SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0034
         (628 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC001709-1|AAH01709.1|  446|Homo sapiens FLJ13052 protein protein.     43   0.001
AY090771-1|AAM01195.1|  446|Homo sapiens NAD kinase protein.           43   0.001
AL031282-13|CAA20354.1|  446|Homo sapiens NAD kinase protein.          43   0.001
AK023114-1|BAB14412.1|  447|Homo sapiens protein ( Homo sapiens ...    43   0.001
AL031282-12|CAI20045.1|  206|Homo sapiens NAD kinase protein.          36   0.089
AL031282-14|CAI20046.1|  591|Homo sapiens NAD kinase protein.          33   0.83 
AF250320-1|AAG44568.1|  590|Homo sapiens HT029 protein.                33   0.83 
DQ335648-1|ABC86718.1|   82|Homo sapiens cholecystokinin B recep...    31   3.3  

>BC001709-1|AAH01709.1|  446|Homo sapiens FLJ13052 protein protein.
          Length = 446

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 17/31 (54%), Positives = 22/31 (70%)
 Frame = +2

Query: 317 FGPCGRIMKNSAMVMQIQDPASQRLTWSSLP 409
           FGP   +++N   +M IQDPASQRLTW+  P
Sbjct: 74  FGPKACVLQNPQTIMHIQDPASQRLTWNKSP 104



 Score = 40.3 bits (90), Expect = 0.005
 Identities = 29/84 (34%), Positives = 43/84 (51%), Gaps = 3/84 (3%)
 Frame = +1

Query: 274 RRTRSLNAPSPIQQVWT---MRQDYEKFRHGHANPGSGVAEADLVKPPLTVLVIKKVHDA 444
           RRTRSL+ P P+        + Q+ +   H   +P S        K P +VLVIKK+ DA
Sbjct: 60  RRTRSLHGPCPVTTFGPKACVLQNPQTIMHIQ-DPAS--QRLTWNKSPKSVLVIKKMRDA 116

Query: 445 QILAPFVQLVHWLVHDKSMVVVRR 516
            +L PF +L   L+ +  +V V +
Sbjct: 117 SLLQPFKELCTHLMEENMIVYVEK 140


>AY090771-1|AAM01195.1|  446|Homo sapiens NAD kinase protein.
          Length = 446

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 17/31 (54%), Positives = 22/31 (70%)
 Frame = +2

Query: 317 FGPCGRIMKNSAMVMQIQDPASQRLTWSSLP 409
           FGP   +++N   +M IQDPASQRLTW+  P
Sbjct: 74  FGPKACVLQNPQTIMHIQDPASQRLTWNKSP 104



 Score = 40.3 bits (90), Expect = 0.005
 Identities = 29/84 (34%), Positives = 43/84 (51%), Gaps = 3/84 (3%)
 Frame = +1

Query: 274 RRTRSLNAPSPIQQVWT---MRQDYEKFRHGHANPGSGVAEADLVKPPLTVLVIKKVHDA 444
           RRTRSL+ P P+        + Q+ +   H   +P S        K P +VLVIKK+ DA
Sbjct: 60  RRTRSLHGPCPVTTFGPKACVLQNPQTIMHIQ-DPAS--QRLTWNKSPKSVLVIKKMRDA 116

Query: 445 QILAPFVQLVHWLVHDKSMVVVRR 516
            +L PF +L   L+ +  +V V +
Sbjct: 117 SLLQPFKELCTHLMEENMIVYVEK 140


>AL031282-13|CAA20354.1|  446|Homo sapiens NAD kinase protein.
          Length = 446

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 17/31 (54%), Positives = 22/31 (70%)
 Frame = +2

Query: 317 FGPCGRIMKNSAMVMQIQDPASQRLTWSSLP 409
           FGP   +++N   +M IQDPASQRLTW+  P
Sbjct: 74  FGPKACVLQNPQTIMHIQDPASQRLTWNKSP 104



 Score = 40.3 bits (90), Expect = 0.005
 Identities = 29/84 (34%), Positives = 43/84 (51%), Gaps = 3/84 (3%)
 Frame = +1

Query: 274 RRTRSLNAPSPIQQVWT---MRQDYEKFRHGHANPGSGVAEADLVKPPLTVLVIKKVHDA 444
           RRTRSL+ P P+        + Q+ +   H   +P S        K P +VLVIKK+ DA
Sbjct: 60  RRTRSLHGPCPVTTFGPKACVLQNPQTIMHIQ-DPAS--QRLTWNKSPKSVLVIKKMRDA 116

Query: 445 QILAPFVQLVHWLVHDKSMVVVRR 516
            +L PF +L   L+ +  +V V +
Sbjct: 117 SLLQPFKELCTHLMEENMIVYVEK 140


>AK023114-1|BAB14412.1|  447|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13052 fis, clone NT2RP3001449. ).
          Length = 447

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 17/31 (54%), Positives = 22/31 (70%)
 Frame = +2

Query: 317 FGPCGRIMKNSAMVMQIQDPASQRLTWSSLP 409
           FGP   +++N   +M IQDPASQRLTW+  P
Sbjct: 74  FGPKACVLQNPQTIMHIQDPASQRLTWNKSP 104



 Score = 40.3 bits (90), Expect = 0.005
 Identities = 29/84 (34%), Positives = 43/84 (51%), Gaps = 3/84 (3%)
 Frame = +1

Query: 274 RRTRSLNAPSPIQQVWT---MRQDYEKFRHGHANPGSGVAEADLVKPPLTVLVIKKVHDA 444
           RRTRSL+ P P+        + Q+ +   H   +P S        K P +VLVIKK+ DA
Sbjct: 60  RRTRSLHGPCPVTTFGPKACVLQNPQTIMHIQ-DPAS--QRLTWNKSPKSVLVIKKMRDA 116

Query: 445 QILAPFVQLVHWLVHDKSMVVVRR 516
            +L PF +L   L+ +  +V V +
Sbjct: 117 SLLQPFKELCTHLMEENMIVYVEK 140


>AL031282-12|CAI20045.1|  206|Homo sapiens NAD kinase protein.
          Length = 206

 Score = 36.3 bits (80), Expect = 0.089
 Identities = 17/39 (43%), Positives = 25/39 (64%)
 Frame = +1

Query: 400 KPPLTVLVIKKVHDAQILAPFVQLVHWLVHDKSMVVVRR 516
           K P +VLVIKK+ DA +L PF +L   L+ +  +V V +
Sbjct: 70  KSPKSVLVIKKMRDASLLQPFKELCTHLMEENMIVYVEK 108



 Score = 31.5 bits (68), Expect = 2.5
 Identities = 13/22 (59%), Positives = 16/22 (72%)
 Frame = +2

Query: 344 NSAMVMQIQDPASQRLTWSSLP 409
           ++A    IQDPASQRLTW+  P
Sbjct: 51  SNACTGHIQDPASQRLTWNKSP 72


>AL031282-14|CAI20046.1|  591|Homo sapiens NAD kinase protein.
          Length = 591

 Score = 33.1 bits (72), Expect = 0.83
 Identities = 19/51 (37%), Positives = 25/51 (49%)
 Frame = +1

Query: 400 KPPLTVLVIKKVHDAQILAPFVQLVHWLVHDKSMVVVRRGGSFWMTHSFAG 552
           K P +VLVIKK+ DA +L PF +L   L+  +       G   W  H   G
Sbjct: 206 KSPKSVLVIKKMRDASLLQPFKELCTHLMEARG----AGGKGAWGAHGVGG 252



 Score = 30.7 bits (66), Expect = 4.4
 Identities = 12/15 (80%), Positives = 13/15 (86%)
 Frame = +2

Query: 365 IQDPASQRLTWSSLP 409
           IQDPASQRLTW+  P
Sbjct: 194 IQDPASQRLTWNKSP 208


>AF250320-1|AAG44568.1|  590|Homo sapiens HT029 protein.
          Length = 590

 Score = 33.1 bits (72), Expect = 0.83
 Identities = 19/51 (37%), Positives = 25/51 (49%)
 Frame = +1

Query: 400 KPPLTVLVIKKVHDAQILAPFVQLVHWLVHDKSMVVVRRGGSFWMTHSFAG 552
           K P +VLVIKK+ DA +L PF +L   L+  +       G   W  H   G
Sbjct: 206 KSPKSVLVIKKMRDASLLQPFKELCTHLMEARG----AGGKGAWGAHGVGG 252



 Score = 30.7 bits (66), Expect = 4.4
 Identities = 12/15 (80%), Positives = 13/15 (86%)
 Frame = +2

Query: 365 IQDPASQRLTWSSLP 409
           IQDPASQRLTW+  P
Sbjct: 194 IQDPASQRLTWNKSP 208


>DQ335648-1|ABC86718.1|   82|Homo sapiens cholecystokinin B receptor
           splice variant long isoform protein.
          Length = 82

 Score = 31.1 bits (67), Expect = 3.3
 Identities = 16/35 (45%), Positives = 20/35 (57%)
 Frame = +3

Query: 369 RIRRRRG*PGQASPHRAGHQESSRRPDTGTLRSTS 473
           R+R + G PG A P RA HQ    RP+TG +   S
Sbjct: 1   RVRNQGGLPGGAGP-RAVHQNGRCRPETGAVGEDS 34


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 100,458,890
Number of Sequences: 237096
Number of extensions: 2270275
Number of successful extensions: 9084
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 8771
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9074
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6804036910
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).