLQQA 3379


>AL137853-1|CAI21814.1| 5430|Homo sapiens microtubule-actin
            crosslinking factor 1 protein.
          Length = 5430

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ-PQISSRVEELGGIWE 273
            DP  +  ++ KH   + ++ A++  V+ +   G  LLE         + SR+E +   WE
Sbjct: 4297 DPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLEAMNQCWE 4356

Query: 272  RLVQSSS*RETSCRKRLNNS 213
             ++Q +  RE   +  L  +
Sbjct: 4357 SVLQKTEEREQQLQSTLQQA 4376


>AF325341-2|AAL38997.1| 5314|Homo sapiens macrophin 1 isoform 4
            protein.
          Length = 5314

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ-PQISSRVEELGGIWE 273
            DP  +  ++ KH   + ++ A++  V+ +   G  LLE         + SR+E +   WE
Sbjct: 4799 DPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLEAMNQCWE 4858

Query: 272  RLVQSSS*RETSCRKRLNNS 213
             ++Q +  RE   +  L  +
Sbjct: 4859 SVLQKTEEREQQLQSTLQQA 4878


>AF325341-1|AAL39000.1| 4631|Homo sapiens macrophin 1 isoform 2
            protein.
          Length = 4631

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ-PQISSRVEELGGIWE 273
            DP  +  ++ KH   + ++ A++  V+ +   G  LLE         + SR+E +   WE
Sbjct: 4116 DPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLEAMNQCWE 4175

Query: 272  RLVQSSS*RETSCRKRLNNS 213
             ++Q +  RE   +  L  +
Sbjct: 4176 SVLQKTEEREQQLQSTLQQA 4195


>AF317696-1|AAL09459.1| 5938|Homo sapiens macrophin 1 isoform 4
            protein.
          Length = 5938

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ-PQISSRVEELGGIWE 273
            DP  +  ++ KH   + ++ A++  V+ +   G  LLE         + SR+E +   WE
Sbjct: 4799 DPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLEAMNQCWE 4858

Query: 272  RLVQSSS*RETSCRKRLNNS 213
             ++Q +  RE   +  L  +
Sbjct: 4859 SVLQKTEEREQQLQSTLQQA 4878


>AF141968-1|AAF06360.1| 5373|Homo sapiens trabeculin-alpha protein.
          Length = 5373

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ-PQISSRVEELGGIWE 273
            DP  +  ++ KH   + ++ A++  V+ +   G  LLE         + SR+E +   WE
Sbjct: 4241 DPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLEAMNQCWE 4300

Query: 272  RLVQSSS*RETSCRKRLNNS 213
             ++Q +  RE   +  L  +
Sbjct: 4301 SVLQKTEEREQQLQSTLQQA 4320


>AB029290-1|BAA83821.1| 5430|Homo sapiens actin binding protein ABP620
            protein.
          Length = 5430

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ-PQISSRVEELGGIWE 273
            DP  +  ++ KH   + ++ A++  V+ +   G  LLE         + SR+E +   WE
Sbjct: 4297 DPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLEAMNQCWE 4356

Query: 272  RLVQSSS*RETSCRKRLNNS 213
             ++Q +  RE   +  L  +
Sbjct: 4357 SVLQKTEEREQQLQSTLQQA 4376


>AB007934-1|BAA32310.3| 4433|Homo sapiens KIAA0465 protein protein.
          Length = 4433

 Score = 34.7 bits (76), Expect = 0.25
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ-PQISSRVEELGGIWE 273
            DP  +  ++ KH   + ++ A++  V+ +   G  LLE         + SR+E +   WE
Sbjct: 3300 DPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLEAMNQCWE 3359

Query: 272  RLVQSSS*RETSCRKRLNNS 213
             ++Q +  RE   +  L  +
Sbjct: 3360 SVLQKTEEREQQLQSTLQQA 3379


>AF013184-1|AAC02792.1|  237|Homo sapiens beta-spectrin protein.
          Length = 237

 Score = 33.5 bits (73), Expect = 0.58
 Identities = 22/86 (25%), Positives = 38/86 (44%), Gaps = 1/86 (1%)
 Frame = -3

Query: 300 RGRAGRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTS 121
           +G+  ++      V E +  KL+      Q  R  +D+E W+SE E    S + G+D   
Sbjct: 51  QGQVDKHYAGLKDVAEERKRKLENMYHLFQLKRETDDLEQWISEKELVASSPEMGQDFDH 110

Query: 120 VQNLQKKHALLEADVSS-HAERIDAI 46
           V  L+ K      +  +   ER+D +
Sbjct: 111 VTLLRDKFRDFARETGAIGQERVDNV 136


>U48734-1|AAC17470.1|  912|Homo sapiens alpha actinin protein.
          Length = 912

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = -3

Query: 186 ELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEADVSSHAERIDAI 46
           E W    E  L   DY    L+ ++ L +KH   E+D+++H +R++ I
Sbjct: 428 EAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQI 475


>L11690-1|AAA52288.1| 2649|Homo sapiens bullous pemphigoid antigen
           protein.
          Length = 2649

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN-RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LK + L +   +++ N + V+D+  W+ E++ QL   ++G DL SV++  + H
Sbjct: 263 LKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENH 315


>D89980-1|BAA24447.1|  884|Homo sapiens alpha actinin 4 protein.
          Length = 884

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = -3

Query: 186 ELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEADVSSHAERIDAI 46
           E W    E  L   DY    L+ ++ L +KH   E+D+++H +R++ I
Sbjct: 399 EAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQI 446


>BC065536-1|AAH65536.1| 1143|Homo sapiens DST protein protein.
          Length = 1143

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN-RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LK + L +   +++ N + V+D+  W+ E++ QL   ++G DL SV++  + H
Sbjct: 263 LKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENH 315


>BC015620-1|AAH15620.2|  634|Homo sapiens ACTN4 protein protein.
          Length = 634

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = -3

Query: 186 ELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEADVSSHAERIDAI 46
           E W    E  L   DY    L+ ++ L +KH   E+D+++H +R++ I
Sbjct: 149 EAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQI 196


>BC005033-1|AAH05033.1|  911|Homo sapiens actinin, alpha 4 protein.
          Length = 911

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = -3

Query: 186 ELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEADVSSHAERIDAI 46
           E W    E  L   DY    L+ ++ L +KH   E+D+++H +R++ I
Sbjct: 426 EAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQI 473


>AL590005-3|CAI14988.1| 5457|Homo sapiens dystonin protein.
          Length = 5457

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN-RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LK + L +   +++ N + V+D+  W+ E++ QL   ++G DL SV++  + H
Sbjct: 589 LKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENH 641



 Score = 32.7 bits (71), Expect = 1.0
 Identities = 14/55 (25%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = -3

Query: 216  QQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
            QQ++  +E +  WL+ +E +L++ E  G   + ++    +H  LE D+ +H + +
Sbjct: 3418 QQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHL 3472



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLL 339
            +DP  LN + Q+ Q   QE    KP+ +++TA G+ +L
Sbjct: 2570 IDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAGQGIL 2607


>AL590005-2|CAI14989.1| 7543|Homo sapiens dystonin protein.
          Length = 7543

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN-RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LK + L +   +++ N + V+D+  W+ E++ QL   ++G DL SV++  + H
Sbjct: 589 LKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENH 641



 Score = 32.7 bits (71), Expect = 1.0
 Identities = 14/55 (25%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = -3

Query: 216  QQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
            QQ++  +E +  WL+ +E +L++ E  G   + ++    +H  LE D+ +H + +
Sbjct: 5504 QQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHL 5558



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLL 339
            +DP  LN + Q+ Q   QE    KP+ +++TA G+ +L
Sbjct: 4656 IDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAGQGIL 4693


>AL512448-3|CAI16610.1| 5144|Homo sapiens dystonin protein.
          Length = 5144

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN-RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LK + L +   +++ N + V+D+  W+ E++ QL   ++G DL SV++  + H
Sbjct: 263 LKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENH 315



 Score = 32.7 bits (71), Expect = 1.0
 Identities = 14/55 (25%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = -3

Query: 216  QQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
            QQ++  +E +  WL+ +E +L++ E  G   + ++    +H  LE D+ +H + +
Sbjct: 3092 QQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHL 3146



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLL 339
            +DP  LN + Q+ Q   QE    KP+ +++TA G+ +L
Sbjct: 2244 IDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAGQGIL 2281


>AL512448-2|CAI16608.1| 5457|Homo sapiens dystonin protein.
          Length = 5457

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN-RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LK + L +   +++ N + V+D+  W+ E++ QL   ++G DL SV++  + H
Sbjct: 589 LKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENH 641



 Score = 32.7 bits (71), Expect = 1.0
 Identities = 14/55 (25%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = -3

Query: 216  QQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
            QQ++  +E +  WL+ +E +L++ E  G   + ++    +H  LE D+ +H + +
Sbjct: 3418 QQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHL 3472



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLL 339
            +DP  LN + Q+ Q   QE    KP+ +++TA G+ +L
Sbjct: 2570 IDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAGQGIL 2607


>AL512448-1|CAI16609.1| 7543|Homo sapiens dystonin protein.
          Length = 7543

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN-RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LK + L +   +++ N + V+D+  W+ E++ QL   ++G DL SV++  + H
Sbjct: 589 LKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENH 641



 Score = 32.7 bits (71), Expect = 1.0
 Identities = 14/55 (25%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = -3

Query: 216  QQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
            QQ++  +E +  WL+ +E +L++ E  G   + ++    +H  LE D+ +H + +
Sbjct: 5504 QQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHL 5558



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLL 339
            +DP  LN + Q+ Q   QE    KP+ +++TA G+ +L
Sbjct: 4656 IDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAGQGIL 4693


>AL512422-3|CAI14342.1| 5457|Homo sapiens dystonin protein.
          Length = 5457

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN-RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LK + L +   +++ N + V+D+  W+ E++ QL   ++G DL SV++  + H
Sbjct: 589 LKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENH 641



 Score = 32.7 bits (71), Expect = 1.0
 Identities = 14/55 (25%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = -3

Query: 216  QQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
            QQ++  +E +  WL+ +E +L++ E  G   + ++    +H  LE D+ +H + +
Sbjct: 3418 QQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHL 3472



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLL 339
            +DP  LN + Q+ Q   QE    KP+ +++TA G+ +L
Sbjct: 2570 IDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAGQGIL 2607


>AL512422-2|CAI14341.1| 7543|Homo sapiens dystonin protein.
          Length = 7543

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN-RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LK + L +   +++ N + V+D+  W+ E++ QL   ++G DL SV++  + H
Sbjct: 589 LKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENH 641



 Score = 32.7 bits (71), Expect = 1.0
 Identities = 14/55 (25%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = -3

Query: 216  QQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
            QQ++  +E +  WL+ +E +L++ E  G   + ++    +H  LE D+ +H + +
Sbjct: 5504 QQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHL 5558



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLL 339
            +DP  LN + Q+ Q   QE    KP+ +++TA G+ +L
Sbjct: 4656 IDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAGQGIL 4693


>AL137008-4|CAI20332.1| 5144|Homo sapiens dystonin protein.
          Length = 5144

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN-RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LK + L +   +++ N + V+D+  W+ E++ QL   ++G DL SV++  + H
Sbjct: 263 LKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENH 315



 Score = 32.7 bits (71), Expect = 1.0
 Identities = 14/55 (25%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = -3

Query: 216  QQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
            QQ++  +E +  WL+ +E +L++ E  G   + ++    +H  LE D+ +H + +
Sbjct: 3092 QQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHL 3146



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLL 339
            +DP  LN + Q+ Q   QE    KP+ +++TA G+ +L
Sbjct: 2244 IDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAGQGIL 2281


>AL137008-3|CAI20331.1| 5457|Homo sapiens dystonin protein.
          Length = 5457

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN-RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LK + L +   +++ N + V+D+  W+ E++ QL   ++G DL SV++  + H
Sbjct: 589 LKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENH 641



 Score = 32.7 bits (71), Expect = 1.0
 Identities = 14/55 (25%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = -3

Query: 216  QQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
            QQ++  +E +  WL+ +E +L++ E  G   + ++    +H  LE D+ +H + +
Sbjct: 3418 QQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHL 3472



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLL 339
            +DP  LN + Q+ Q   QE    KP+ +++TA G+ +L
Sbjct: 2570 IDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAGQGIL 2607


>AL137008-2|CAI20330.1| 7543|Homo sapiens dystonin protein.
          Length = 7543

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN-RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LK + L +   +++ N + V+D+  W+ E++ QL   ++G DL SV++  + H
Sbjct: 589 LKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENH 641



 Score = 32.7 bits (71), Expect = 1.0
 Identities = 14/55 (25%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = -3

Query: 216  QQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
            QQ++  +E +  WL+ +E +L++ E  G   + ++    +H  LE D+ +H + +
Sbjct: 5504 QQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHL 5558



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLL 339
            +DP  LN + Q+ Q   QE    KP+ +++TA G+ +L
Sbjct: 4656 IDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAGQGIL 4693


>AL096710-6|CAI22047.1| 2649|Homo sapiens dystonin protein.
          Length = 2649

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN-RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LK + L +   +++ N + V+D+  W+ E++ QL   ++G DL SV++  + H
Sbjct: 263 LKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENH 315


>AL096710-5|CAI22046.1| 3060|Homo sapiens dystonin protein.
          Length = 3060

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN-RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LK + L +   +++ N + V+D+  W+ E++ QL   ++G DL SV++  + H
Sbjct: 263 LKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENH 315


>AL096710-4|CAI22045.1| 5144|Homo sapiens dystonin protein.
          Length = 5144

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN-RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LK + L +   +++ N + V+D+  W+ E++ QL   ++G DL SV++  + H
Sbjct: 263 LKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENH 315



 Score = 32.7 bits (71), Expect = 1.0
 Identities = 14/55 (25%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = -3

Query: 216  QQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
            QQ++  +E +  WL+ +E +L++ E  G   + ++    +H  LE D+ +H + +
Sbjct: 3092 QQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHL 3146



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLL 339
            +DP  LN + Q+ Q   QE    KP+ +++TA G+ +L
Sbjct: 2244 IDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAGQGIL 2281


>AL096710-3|CAI22043.1| 5457|Homo sapiens dystonin protein.
          Length = 5457

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN-RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LK + L +   +++ N + V+D+  W+ E++ QL   ++G DL SV++  + H
Sbjct: 589 LKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENH 641



 Score = 32.7 bits (71), Expect = 1.0
 Identities = 14/55 (25%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = -3

Query: 216  QQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
            QQ++  +E +  WL+ +E +L++ E  G   + ++    +H  LE D+ +H + +
Sbjct: 3418 QQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHL 3472



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLL 339
            +DP  LN + Q+ Q   QE    KP+ +++TA G+ +L
Sbjct: 2570 IDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAGQGIL 2607


>AL096710-2|CAI22044.1| 7543|Homo sapiens dystonin protein.
          Length = 7543

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN-RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LK + L +   +++ N + V+D+  W+ E++ QL   ++G DL SV++  + H
Sbjct: 589 LKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENH 641



 Score = 32.7 bits (71), Expect = 1.0
 Identities = 14/55 (25%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = -3

Query: 216  QQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
            QQ++  +E +  WL+ +E +L++ E  G   + ++    +H  LE D+ +H + +
Sbjct: 5504 QQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHL 5558



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLL 339
            +DP  LN + Q+ Q   QE    KP+ +++TA G+ +L
Sbjct: 4656 IDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAGQGIL 4693


>AF400227-1|AAL62062.1| 3060|Homo sapiens bullous pemphigoid antigen
           1 eB protein.
          Length = 3060

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN-RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LK + L +   +++ N + V+D+  W+ E++ QL   ++G DL SV++  + H
Sbjct: 263 LKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENH 315


>AF400226-1|AAL62061.1| 5171|Homo sapiens bullous pemphigoid antigen
           1 eA protein.
          Length = 5171

 Score = 33.1 bits (72), Expect = 0.77
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN-RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LK + L +   +++ N + V+D+  W+ E++ QL   ++G DL SV++  + H
Sbjct: 263 LKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENH 315



 Score = 32.7 bits (71), Expect = 1.0
 Identities = 14/55 (25%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = -3

Query: 216  QQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
            QQ++  +E +  WL+ +E +L++ E  G   + ++    +H  LE D+ +H + +
Sbjct: 3092 QQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHL 3146



 Score = 31.5 bits (68), Expect = 2.4
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLL 339
            +DP  LN + Q+ Q   QE    KP+ +++TA G+ +L
Sbjct: 2244 IDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAGQGIL 2281



 Score = 29.5 bits (63), Expect = 9.5
 Identities = 11/40 (27%), Positives = 23/40 (57%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLEL 333
            L+   L  + ++H+   + +  +KP +D++   G +LLEL
Sbjct: 3556 LEYETLRQQQEEHRQLRESIAEHKPHIDKMNKTGPQLLEL 3595


>AK055189-1|BAB70870.1| 1174|Homo sapiens protein ( Homo sapiens
           cDNA FLJ30627 fis, clone CTONG2001955, moderately
           similar to Homo sapiens mRNA for actin binding protein
           ABP620. ).
          Length = 1174

 Score = 32.7 bits (71), Expect = 1.0
 Identities = 14/55 (25%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = -3

Query: 216 QQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
           QQ++  +E +  WL+ +E +L++ E  G   + ++    +H  LE D+ +H + +
Sbjct: 651 QQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHL 705


>M86407-1|AAA51585.1|  901|Homo sapiens alpha-actinin protein.
          Length = 901

 Score = 31.9 bits (69), Expect = 1.8
 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 1/66 (1%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTS-VQNLQKKHALLEADVSSHA 64
           +LQ  A++ +   ++   E W    E  L   DY   L   V+ L ++H   E+D+++H 
Sbjct: 405 RLQHLAEKFRQKASLH--EAWTRGKEEMLSQRDYDSALLQEVRALLRRHEAFESDLAAHQ 462

Query: 63  ERIDAI 46
           +R++ I
Sbjct: 463 DRVEHI 468


>BC099649-1|AAH99649.1|  901|Homo sapiens actinin, alpha 3 protein.
          Length = 901

 Score = 31.9 bits (69), Expect = 1.8
 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 1/66 (1%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTS-VQNLQKKHALLEADVSSHA 64
           +LQ  A++ +   ++   E W    E  L   DY   L   V+ L ++H   E+D+++H 
Sbjct: 405 RLQHLAEKFRQKASLH--EAWTRGKEEMLSQRDYDSALLQEVRALLRRHEAFESDLAAHQ 462

Query: 63  ERIDAI 46
           +R++ I
Sbjct: 463 DRVEHI 468


>BC099647-1|AAH99647.1|  901|Homo sapiens actinin, alpha 3 protein.
          Length = 901

 Score = 31.9 bits (69), Expect = 1.8
 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 1/66 (1%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTS-VQNLQKKHALLEADVSSHA 64
           +LQ  A++ +   ++   E W    E  L   DY   L   V+ L ++H   E+D+++H 
Sbjct: 405 RLQHLAEKFRQKASLH--EAWTRGKEEMLSQRDYDSALLQEVRALLRRHEAFESDLAAHQ 462

Query: 63  ERIDAI 46
           +R++ I
Sbjct: 463 DRVEHI 468


>BC096323-1|AAH96323.1|  620|Homo sapiens ACTN3 protein protein.
          Length = 620

 Score = 31.9 bits (69), Expect = 1.8
 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 1/66 (1%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTS-VQNLQKKHALLEADVSSHA 64
           +LQ  A++ +   ++   E W    E  L   DY   L   V+ L ++H   E+D+++H 
Sbjct: 124 RLQHLAEKFRQKASLH--EAWTRGKEEMLSQRDYDSALLQEVRALLRRHEAFESDLAAHQ 181

Query: 63  ERIDAI 46
           +R++ I
Sbjct: 182 DRVEHI 187


>AF026487-1|AAC79502.1|  491|Homo sapiens beta III spectrin protein.
          Length = 491

 Score = 31.9 bits (69), Expect = 1.8
 Identities = 13/46 (28%), Positives = 24/46 (52%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           ++  Q  + E++A   R      +GK LL   H+A  +IS ++ +L
Sbjct: 47  IKNQQGIKAEIEARADRFSSCIDMGKELLARSHYAAEEISEKLSQL 92


>AK094883-1|BAC04449.1|  775|Homo sapiens protein ( Homo sapiens
           cDNA FLJ37564 fis, clone BRCOC2000816, weakly similar to
           Homo sapiens mRNA for actin binding protein ABP620. ).
          Length = 775

 Score = 31.5 bits (68), Expect = 2.4
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = -1

Query: 452 LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLL 339
           +DP  LN + Q+ Q   QE    KP+ +++TA G+ +L
Sbjct: 488 IDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAGQGIL 525


>U72849-1|AAD00186.1| 2033|Homo sapiens envoplakin protein.
          Length = 2033

 Score = 30.3 bits (65), Expect = 5.4
 Identities = 18/65 (27%), Positives = 36/65 (55%), Gaps = 1/65 (1%)
 Frame = -1

Query: 431 GKVQKHQNFEQ-ELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSS 255
           G  +++++F+Q EL + +  V+++   G+R++EL H A   I +  E L   W+  +   
Sbjct: 263 GVRREYEHFKQHELLSQEQSVNQLEDDGERMVELRHPAVGPIQAHQEALKMEWQNFLNLC 322

Query: 254 S*RET 240
             +ET
Sbjct: 323 ICQET 327


>U53786-1|AAC64662.1| 2033|Homo sapiens envoplakin protein.
          Length = 2033

 Score = 30.3 bits (65), Expect = 5.4
 Identities = 18/65 (27%), Positives = 36/65 (55%), Gaps = 1/65 (1%)
 Frame = -1

Query: 431 GKVQKHQNFEQ-ELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSS 255
           G  +++++F+Q EL + +  V+++   G+R++EL H A   I +  E L   W+  +   
Sbjct: 263 GVRREYEHFKQHELLSQEQSVNQLEDDGERMVELRHPAVGPIQAHQEALKMEWQNFLNLC 322

Query: 254 S*RET 240
             +ET
Sbjct: 323 ICQET 327


>BC126105-1|AAI26106.1| 2033|Homo sapiens envoplakin protein.
          Length = 2033

 Score = 30.3 bits (65), Expect = 5.4
 Identities = 18/65 (27%), Positives = 36/65 (55%), Gaps = 1/65 (1%)
 Frame = -1

Query: 431 GKVQKHQNFEQ-ELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSS 255
           G  +++++F+Q EL + +  V+++   G+R++EL H A   I +  E L   W+  +   
Sbjct: 263 GVRREYEHFKQHELLSQEQSVNQLEDDGERMVELRHPAVGPIQAHQEALKMEWQNFLNLC 322

Query: 254 S*RET 240
             +ET
Sbjct: 323 ICQET 327


>BC126103-1|AAI26104.1| 2033|Homo sapiens envoplakin protein.
          Length = 2033

 Score = 30.3 bits (65), Expect = 5.4
 Identities = 18/65 (27%), Positives = 36/65 (55%), Gaps = 1/65 (1%)
 Frame = -1

Query: 431 GKVQKHQNFEQ-ELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSS 255
           G  +++++F+Q EL + +  V+++   G+R++EL H A   I +  E L   W+  +   
Sbjct: 263 GVRREYEHFKQHELLSQEQSVNQLEDDGERMVELRHPAVGPIQAHQEALKMEWQNFLNLC 322

Query: 254 S*RET 240
             +ET
Sbjct: 323 ICQET 327


>BC114620-1|AAI14621.1| 1756|Homo sapiens periplakin protein.
          Length = 1756

 Score = 30.3 bits (65), Expect = 5.4
 Identities = 13/51 (25%), Positives = 31/51 (60%), Gaps = 1/51 (1%)
 Frame = -1

Query: 422 QKHQNF-EQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWE 273
           ++++NF  + L+A + R++++ + G +LL  EH  +  I + +E +   W+
Sbjct: 253 RQYENFINRNLEAKEERINKLHSEGDQLLAAEHPGRNSIEAHMEAVHADWK 303


>BC042165-1|AAH42165.1|  488|Homo sapiens Similar to tubulin, gamma
           complex associated protein 6 protein.
          Length = 488

 Score = 30.3 bits (65), Expect = 5.4
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = +2

Query: 251 SSKTAPVAPIFRPALPRETIFEVEQNVRAQADACRRPLS 367
           S    P+A + RP LPR   F V+  V++ AD     LS
Sbjct: 123 SMSEPPIAHLLRPVLPRAFAFPVDPQVQSAADETAVQLS 161


>BC023573-1|AAH23573.1| 1009|Homo sapiens TUBGCP6 protein protein.
          Length = 1009

 Score = 30.3 bits (65), Expect = 5.4
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = +2

Query: 251 SSKTAPVAPIFRPALPRETIFEVEQNVRAQADACRRPLS 367
           S    P+A + RP LPR   F V+  V++ AD     LS
Sbjct: 627 SMSEPPIAHLLRPVLPRAFAFPVDPQVQSAADETAVQLS 665


>AL022328-10|CAI42756.1| 1819|Homo sapiens tubulin, gamma complex
            associated protein 6 protein.
          Length = 1819

 Score = 30.3 bits (65), Expect = 5.4
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = +2

Query: 251  SSKTAPVAPIFRPALPRETIFEVEQNVRAQADACRRPLS 367
            S    P+A + RP LPR   F V+  V++ AD     LS
Sbjct: 1437 SMSEPPIAHLLRPVLPRAFAFPVDPQVQSAADETAVQLS 1475


>AF495910-1|AAN60442.1| 8797|Homo sapiens nesprin-1 protein.
          Length = 8797

 Score = 30.3 bits (65), Expect = 5.4
 Identities = 12/63 (19%), Positives = 33/63 (52%), Gaps = 2/63 (3%)
 Frame = -3

Query: 216  QQYNRAVEDIELWLSEVEGQLLSEDY--GKDLTSVQNLQKKHALLEADVSSHAERIDAIR 43
            + YN  ++++E WL ++ G+L++ D      L ++      H  +  +++   +R++ ++
Sbjct: 3925 EDYNSELQEVEKWLLQMSGRLVAPDLLETSSLETITQQLAHHKAMMEEIAGFEDRLNNLQ 3984

Query: 42   EPG 34
              G
Sbjct: 3985 MKG 3987


>AF272887-1|AAK82968.1| 1819|Homo sapiens gamma-tubulin complex
            component protein.
          Length = 1819

 Score = 30.3 bits (65), Expect = 5.4
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = +2

Query: 251  SSKTAPVAPIFRPALPRETIFEVEQNVRAQADACRRPLS 367
            S    P+A + RP LPR   F V+  V++ AD     LS
Sbjct: 1437 SMSEPPIAHLLRPVLPRAFAFPVDPQVQSAADETAVQLS 1475


>AF041004-1|AAD17459.1| 1756|Homo sapiens periplakin protein.
          Length = 1756

 Score = 30.3 bits (65), Expect = 5.4
 Identities = 13/51 (25%), Positives = 31/51 (60%), Gaps = 1/51 (1%)
 Frame = -1

Query: 422 QKHQNF-EQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWE 273
           ++++NF  + L+A + R++++ + G +LL  EH  +  I + +E +   W+
Sbjct: 253 RQYENFINRNLEAKEERINKLHSEGDQLLAAEHPGRNSIEAHMEAVHADWK 303


>AF013717-1|AAC39668.1| 1756|Homo sapiens periplakin protein.
          Length = 1756

 Score = 30.3 bits (65), Expect = 5.4
 Identities = 13/51 (25%), Positives = 31/51 (60%), Gaps = 1/51 (1%)
 Frame = -1

Query: 422 QKHQNF-EQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWE 273
           ++++NF  + L+A + R++++ + G +LL  EH  +  I + +E +   W+
Sbjct: 253 RQYENFINRNLEAKEERINKLHSEGDQLLAAEHPGRNSIEAHMEAVHADWK 303


>AF001691-1|AAC17738.1| 1756|Homo sapiens 195 kDa cornified envelope
           precursor protein.
          Length = 1756

 Score = 30.3 bits (65), Expect = 5.4
 Identities = 13/51 (25%), Positives = 31/51 (60%), Gaps = 1/51 (1%)
 Frame = -1

Query: 422 QKHQNF-EQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWE 273
           ++++NF  + L+A + R++++ + G +LL  EH  +  I + +E +   W+
Sbjct: 253 RQYENFINRNLEAKEERINKLHSEGDQLLAAEHPGRNSIEAHMEAVHADWK 303


>X69086-1|CAA48829.1| 3433|Homo sapiens utrophin (dystrophin related
           protein) protein.
          Length = 3433

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 18/79 (22%), Positives = 41/79 (51%), Gaps = 2/79 (2%)
 Frame = -1

Query: 491 KRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLEL--EHFAQ 318
           K E+       ++ D   L+  V++    +++++  +  +D+++ +G+ + +L     A 
Sbjct: 548 KEEALNKVQTSNFKDQKELSVSVRRLAILKEDMEMKRQTLDQLSEIGQDVGQLLDNSKAS 607

Query: 317 PQISSRVEELGGIWERLVQ 261
            +I+S  EEL   W+ LVQ
Sbjct: 608 KKINSDSEELTQRWDSLVQ 626


>AL590704-1|CAI10894.1| 3433|Homo sapiens utrophin protein.
          Length = 3433

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 18/79 (22%), Positives = 41/79 (51%), Gaps = 2/79 (2%)
 Frame = -1

Query: 491 KRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLEL--EHFAQ 318
           K E+       ++ D   L+  V++    +++++  +  +D+++ +G+ + +L     A 
Sbjct: 548 KEEALNKVQTSNFKDQKELSVSVRRLAILKEDMEMKRQTLDQLSEIGQDVGQLLDNSKAS 607

Query: 317 PQISSRVEELGGIWERLVQ 261
            +I+S  EEL   W+ LVQ
Sbjct: 608 KKINSDSEELTQRWDSLVQ 626


>AL590488-1|CAI16497.1| 3433|Homo sapiens utrophin protein.
          Length = 3433

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 18/79 (22%), Positives = 41/79 (51%), Gaps = 2/79 (2%)
 Frame = -1

Query: 491 KRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLEL--EHFAQ 318
           K E+       ++ D   L+  V++    +++++  +  +D+++ +G+ + +L     A 
Sbjct: 548 KEEALNKVQTSNFKDQKELSVSVRRLAILKEDMEMKRQTLDQLSEIGQDVGQLLDNSKAS 607

Query: 317 PQISSRVEELGGIWERLVQ 261
            +I+S  EEL   W+ LVQ
Sbjct: 608 KKINSDSEELTQRWDSLVQ 626


>AL513475-1|CAI13032.1| 3433|Homo sapiens utrophin protein.
          Length = 3433

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 18/79 (22%), Positives = 41/79 (51%), Gaps = 2/79 (2%)
 Frame = -1

Query: 491 KRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLEL--EHFAQ 318
           K E+       ++ D   L+  V++    +++++  +  +D+++ +G+ + +L     A 
Sbjct: 548 KEEALNKVQTSNFKDQKELSVSVRRLAILKEDMEMKRQTLDQLSEIGQDVGQLLDNSKAS 607

Query: 317 PQISSRVEELGGIWERLVQ 261
            +I+S  EEL   W+ LVQ
Sbjct: 608 KKINSDSEELTQRWDSLVQ 626


>AL513184-1|CAI40502.1| 3433|Homo sapiens utrophin protein.
          Length = 3433

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 18/79 (22%), Positives = 41/79 (51%), Gaps = 2/79 (2%)
 Frame = -1

Query: 491 KRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLEL--EHFAQ 318
           K E+       ++ D   L+  V++    +++++  +  +D+++ +G+ + +L     A 
Sbjct: 548 KEEALNKVQTSNFKDQKELSVSVRRLAILKEDMEMKRQTLDQLSEIGQDVGQLLDNSKAS 607

Query: 317 PQISSRVEELGGIWERLVQ 261
            +I+S  EEL   W+ LVQ
Sbjct: 608 KKINSDSEELTQRWDSLVQ 626


>AL357149-1|CAI40388.1| 3433|Homo sapiens utrophin protein.
          Length = 3433

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 18/79 (22%), Positives = 41/79 (51%), Gaps = 2/79 (2%)
 Frame = -1

Query: 491 KRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLEL--EHFAQ 318
           K E+       ++ D   L+  V++    +++++  +  +D+++ +G+ + +L     A 
Sbjct: 548 KEEALNKVQTSNFKDQKELSVSVRRLAILKEDMEMKRQTLDQLSEIGQDVGQLLDNSKAS 607

Query: 317 PQISSRVEELGGIWERLVQ 261
            +I+S  EEL   W+ LVQ
Sbjct: 608 KKINSDSEELTQRWDSLVQ 626


>AL024474-2|CAI23353.1| 3433|Homo sapiens utrophin protein.
          Length = 3433

 Score = 29.9 bits (64), Expect = 7.2
 Identities = 18/79 (22%), Positives = 41/79 (51%), Gaps = 2/79 (2%)
 Frame = -1

Query: 491 KRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLEL--EHFAQ 318
           K E+       ++ D   L+  V++    +++++  +  +D+++ +G+ + +L     A 
Sbjct: 548 KEEALNKVQTSNFKDQKELSVSVRRLAILKEDMEMKRQTLDQLSEIGQDVGQLLDNSKAS 607

Query: 317 PQISSRVEELGGIWERLVQ 261
            +I+S  EEL   W+ LVQ
Sbjct: 608 KKINSDSEELTQRWDSLVQ 626


>D87343-1|BAA23225.1|  297|Homo sapiens DCRA protein.
          Length = 297

 Score = 29.5 bits (63), Expect = 9.5
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = -3

Query: 201 AVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQ 106
           A+  +EL L  VE    +E Y +D T +QN+Q
Sbjct: 205 AIRSVELQLVRVETCGCAEGYARDATEIQNIQ 236


>BC110655-1|AAI10656.1|  297|Homo sapiens Down syndrome critical
           region gene 3 protein.
          Length = 297

 Score = 29.5 bits (63), Expect = 9.5
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = -3

Query: 201 AVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQ 106
           A+  +EL L  VE    +E Y +D T +QN+Q
Sbjct: 205 AIRSVELQLVRVETCGCAEGYARDATEIQNIQ 236


>BC050325-1|AAH50325.1|  356|Homo sapiens CCDC67 protein protein.
          Length = 356

 Score = 29.5 bits (63), Expect = 9.5
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 5/69 (7%)
 Frame = -3

Query: 252 LKGNKLQEAAQQ-----QQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALL 88
           L  NKLQ+  Q+     + Y R  + +E  LSEV+ +L S D    +  ++ LQ    LL
Sbjct: 231 LSRNKLQDENQKLLQELKMYQRQCQAMEAGLSEVKSELQSRDDLLRIIEMERLQLHRELL 290

Query: 87  EADVSSHAE 61
           +     +A+
Sbjct: 291 KIGECQNAQ 299


>BC017929-1|AAH17929.1|  399|Homo sapiens CCDC67 protein protein.
          Length = 399

 Score = 29.5 bits (63), Expect = 9.5
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 5/69 (7%)
 Frame = -3

Query: 252 LKGNKLQEAAQQ-----QQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALL 88
           L  NKLQ+  Q+     + Y R  + +E  LSEV+ +L S D    +  ++ LQ    LL
Sbjct: 231 LSRNKLQDENQKLLQELKMYQRQCQAMEAGLSEVKSELQSRDDLLRIIEMERLQLHRELL 290

Query: 87  EADVSSHAE 61
           +     +A+
Sbjct: 291 KIGECQNAQ 299


>AK127973-1|BAC87213.1|  567|Homo sapiens protein ( Homo sapiens
           cDNA FLJ46088 fis, clone TESTI2009739. ).
          Length = 567

 Score = 29.5 bits (63), Expect = 9.5
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 5/69 (7%)
 Frame = -3

Query: 252 LKGNKLQEAAQQ-----QQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALL 88
           L  NKLQ+  Q+     + Y R  + +E  LSEV+ +L S D    +  ++ LQ    LL
Sbjct: 231 LSRNKLQDENQKLLQELKMYQRQCQAMEAGLSEVKSELQSRDDLLRIIEMERLQLHRELL 290

Query: 87  EADVSSHAE 61
           +     +A+
Sbjct: 291 KIGECQNAQ 299


>AK127130-1|BAC86842.1|  266|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45187 fis, clone BRAWH3048548. ).
          Length = 266

 Score = 29.5 bits (63), Expect = 9.5
 Identities = 21/64 (32%), Positives = 28/64 (43%), Gaps = 1/64 (1%)
 Frame = +2

Query: 224 AASCNLFPFSSKTA-PVAPIFRPALPRETIFEVEQNVRAQADACRRPLSRRREACWPAAP 400
           AA+    P  ++T  P   I  P  P   I    Q  R + +  RR   RRR A  P  P
Sbjct: 100 AAAATPSPAPTRTTRPTTRILAPVCPAPAIL-CPQRKRRRRERRRRRKRRRRGAAGPRIP 158

Query: 401 VRSS 412
           V+S+
Sbjct: 159 VKSA 162


>AK058122-1|BAB71673.1|  520|Homo sapiens protein ( Homo sapiens
           cDNA FLJ25393 fis, clone TST02536. ).
          Length = 520

 Score = 29.5 bits (63), Expect = 9.5
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 5/69 (7%)
 Frame = -3

Query: 252 LKGNKLQEAAQQ-----QQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALL 88
           L  NKLQ+  Q+     + Y R  + +E  LSEV+ +L S D    +  ++ LQ    LL
Sbjct: 155 LSRNKLQDENQKLLQELKMYQRQCQAMEAGLSEVKSELQSRDDLLRIIEMERLQLHRELL 214

Query: 87  EADVSSHAE 61
           +     +A+
Sbjct: 215 KIGECQNAQ 223


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 83,141,872
Number of Sequences: 237096
Number of extensions: 1691838
Number of successful extensions: 6718
Number of sequences better than 10.0: 148
Number of HSP's better than 10.0 without gapping: 5492
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6718
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6354183230
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).