SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0028
         (633 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK126902-1|BAC86743.1|  247|Homo sapiens protein ( Homo sapiens ...    54   4e-07
AY597812-1|AAT09005.1|  238|Homo sapiens UHS KerB-like protein.        51   3e-06
AJ628246-1|CAF31638.1|  167|Homo sapiens keratin associated prot...    51   3e-06
AB126072-1|BAD20199.1|  238|Homo sapiens keratin associated prot...    51   3e-06
AK090647-1|BAC03496.1|  353|Homo sapiens   protein.                    50   9e-06
AB126076-1|BAD20203.1|  165|Homo sapiens keratin associated prot...    50   9e-06
AY360461-1|AAQ62965.1|  187|Homo sapiens UHS KERB-like protein p...    49   1e-05
AB126073-1|BAD20200.1|  288|Homo sapiens keratin associated prot...    49   1e-05
BC117287-1|AAI17288.1|  174|Homo sapiens keratin associated prot...    49   2e-05
BC069560-1|AAH69560.1|  173|Homo sapiens KRTAP9-2 protein protein.     49   2e-05
AJ006692-1|CAA07188.1|  194|Homo sapiens ultra high sulfer kerat...    49   2e-05
AB126077-1|BAD20204.1|  187|Homo sapiens keratin associated prot...    49   2e-05
X63755-1|CAA45283.1|  169|Homo sapiens high-sulpher keratin prot...    48   2e-05
X55293-1|CAA39005.1|  169|Homo sapiens ultra high-sulphur kerati...    48   2e-05
BC101744-1|AAI01745.2|  169|Homo sapiens keratin associated prot...    48   2e-05
BC069531-1|AAH69531.1|  169|Homo sapiens keratin associated prot...    48   2e-05
AJ006693-1|CAA07189.1|  169|Homo sapiens ultra high sulfer kerat...    48   2e-05
AB126078-1|BAD20205.1|  169|Homo sapiens keratin associated prot...    48   2e-05
AJ628247-1|CAF31639.1|  221|Homo sapiens keratin associated prot...    47   5e-05
AB126074-1|BAD20201.1|  221|Homo sapiens keratin associated prot...    47   5e-05
AJ628245-1|CAF31637.1|  177|Homo sapiens keratin associated prot...    47   6e-05
AB126071-1|BAD20198.1|  177|Homo sapiens keratin associated prot...    47   6e-05
BC126423-1|AAI26424.1|  210|Homo sapiens keratin associated prot...    46   8e-05
BC126421-1|AAI26422.1|  210|Homo sapiens keratin associated prot...    46   8e-05
AJ406939-1|CAC27578.1|  210|Homo sapiens keratin associated prot...    46   8e-05
AJ406937-1|CAC27576.1|  186|Homo sapiens keratin associated prot...    46   8e-05
AB126080-1|BAD20207.1|  156|Homo sapiens keratin associated prot...    46   1e-04
BC130562-1|AAI30563.1|  195|Homo sapiens keratin associated prot...    45   2e-04
BC126131-1|AAI26132.1|  195|Homo sapiens keratin associated prot...    45   2e-04
BC110619-1|AAI10620.1|  174|Homo sapiens keratin associated prot...    45   2e-04
BC074919-1|AAH74919.1|  159|Homo sapiens keratin associated prot...    45   2e-04
BC074918-1|AAH74918.1|  159|Homo sapiens keratin associated prot...    45   2e-04
AJ406947-1|CAC27586.1|  159|Homo sapiens keratin associated prot...    45   2e-04
AJ406946-1|CAC27585.1|  174|Homo sapiens keratin associated prot...    45   2e-04
AJ406944-1|CAC27583.1|  195|Homo sapiens keratin associated prot...    45   2e-04
AJ406940-1|CAC27579.1|  114|Homo sapiens keratin associated prot...    45   3e-04
BC074982-1|AAH74982.1|  159|Homo sapiens keratin associated prot...    44   3e-04
BC074981-1|AAH74981.1|  159|Homo sapiens keratin associated prot...    44   3e-04
AJ406950-1|CAC27589.1|  159|Homo sapiens keratin associated prot...    44   3e-04
BC101162-1|AAI01163.1|  201|Homo sapiens keratin associated prot...    44   5e-04
BC101160-1|AAI01161.1|  201|Homo sapiens keratin associated prot...    44   5e-04
BC101159-1|AAI01160.1|  201|Homo sapiens keratin associated prot...    44   5e-04
BC004212-1|AAH04212.1|  201|Homo sapiens keratin associated prot...    44   5e-04
BC004180-1|AAH04180.1|  201|Homo sapiens keratin associated prot...    44   5e-04
AJ406943-1|CAC27582.1|  201|Homo sapiens keratin associated prot...    44   5e-04
AB126070-1|BAD20197.1|  278|Homo sapiens keratin associated prot...    44   5e-04
AB076353-1|BAD01540.1|  365|Homo sapiens keratin associated prot...    44   6e-04
BC131611-1|AAI31612.1|  298|Homo sapiens keratin associated prot...    43   8e-04
BC121094-1|AAI21095.1|  154|Homo sapiens keratin associated prot...    43   8e-04
AJ406948-1|CAC27587.1|  154|Homo sapiens keratin associated prot...    43   8e-04
AB076359-1|BAD01546.1|  298|Homo sapiens keratin associated prot...    43   8e-04
AJ406941-1|CAC27580.1|  191|Homo sapiens keratin associated prot...    42   0.001
BC127252-1|AAI27253.1|  136|Homo sapiens keratin associated prot...    42   0.002
BC125049-1|AAI25050.1|  401|Homo sapiens keratin associated prot...    42   0.002
BC125048-1|AAI25049.1|  401|Homo sapiens keratin associated prot...    42   0.002
BC120960-1|AAI20961.1|  282|Homo sapiens keratin associated prot...    42   0.002
BC120959-1|AAI20960.1|  282|Homo sapiens keratin associated prot...    42   0.002
BC103846-1|AAI03847.1|  127|Homo sapiens keratin associated prot...    42   0.002
BC103845-1|AAI03846.1|  127|Homo sapiens keratin associated prot...    42   0.002
AJ406949-1|CAC27588.1|  111|Homo sapiens keratin associated prot...    42   0.002
AJ406942-1|CAC27581.1|  127|Homo sapiens keratin associated prot...    42   0.002
AJ406936-1|CAC27575.1|  166|Homo sapiens keratin associated prot...    42   0.002
AJ406934-1|CAC27573.1|  136|Homo sapiens keratin associated prot...    42   0.002
AB076351-1|BAD01538.1|  401|Homo sapiens keratin associated prot...    42   0.002
AB076347-1|BAD01534.1|  282|Homo sapiens keratin associated prot...    42   0.002
AJ406945-1|CAC27584.1|  193|Homo sapiens keratin associated prot...    41   0.003
AB126079-1|BAD20206.1|  202|Homo sapiens keratin associated prot...    41   0.003
BC119643-1|AAI19644.1|  370|Homo sapiens keratin associated prot...    41   0.004
AJ406951-1|CAC27590.1|  154|Homo sapiens keratin associated prot...    41   0.004
AB076354-1|BAD01541.1|  370|Homo sapiens keratin associated prot...    41   0.004
BC101153-1|AAI01154.1|  167|Homo sapiens keratin associated prot...    40   0.006
BC101151-1|AAI01152.1|  167|Homo sapiens keratin associated prot...    40   0.006
BC101150-1|AAI01151.1|  167|Homo sapiens keratin associated prot...    40   0.006
BC069161-1|AAH69161.1|  167|Homo sapiens keratin associated prot...    40   0.006
AJ406927-1|CAC27566.1|  167|Homo sapiens keratin associated prot...    40   0.006
AF010404-1|AAC51735.1| 4957|Homo sapiens ALR protein.                  40   0.006
AF010403-1|AAC51734.1| 5262|Homo sapiens ALR protein.                  40   0.006
AB209494-1|BAD92731.1| 2704|Homo sapiens myeloid/lymphoid or mix...    40   0.006
BC127016-1|AAI27017.1|  259|Homo sapiens KRTAP10-8 protein protein.    39   0.013
AK123603-1|BAC85658.1|  143|Homo sapiens protein ( Homo sapiens ...    39   0.013
AB076355-1|BAD01542.1|  259|Homo sapiens keratin associated prot...    39   0.013
AB076348-1|BAD01535.1|  255|Homo sapiens keratin associated prot...    39   0.013
BC133035-1|AAI33036.1|  129|Homo sapiens keratin associated prot...    39   0.017
BC130399-1|AAI30400.1|  129|Homo sapiens keratin associated prot...    39   0.017
BC120950-1|AAI20951.1|  271|Homo sapiens keratin associated prot...    39   0.017
BC120949-1|AAI20950.1|  271|Homo sapiens keratin associated prot...    39   0.017
AB126075-1|BAD20202.1|  129|Homo sapiens keratin associated prot...    39   0.017
AB076364-1|BAD01551.1|  245|Homo sapiens keratin associated prot...    39   0.017
AB076352-1|BAD01539.1|  271|Homo sapiens keratin associated prot...    39   0.017
AJ406935-1|CAC27574.1|   98|Homo sapiens keratin associated prot...    38   0.030
AJ296168-1|CAC27563.1|  106|Homo sapiens keratin associated prot...    38   0.030
BC101152-1|AAI01153.1|  177|Homo sapiens KRTAP1-3 protein protein.     38   0.039
AB081338-1|BAC15619.1|  177|Homo sapiens keratin associated prot...    38   0.039
BC131613-1|AAI31614.1|  292|Homo sapiens keratin associated prot...    37   0.052
AK022609-1|BAB14128.1|  307|Homo sapiens protein ( Homo sapiens ...    37   0.052
AB076356-1|BAD01543.1|  292|Homo sapiens keratin associated prot...    37   0.052
BC069297-1|AAH69297.1|  105|Homo sapiens keratin associated prot...    36   0.090
BC069078-1|AAH69078.1|  105|Homo sapiens keratin associated prot...    36   0.090
AJ406952-1|CAC27591.1|  105|Homo sapiens keratin associated prot...    36   0.090
AB076350-1|BAD01537.1|  221|Homo sapiens keratin associated prot...    36   0.090
U80742-1|AAB91440.1|  652|Homo sapiens CAGH45 protein.                 36   0.12 
D83783-1|BAA12112.1| 2124|Homo sapiens KIAA0192 protein.               36   0.12 
AL353779-1|CAI20975.1|  250|Homo sapiens chromosome 1 open readi...    36   0.12 
AF132033-1|AAD44162.1| 2023|Homo sapiens OPA-containing protein ...    36   0.12 
AF117755-1|AAD22033.1| 2212|Homo sapiens thyroid hormone recepto...    36   0.12 
AF071309-1|AAC83163.1| 2023|Homo sapiens OPA-containing protein ...    36   0.12 
AB102668-1|BAC81137.1| 2027|Homo sapiens TNRC11 protein.               36   0.12 
AB065580-1|BAC05810.1|  346|Homo sapiens seven transmembrane hel...    36   0.12 
BC133677-1|AAI33678.1|  194|Homo sapiens KRTAP10-3 protein protein.    36   0.16 
BC127772-1|AAI27773.1|  863|Homo sapiens KIF5C protein protein.        36   0.16 
BC110287-1|AAI10288.1|  725|Homo sapiens KIF5C protein protein.        36   0.16 
AJ628243-1|CAF31636.1|   38|Homo sapiens keratin associated prot...    36   0.16 
AC108512-1|AAX82030.1|  684|Homo sapiens unknown protein.              36   0.16 
AB011103-1|BAA25457.2|  999|Homo sapiens KIAA0531 protein protein.     36   0.16 
Y08267-1|CAA69593.1|  238|Homo sapiens AAD10 protein.                  35   0.21 
AJ566387-1|CAD97467.1|  251|Homo sapiens keratin associated prot...    35   0.28 
AB076358-1|BAD01545.1|  251|Homo sapiens keratin associated prot...    35   0.28 
X63337-1|CAA44937.1|  177|Homo sapiens high sulfur keratin protein.    34   0.36 
BC105071-1|AAI05072.1|  177|Homo sapiens keratin associated prot...    34   0.36 
BC105069-1|AAI05070.1|  177|Homo sapiens keratin associated prot...    34   0.36 
BC101555-1|AAI01556.1|  174|Homo sapiens keratin associated prot...    34   0.36 
BC093841-1|AAH93841.1|  174|Homo sapiens keratin associated prot...    34   0.36 
BC069533-1|AAH69533.1|  174|Homo sapiens keratin associated prot...    34   0.36 
AL353779-5|CAI20979.1|  118|Homo sapiens late cornified envelope...    34   0.36 
AL139247-6|CAI21684.1|  110|Homo sapiens late cornified envelope...    34   0.36 
AJ406928-1|CAC27567.1|  174|Homo sapiens keratin associated prot...    34   0.36 
AJ406926-1|CAC27565.1|  177|Homo sapiens keratin associated prot...    34   0.36 
AF005080-1|AAB83960.1|  110|Homo sapiens skin-specific protein p...    34   0.36 
AB052934-1|BAB61026.1|  177|Homo sapiens keratin associated prot...    34   0.36 
AB055057-1|BAB61031.1|   85|Homo sapiens keratin associated prot...    34   0.48 
AB052868-1|BAB61024.1|  131|Homo sapiens keratin associated prot...    34   0.48 
AL139247-5|CAI21683.1|  110|Homo sapiens late cornified envelope...    33   0.64 
X89961-1|CAD56487.1|  116|Homo sapiens mitochondrial capsule sel...    33   0.84 
X89960-1|CAA62000.1|  116|Homo sapiens mitochondrial capsule sel...    33   0.84 
X63338-1|CAA44938.1|  175|Homo sapiens high sulfur keratin protein.    33   1.1  
U63332-1|AAB05810.1|   46|Homo sapiens super cysteine rich prote...    33   1.1  
U07807-1|AAA20232.1|   62|Homo sapiens metallothionein IV protein.     33   1.1  
K01383-1|AAA59586.1|   61|Homo sapiens MT1A protein.                   33   1.1  
BC130605-1|AAI30606.1|  110|Homo sapiens late cornified envelope...    33   1.1  
BC130603-1|AAI30604.1|  110|Homo sapiens late cornified envelope...    33   1.1  
BC113448-1|AAI13449.1|   99|Homo sapiens late cornified envelope...    33   1.1  
BC113446-1|AAI13447.1|   99|Homo sapiens late cornified envelope...    33   1.1  
BC113444-1|AAI13445.1|   62|Homo sapiens metallothionein 4 protein.    33   1.1  
BC113442-1|AAI13443.1|   62|Homo sapiens metallothionein 4 protein.    33   1.1  
BC029475-1|AAH29475.1|   61|Homo sapiens metallothionein 1A prot...    33   1.1  
AL163280-3|CAB90447.1|  315|Homo sapiens IGSF5 protein.                33   1.1  
AL139247-8|CAI21686.1|   99|Homo sapiens late cornified envelope...    33   1.1  
AL139247-4|CAI21682.1|  110|Homo sapiens late cornified envelope...    33   1.1  
AF005081-1|AAB83961.1|  112|Homo sapiens skin-specific protein p...    33   1.1  
U80736-1|AAB91435.1|  331|Homo sapiens CAGF9 protein.                  32   1.5  
BC028377-1|AAH28377.1|  544|Homo sapiens zinc finger protein 502...    32   1.5  
AK128797-1|BAC87611.1|  201|Homo sapiens protein ( Homo sapiens ...    32   1.5  
M13903-1|AAA59186.1|  585|Homo sapiens involucrin protein.             32   1.9  
CR457218-1|CAG33499.1|   99|Homo sapiens NICE-1 protein.               32   1.9  
BT006844-1|AAP35490.1|  438|Homo sapiens granulin protein.             32   1.9  
BC119710-1|AAI19711.1|   99|Homo sapiens cysteine-rich C-termina...    32   1.9  
BC101149-1|AAI01150.1|  128|Homo sapiens keratin associated prot...    32   1.9  
BC101148-1|AAI01149.1|  128|Homo sapiens keratin associated prot...    32   1.9  
BC101147-1|AAI01148.1|  128|Homo sapiens keratin associated prot...    32   1.9  
BC063625-1|AAH63625.1|  128|Homo sapiens KRTAP2-4 protein protein.     32   1.9  
BC046391-1|AAH46391.1|  585|Homo sapiens involucrin protein.           32   1.9  
BC020757-1|AAH20757.1|   62|Homo sapiens MT1G protein protein.         32   1.9  
BC016744-1|AAH16744.1|  116|Homo sapiens sperm mitochondria-asso...    32   1.9  
BC014593-1|AAH14593.1|  116|Homo sapiens sperm mitochondria-asso...    32   1.9  
BC000324-1|AAH00324.1|  438|Homo sapiens granulin protein.             32   1.9  
AL162596-4|CAI19553.1|  585|Homo sapiens involucrin protein.           32   1.9  
AL162596-3|CAI19552.1|  116|Homo sapiens sperm mitochondria-asso...    32   1.9  
AL135842-4|CAI23351.1|   99|Homo sapiens cysteine-rich C-termina...    32   1.9  
AJ406930-1|CAC27569.1|  128|Homo sapiens keratin associated prot...    32   1.9  
AJ302536-1|CAC27564.1|   85|Homo sapiens keratin associated prot...    32   1.9  
AJ296345-1|CAC24555.1|   96|Homo sapiens keratin associated prot...    32   1.9  
AJ243662-1|CAB65093.1|   99|Homo sapiens NICE-1 protein protein.       32   1.9  
AF384996-1|AAK62360.1|  111|Homo sapiens MUSP1 protein.                32   1.9  
AB081339-1|BAC15620.1|  141|Homo sapiens keratin associated prot...    32   1.9  
L21998-1|AAB95295.1| 5179|Homo sapiens mucin protein.                  31   2.6  
AF348997-1|AAO32957.1|   61|Homo sapiens MTE protein.                  31   2.6  
X60077-1|CAC16148.1|   91|Homo sapiens 22 Kruppel-related zinc f...    31   3.4  
CR456615-1|CAG30501.1|  446|Homo sapiens ZNF70 protein.                31   3.4  
BC040161-1|AAH40161.1|  446|Homo sapiens zinc finger protein 70 ...    31   3.4  
AB050771-1|BAB83033.1|  446|Homo sapiens zinc finger protein N27...    31   3.4  
X97261-1|CAA65916.1|   61|Homo sapiens Metallothionein 1R protein.     31   4.5  
AY196485-1|AAP33842.1|  246|Homo sapiens I-mfa domain-containing...    31   4.5  
AY077636-1|AAL76084.1|   61|Homo sapiens zinc-induced metallothi...    31   4.5  
AF054589-2|AAF36998.1|  246|Homo sapiens HIC protein isoform p32...    31   4.5  
AF054589-1|AAF36999.1|  355|Homo sapiens HIC protein isoform p40...    31   4.5  
X97260-1|CAA65915.1|   61|Homo sapiens Metallothionein 2 protein.      30   5.9  
X76717-1|CAA54136.1|   61|Homo sapiens MT-1l protein protein.          30   5.9  
X65607-1|CAA46557.1|   61|Homo sapiens metallothionein IX protein.     30   5.9  
V00594-1|CAA23841.1|   61|Homo sapiens protein ( Human mRNA for ...    30   5.9  
S52379-1|AAB24908.1|   61|Homo sapiens metallothionein-II protein.     30   5.9  
M10942-1|AAA59587.1|   61|Homo sapiens MT1E protein.                   30   5.9  
L46720-1|AAB00855.1|  863|Homo sapiens autotaxin-t protein.            30   5.9  
J03910-1|AAA59873.1|   61|Homo sapiens metallothionein-IG protein.     30   5.9  
J00271-1|AAA59583.1|   61|Homo sapiens metallothionein II protein.     30   5.9  
DQ370420-1|ABC79300.1|   61|Homo sapiens metallothionein 2A prot...    30   5.9  
CR456537-1|CAG30423.1|  674|Homo sapiens PCQAP protein.                30   5.9  
BT007315-1|AAP35979.1|   61|Homo sapiens metallothionein 2A prot...    30   5.9  
BC131609-1|AAI31610.1|   61|Homo sapiens metallothionein 1E prot...    30   5.9  
BC070289-1|AAH70289.1|   61|Homo sapiens MT2A protein protein.         30   5.9  
BC062734-1|AAH62734.1|   61|Homo sapiens metallothionein 1E prot...    30   5.9  
BC032338-1|AAH32338.1|   61|Homo sapiens metallothionein 1X prot...    30   5.9  
BC013985-1|AAH13985.1|  748|Homo sapiens PC2 (positive cofactor ...    30   5.9  
BC009699-1|AAH09699.1|   61|Homo sapiens metallothionein 1E prot...    30   5.9  
BC007034-1|AAH07034.1|   61|Homo sapiens MT2A protein protein.         30   5.9  
BC003078-1|AAH03078.1|  767|Homo sapiens PCQAP protein protein.        30   5.9  
AY028617-1|AAK26162.1|   61|Homo sapiens metallothionein 1S prot...    30   5.9  
AL135842-3|CAI23350.1|  118|Homo sapiens late cornified envelope...    30   5.9  
AK090465-1|BAC03446.1|  811|Homo sapiens FLJ00386 protein protein.     30   5.9  
AF348996-1|AAO32956.2|   61|Homo sapiens MTD protein.                  30   5.9  
AF348995-1|AAO32955.1|   61|Homo sapiens MTC protein.                  30   5.9  
AF328769-1|AAK58423.1|  746|Homo sapiens PC2-glutamine-rich-asso...    30   5.9  
AF078844-1|AAF23355.1|  122|Homo sapiens hqp0376 protein protein.      30   5.9  
AF056191-1|AAC12944.1|  579|Homo sapiens TPA inducible protein p...    30   5.9  
AB075861-1|BAB85567.1|  863|Homo sapiens KIAA1981 protein protein.     30   5.9  
X64834-1|CAA46046.1|   61|Homo sapiens metallothionein Ih protein.     30   7.8  
X64177-1|CAA45516.1|   61|Homo sapiens metallothionein protein.        30   7.8  
X14894-1|CAA33025.1|  255|Homo sapiens protein ( Human mRNA for ...    30   7.8  
M13003-1|AAA36213.1|   61|Homo sapiens protein ( Human metalloth...    30   7.8  
M10943-1|AAA59588.1|   61|Homo sapiens MT1F protein.                   30   7.8  
BX538201-1|CAD98066.1|  675|Homo sapiens hypothetical protein pr...    30   7.8  
BT019399-1|AAV38206.1|  255|Homo sapiens myogenic factor 5 protein.    30   7.8  
BT007171-1|AAP35835.1|   61|Homo sapiens metallothionein 1H prot...    30   7.8  
BC133032-1|AAI33033.1|   61|Homo sapiens metallothionein 1 pseud...    30   7.8  
BC133030-1|AAI33031.1|   61|Homo sapiens metallothionein 1 pseud...    30   7.8  
BC119707-1|AAI19708.1|  106|Homo sapiens late cornified envelope...    30   7.8  
BC069373-1|AAH69373.1|  255|Homo sapiens myogenic factor 5 protein.    30   7.8  
BC059780-1|AAH59780.1|   61|Homo sapiens metallothionein 1H prot...    30   7.8  
BC033781-1|AAH33781.1|  757|Homo sapiens PAXIP1 protein protein.       30   7.8  
BC029453-1|AAH29453.1|   61|Homo sapiens metallothionein 1F prot...    30   7.8  
BC008408-1|AAH08408.1|   61|Homo sapiens metallothionein 1H prot...    30   7.8  
AL353779-6|CAI20980.1|  118|Homo sapiens late cornified envelope...    30   7.8  
AL139247-7|CAI21685.1|  106|Homo sapiens late cornified envelope...    30   7.8  
AK123600-1|BAC85657.1| 1035|Homo sapiens  mRNA.  protein.              30   7.8  
AK123044-1|BAC85523.1|  548|Homo sapiens PTIP mRNA.  protein.          30   7.8  
AF333388-1|AAK18278.1|   61|Homo sapiens metallothionein 1H-like...    30   7.8  
AB058676-1|BAB47409.1| 1140|Homo sapiens MEGF10 protein (KIAA178...    30   7.8  

>AK126902-1|BAC86743.1|  247|Homo sapiens protein ( Homo sapiens
           cDNA FLJ44954 fis, clone BRAWH2010364. ).
          Length = 247

 Score = 54.0 bits (124), Expect = 4e-07
 Identities = 34/88 (38%), Positives = 41/88 (46%), Gaps = 4/88 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI---LCCFAILCWCCSNPASGSLHSPCS- 421
           C S+ CS  C+L C+ CCS +C   C P   +    CCF     CCS    GSLH  CS 
Sbjct: 105 CCSLRCSPCCSLHCSPCCSLQCSLHCSPHCSLHCSPCCFLHRSPCCS--LQGSLH--CSP 160

Query: 422 CCICCRLPIWSSTSSTFPVWICTSVCSI 505
           CC   R P  S   S      C+  CS+
Sbjct: 161 CCFLHRSPCCSLQGSLH----CSPCCSL 184



 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 26/65 (40%), Positives = 30/65 (46%), Gaps = 2/65 (3%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS--CC 427
           C S+ CS  C+L C+ CCS RC + CC      CC      CCS   S      CS  C 
Sbjct: 81  CCSLRCSPCCSLHCSPCCSLRC-SPCCSLRCSPCCSLHCSPCCSLQCSLHCSPHCSLHCS 139

Query: 428 ICCRL 442
            CC L
Sbjct: 140 PCCFL 144



 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 30/72 (41%), Positives = 37/72 (51%), Gaps = 1/72 (1%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS-CCI 430
           C S+ CS  C+LRC+ CCS RC + CC      CC ++ C    +P   SLH  CS CC 
Sbjct: 89  CCSLHCSPCCSLRCSPCCSLRC-SPCCSLHCSPCC-SLQCSLHCSPHC-SLH--CSPCCF 143

Query: 431 CCRLPIWSSTSS 466
             R P  S   S
Sbjct: 144 LHRSPCCSLQGS 155



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 35/89 (39%), Positives = 41/89 (46%), Gaps = 16/89 (17%)
 Frame = +2

Query: 248 PLCN---SICCSYSCTLRCTFCCSNRCG-------TSCCPSSGIL----CCFAILCWCCS 385
           P C+   S CCS  C+L C+  CS  C        + CC   G L    CCF     CCS
Sbjct: 112 PCCSLHCSPCCSLQCSLHCSPHCSLHCSPCCFLHRSPCCSLQGSLHCSPCCFLHRSPCCS 171

Query: 386 NPASGSLH-SP-CSCCICCRLPIWSSTSS 466
               GSLH SP CS  I C  P  S T++
Sbjct: 172 --LQGSLHCSPCCSLHISCPRPSHSPTNT 198



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 26/62 (41%), Positives = 31/62 (50%), Gaps = 1/62 (1%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLH-SPCSCCICC 436
           S+ CS  C+LRC+ CCS  C + CC      CC      CC      SLH SPC C + C
Sbjct: 75  SLHCSPCCSLRCSPCCSLHC-SPCCSLRCSPCCSLRCSPCC------SLHCSPC-CSLQC 126

Query: 437 RL 442
            L
Sbjct: 127 SL 128


>AY597812-1|AAT09005.1|  238|Homo sapiens UHS KerB-like protein.
          Length = 238

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 28/73 (38%), Positives = 32/73 (43%), Gaps = 3/73 (4%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGIL-CCFAILCW--CCSNPAS 397
           +PS      C   C   SC   C  CCS+ CG+SCC SS    CC    C   CC +   
Sbjct: 152 KPSCSQSSCCKPCCSQSSCCKPC--CCSSGCGSSCCQSSCCKPCCSQSSCCKPCCCSSGC 209

Query: 398 GSLHSPCSCCICC 436
           GS     SCC  C
Sbjct: 210 GSSCCQSSCCKPC 222



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 25/62 (40%), Positives = 30/62 (48%), Gaps = 3/62 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS-NRCGTSCCPSSGI--LCCFAILCWCCSNPASGSLHSPCSC 424
           C S CC  SC   C  CCS + C   CC SSG    CC +  C  CS+ +S  +   C C
Sbjct: 180 CGSSCCQSSC---CKPCCSQSSCCKPCCCSSGCGSSCCQSSCCKPCSSQSSCCVPICCQC 236

Query: 425 CI 430
            I
Sbjct: 237 KI 238



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 36/93 (38%), Positives = 42/93 (45%), Gaps = 11/93 (11%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCW-CCS-----NPASGSL 406
           C S  CS  SC   C  CCS+ CG+SCC SS     C  +  C  CCS      P   S 
Sbjct: 121 CGSCGCSQCSCYKPC--CCSSGCGSSCCQSSCCKPSCSQSSCCKPCCSQSSCCKPCCCSS 178

Query: 407 HSPCSCC--ICCRLPIWSSTSSTFPVWICTSVC 499
               SCC   CC+ P  S +S   P   C+S C
Sbjct: 179 GCGSSCCQSSCCK-PCCSQSSCCKPC-CCSSGC 209



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 20/70 (28%), Positives = 24/70 (34%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           C S CC   C  +   CC   C  S C S G        C  C         S   C   
Sbjct: 31  CGSGCCVPVCCCKPVCCCVPACSCSSCGSCGGSKGVCGSCGGCKGGCGSCGGSKGGCGSS 90

Query: 434 CRLPIWSSTS 463
           C +P+  S+S
Sbjct: 91  CCVPVCCSSS 100


>AJ628246-1|CAF31638.1|  167|Homo sapiens keratin associated protein
           5-9 protein.
          Length = 167

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 28/73 (38%), Positives = 32/73 (43%), Gaps = 3/73 (4%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGIL-CCFAILCW--CCSNPAS 397
           +PS      C   C   SC   C  CCS+ CG+SCC SS    CC    C   CC +   
Sbjct: 81  KPSCSQSSCCKPCCSQSSCCKPC--CCSSGCGSSCCQSSCCKPCCSQSSCCKPCCCSSGC 138

Query: 398 GSLHSPCSCCICC 436
           GS     SCC  C
Sbjct: 139 GSSCCQSSCCKPC 151



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 25/62 (40%), Positives = 30/62 (48%), Gaps = 3/62 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS-NRCGTSCCPSSGI--LCCFAILCWCCSNPASGSLHSPCSC 424
           C S CC  SC   C  CCS + C   CC SSG    CC +  C  CS+ +S  +   C C
Sbjct: 109 CGSSCCQSSC---CKPCCSQSSCCKPCCCSSGCGSSCCQSSCCKPCSSQSSCCVPICCQC 165

Query: 425 CI 430
            I
Sbjct: 166 KI 167



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 36/93 (38%), Positives = 42/93 (45%), Gaps = 11/93 (11%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCW-CCS-----NPASGSL 406
           C S  CS  SC   C  CCS+ CG+SCC SS     C  +  C  CCS      P   S 
Sbjct: 50  CGSCGCSQCSCYKPC--CCSSGCGSSCCQSSCCKPSCSQSSCCKPCCSQSSCCKPCCCSS 107

Query: 407 HSPCSCC--ICCRLPIWSSTSSTFPVWICTSVC 499
               SCC   CC+ P  S +S   P   C+S C
Sbjct: 108 GCGSSCCQSSCCK-PCCSQSSCCKPC-CCSSGC 138


>AB126072-1|BAD20199.1|  238|Homo sapiens keratin associated protein
           protein.
          Length = 238

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 28/73 (38%), Positives = 32/73 (43%), Gaps = 3/73 (4%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGIL-CCFAILCW--CCSNPAS 397
           +PS      C   C   SC   C  CCS+ CG+SCC SS    CC    C   CC +   
Sbjct: 152 KPSCSQSSCCKPCCSQSSCCKPC--CCSSGCGSSCCQSSCCKPCCSQSSCCKPCCCSSGC 209

Query: 398 GSLHSPCSCCICC 436
           GS     SCC  C
Sbjct: 210 GSSCCQSSCCKPC 222



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 25/62 (40%), Positives = 30/62 (48%), Gaps = 3/62 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS-NRCGTSCCPSSGI--LCCFAILCWCCSNPASGSLHSPCSC 424
           C S CC  SC   C  CCS + C   CC SSG    CC +  C  CS+ +S  +   C C
Sbjct: 180 CGSSCCQSSC---CKPCCSQSSCCKPCCCSSGCGSSCCQSSCCKPCSSQSSCCVPICCQC 236

Query: 425 CI 430
            I
Sbjct: 237 KI 238



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 36/93 (38%), Positives = 42/93 (45%), Gaps = 11/93 (11%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCW-CCS-----NPASGSL 406
           C S  CS  SC   C  CCS+ CG+SCC SS     C  +  C  CCS      P   S 
Sbjct: 121 CGSCGCSQCSCYKPC--CCSSGCGSSCCQSSCCKPSCSQSSCCKPCCSQSSCCKPCCCSS 178

Query: 407 HSPCSCC--ICCRLPIWSSTSSTFPVWICTSVC 499
               SCC   CC+ P  S +S   P   C+S C
Sbjct: 179 GCGSSCCQSSCCK-PCCSQSSCCKPC-CCSSGC 209



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 20/70 (28%), Positives = 24/70 (34%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           C S CC   C  +   CC   C  S C S G        C  C         S   C   
Sbjct: 31  CGSGCCVPVCCCKPVCCCVPACSCSSCGSCGGSKGVCGSCGGCKGGCGSCGGSKGGCGSS 90

Query: 434 CRLPIWSSTS 463
           C +P+  S+S
Sbjct: 91  CCVPVCCSSS 100


>AK090647-1|BAC03496.1|  353|Homo sapiens   protein.
          Length = 353

 Score = 49.6 bits (113), Expect = 9e-06
 Identities = 26/68 (38%), Positives = 33/68 (48%), Gaps = 4/68 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI---LCCFAILCWCCSNPASGSLHSPC-S 421
           C S+ CS  C+L C+ CCS +C   C P   +    CCF     CCS   S    SPC  
Sbjct: 105 CCSLRCSPCCSLHCSPCCSLQCSLHCSPHCSLHCSPCCFLHYSPCCSLHFS-LCRSPCIP 163

Query: 422 CCICCRLP 445
           C + C +P
Sbjct: 164 CTVPCTVP 171



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 31/84 (36%), Positives = 36/84 (42%), Gaps = 2/84 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS--CC 427
           C S+ CS  C+L C+ CCS RC + CC      CC      CCS   S      CS  C 
Sbjct: 81  CCSLRCSPCCSLHCSPCCSLRC-SPCCSLRCSPCCSLHCSPCCSLQCSLHCSPHCSLHCS 139

Query: 428 ICCRLPIWSSTSSTFPVWICTSVC 499
            CC L      S  F   +C S C
Sbjct: 140 PCCFLHYSPCCSLHFS--LCRSPC 161



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 34/89 (38%), Positives = 44/89 (49%), Gaps = 5/89 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLH-SPCSCCI 430
           C S+ CS  C+LRC+ CCS RC + CC      CC ++ C    +P   SLH SPC C +
Sbjct: 89  CCSLHCSPCCSLRCSPCCSLRC-SPCCSLHCSPCC-SLQCSLHCSPHC-SLHCSPC-CFL 144

Query: 431 ----CCRLPIWSSTSSTFPVWICTSVCSI 505
               CC L      S   P   CT  C++
Sbjct: 145 HYSPCCSLHFSLCRSPCIP---CTVPCTV 170


>AB126076-1|BAD20203.1|  165|Homo sapiens keratin associated protein
           protein.
          Length = 165

 Score = 49.6 bits (113), Expect = 9e-06
 Identities = 29/66 (43%), Positives = 33/66 (50%), Gaps = 5/66 (7%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCW-CCSNPASGSLHSPCS 421
           C S  CS  SC   C  CCS+ CG+SCC SS     CC +  C  CC +   GS     S
Sbjct: 87  CGSCGCSQCSCYKPC--CCSSGCGSSCCQSSCCKPCCCQSSCCKPCCCSSGCGSSCCQSS 144

Query: 422 CC-ICC 436
           CC  CC
Sbjct: 145 CCNPCC 150



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/61 (37%), Positives = 28/61 (45%), Gaps = 2/61 (3%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSG--ILCCFAILCWCCSNPASGSLHSPCSCC 427
           C S CC  SC   C  CC + C   CC SSG    CC +  C  C + +S  +   C C 
Sbjct: 107 CGSSCCQSSCCKPC--CCQSSCCKPCCCSSGCGSSCCQSSCCNPCCSQSSCCVPVCCQCK 164

Query: 428 I 430
           I
Sbjct: 165 I 165



 Score = 31.1 bits (67), Expect = 3.4
 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 7/67 (10%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPS-----SGILCCFAIL--CWCCSNPASGSLHS 412
           C S CC   C  +   CC   C  S C S      G   C      C  C     G    
Sbjct: 31  CGSSCCVPVCCCKPVCCCVPACSCSSCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSC 90

Query: 413 PCSCCIC 433
            CS C C
Sbjct: 91  GCSQCSC 97


>AY360461-1|AAQ62965.1|  187|Homo sapiens UHS KERB-like protein
           protein.
          Length = 187

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 35/86 (40%), Positives = 40/86 (46%), Gaps = 4/86 (4%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW-CCSNPASGSLHSPCSCC 427
           C S  CS  SC   C  CCS+ CG+SCC SS   CC        C  P S S     SCC
Sbjct: 80  CGSCGCSQCSCCKPC--CCSSGCGSSCCQSS---CCKPCCSQSSCCKPCSCSSGCGSSCC 134

Query: 428 --ICCRLPIWSSTSSTFPVWICTSVC 499
              CC+ P  S +S   P   C+S C
Sbjct: 135 QSSCCK-PCCSQSSCCKPC-CCSSGC 158



 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 28/68 (41%), Positives = 32/68 (47%), Gaps = 7/68 (10%)
 Frame = +2

Query: 254 CNSICCSYSCTLR--CTFC-CSNRCGTSCCPSSGIL-CCFAILCW--CCSNPASGSLHSP 415
           C S CC   C+    C  C CS+ CG+SCC SS    CC    C   CC +   GS    
Sbjct: 105 CQSSCCKPCCSQSSCCKPCSCSSGCGSSCCQSSCCKPCCSQSSCCKPCCCSSGCGSSCCQ 164

Query: 416 CSCC-ICC 436
            SCC  CC
Sbjct: 165 SSCCKPCC 172



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 27/76 (35%), Positives = 34/76 (44%), Gaps = 9/76 (11%)
 Frame = +2

Query: 248 PLCN-SICCS-YSCTLRC-TFCCSNRCGTSCCPSSGIL--CCFAILCW--CCSNPASGSL 406
           P C+ S CC   SC+  C + CC + C   CC  S     CC +  C   CC +      
Sbjct: 112 PCCSQSSCCKPCSCSSGCGSSCCQSSCCKPCCSQSSCCKPCCCSSGCGSSCCQSSCCKPC 171

Query: 407 HSPCSCC--ICCRLPI 448
            S  SCC  ICC+  I
Sbjct: 172 CSQSSCCVPICCQCKI 187



 Score = 30.3 bits (65), Expect = 5.9
 Identities = 27/92 (29%), Positives = 29/92 (31%), Gaps = 9/92 (9%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPS-----SGILCCFAIL--CWCCSNPASGSLHS 412
           C S C    C  +   CC   C  S C S      G   C      C  C     G    
Sbjct: 24  CGSSCRVPICCCKPVCCCVPACSCSSCGSCGGSKGGRGSCGGSKGDCGSCGGSKGGCGSC 83

Query: 413 PCSCCICCRLPIWSS--TSSTFPVWICTSVCS 502
            CS C CC+    SS   SS      C   CS
Sbjct: 84  GCSQCSCCKPCCCSSGCGSSCCQSSCCKPCCS 115


>AB126073-1|BAD20200.1|  288|Homo sapiens keratin associated protein
           protein.
          Length = 288

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 29/65 (44%), Positives = 33/65 (50%), Gaps = 3/65 (4%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC- 427
           C S  CS  SC   C  CCS+ CG+SCC SS   CC      CCS+   GS     SCC 
Sbjct: 191 CGSCGCSQCSCCKPC--CCSSGCGSSCCQSS---CCKP----CCSSSGCGSSCCQSSCCK 241

Query: 428 -ICCR 439
             CC+
Sbjct: 242 PYCCQ 246



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 29/66 (43%), Positives = 33/66 (50%), Gaps = 5/66 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRC-GTSCCPSSGI--LCCFAILCW-CCSNPASGSLHSPCS 421
           C S CC  SC   C  CCS+   G+SCC SS     CC +  C  CCS+   GS     S
Sbjct: 211 CGSSCCQSSC---CKPCCSSSGCGSSCCQSSCCKPYCCQSSCCKPCCSSSGCGSSCCQSS 267

Query: 422 CC-ICC 436
           CC  CC
Sbjct: 268 CCNPCC 273



 Score = 37.5 bits (83), Expect = 0.039
 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 2/44 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLR-C-TFCCSNRCGTSCCPSSGILCCFAILCWC 379
           C S CC   C+   C + CC + C   CC  S   CC  + C C
Sbjct: 245 CQSSCCKPCCSSSGCGSSCCQSSCCNPCCSQSS--CCVPVCCQC 286



 Score = 30.7 bits (66), Expect = 4.5
 Identities = 12/31 (38%), Positives = 13/31 (41%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSG 346
           C S CC   C  +   CC   C  S C S G
Sbjct: 45  CGSSCCVPICCCKPVCCCVPACSCSSCGSCG 75


>BC117287-1|AAI17288.1|  174|Homo sapiens keratin associated protein
           9-2 protein.
          Length = 174

 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 28/88 (31%), Positives = 35/88 (39%), Gaps = 4/88 (4%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASG--SLHSP 415
           P C   CC  +C    T CC   C TSCC  S   CC    C   CC +   G  S  S 
Sbjct: 50  PCCRPTCCQNTCCR--TTCCQPTCVTSCCQPS---CCSTPCCQPTCCGSSCCGQTSCGSS 104

Query: 416 CSCCICCRLPIWSSTSSTFPVWICTSVC 499
           C     C  P++   +  +P  +C   C
Sbjct: 105 CGQSSSC-APVYCRRTCYYPTTVCLPGC 131



 Score = 37.5 bits (83), Expect = 0.039
 Identities = 28/89 (31%), Positives = 37/89 (41%), Gaps = 11/89 (12%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCG--TSCCPSSGILCCFAILCWC---CSNP 391
           +PS    P C   CC  SC  + +  C + CG  +SC P      C+     C   C N 
Sbjct: 77  QPSCCSTPCCQPTCCGSSCCGQTS--CGSSCGQSSSCAPVYCRRTCYYPTTVCLPGCLNQ 134

Query: 392 ASGS-LHSPC---SCC--ICCRLPIWSST 460
           + GS    PC   +CC   CCR   +  T
Sbjct: 135 SCGSNCCQPCCRPACCETTCCRTTCFQPT 163



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%)
 Frame = +2

Query: 296 TFCCSNRCGTSCCPSSGILCCFAILCW-------CCSNPASGSLHSPCSCC-ICCR 439
           T CCS  C  +CC ++   CC    CW       C S P         SCC  CCR
Sbjct: 2   THCCSPCCQPTCCRTT---CC-RTTCWKPTTVTTCSSTPCCQPACCVSSCCQPCCR 53


>BC069560-1|AAH69560.1|  173|Homo sapiens KRTAP9-2 protein protein.
          Length = 173

 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 28/88 (31%), Positives = 35/88 (39%), Gaps = 4/88 (4%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASG--SLHSP 415
           P C   CC  +C    T CC   C TSCC  S   CC    C   CC +   G  S  S 
Sbjct: 49  PCCRPTCCQNTCCR--TTCCQPTCVTSCCQPS---CCSTPCCQPTCCGSSCCGQTSCGSS 103

Query: 416 CSCCICCRLPIWSSTSSTFPVWICTSVC 499
           C     C  P++   +  +P  +C   C
Sbjct: 104 CGQSSSC-APVYCRRTCYYPTTVCLPGC 130



 Score = 37.5 bits (83), Expect = 0.039
 Identities = 28/89 (31%), Positives = 37/89 (41%), Gaps = 11/89 (12%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCG--TSCCPSSGILCCFAILCWC---CSNP 391
           +PS    P C   CC  SC  + +  C + CG  +SC P      C+     C   C N 
Sbjct: 76  QPSCCSTPCCQPTCCGSSCCGQTS--CGSSCGQSSSCAPVYCRRTCYYPTTVCLPGCLNQ 133

Query: 392 ASGS-LHSPC---SCC--ICCRLPIWSST 460
           + GS    PC   +CC   CCR   +  T
Sbjct: 134 SCGSNCCQPCCRPACCETTCCRTTCFQPT 162



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 8/56 (14%)
 Frame = +2

Query: 296 TFCCSNRCGTSCCPSSGILCCFAILCW-------CCSNPASGSLHSPCSCC-ICCR 439
           T CCS  C  +CC ++   CC    CW       C S P         SCC  CCR
Sbjct: 1   THCCSPCCQPTCCRTT---CC-RTTCWKPTTVTTCSSTPCCQPACCVSSCCQPCCR 52


>AJ006692-1|CAA07188.1|  194|Homo sapiens ultra high sulfer keratin
           protein.
          Length = 194

 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 35/86 (40%), Positives = 40/86 (46%), Gaps = 4/86 (4%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW-CCSNPASGSLHSPCSCC 427
           C S  CS  SC   C  CCS+ CG+SCC SS   CC        C  P S S     SCC
Sbjct: 87  CGSCGCSQCSCYKPC--CCSSGCGSSCCQSS---CCKPCCSQSSCCKPCSCSSGCGSSCC 141

Query: 428 --ICCRLPIWSSTSSTFPVWICTSVC 499
              CC+ P  S +S   P   C+S C
Sbjct: 142 QSSCCK-PCCSQSSCCKPC-CCSSGC 165



 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 28/68 (41%), Positives = 32/68 (47%), Gaps = 7/68 (10%)
 Frame = +2

Query: 254 CNSICCSYSCTLR--CTFC-CSNRCGTSCCPSSGIL-CCFAILCW--CCSNPASGSLHSP 415
           C S CC   C+    C  C CS+ CG+SCC SS    CC    C   CC +   GS    
Sbjct: 112 CQSSCCKPCCSQSSCCKPCSCSSGCGSSCCQSSCCKPCCSQSSCCKPCCCSSGCGSSCCQ 171

Query: 416 CSCC-ICC 436
            SCC  CC
Sbjct: 172 SSCCKPCC 179



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 27/76 (35%), Positives = 34/76 (44%), Gaps = 9/76 (11%)
 Frame = +2

Query: 248 PLCN-SICCS-YSCTLRC-TFCCSNRCGTSCCPSSGIL--CCFAILCW--CCSNPASGSL 406
           P C+ S CC   SC+  C + CC + C   CC  S     CC +  C   CC +      
Sbjct: 119 PCCSQSSCCKPCSCSSGCGSSCCQSSCCKPCCSQSSCCKPCCCSSGCGSSCCQSSCCKPC 178

Query: 407 HSPCSCC--ICCRLPI 448
            S  SCC  ICC+  I
Sbjct: 179 CSQSSCCVPICCQCKI 194


>AB126077-1|BAD20204.1|  187|Homo sapiens keratin associated protein
           protein.
          Length = 187

 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 35/86 (40%), Positives = 40/86 (46%), Gaps = 4/86 (4%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW-CCSNPASGSLHSPCSCC 427
           C S  CS  SC   C  CCS+ CG+SCC SS   CC        C  P S S     SCC
Sbjct: 80  CGSCGCSQCSCYKPC--CCSSGCGSSCCQSS---CCKPCCSQSSCCKPCSCSSGCGSSCC 134

Query: 428 --ICCRLPIWSSTSSTFPVWICTSVC 499
              CC+ P  S +S   P   C+S C
Sbjct: 135 QSSCCK-PCCSQSSCCKPC-CCSSGC 158



 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 28/68 (41%), Positives = 32/68 (47%), Gaps = 7/68 (10%)
 Frame = +2

Query: 254 CNSICCSYSCTLR--CTFC-CSNRCGTSCCPSSGIL-CCFAILCW--CCSNPASGSLHSP 415
           C S CC   C+    C  C CS+ CG+SCC SS    CC    C   CC +   GS    
Sbjct: 105 CQSSCCKPCCSQSSCCKPCSCSSGCGSSCCQSSCCKPCCSQSSCCKPCCCSSGCGSSCCQ 164

Query: 416 CSCC-ICC 436
            SCC  CC
Sbjct: 165 SSCCKPCC 172



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 27/76 (35%), Positives = 34/76 (44%), Gaps = 9/76 (11%)
 Frame = +2

Query: 248 PLCN-SICCS-YSCTLRC-TFCCSNRCGTSCCPSSGIL--CCFAILCW--CCSNPASGSL 406
           P C+ S CC   SC+  C + CC + C   CC  S     CC +  C   CC +      
Sbjct: 112 PCCSQSSCCKPCSCSSGCGSSCCQSSCCKPCCSQSSCCKPCCCSSGCGSSCCQSSCCKPC 171

Query: 407 HSPCSCC--ICCRLPI 448
            S  SCC  ICC+  I
Sbjct: 172 CSQSSCCVPICCQCKI 187



 Score = 30.7 bits (66), Expect = 4.5
 Identities = 12/31 (38%), Positives = 13/31 (41%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSG 346
           C S CC   C  +   CC   C  S C S G
Sbjct: 24  CGSSCCVPICCCKPVCCCVPACSCSSCGSCG 54


>X63755-1|CAA45283.1|  169|Homo sapiens high-sulpher keratin
           protein.
          Length = 169

 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 36/91 (39%), Positives = 41/91 (45%), Gaps = 8/91 (8%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGILCC--FAILCWCCSNPASGSLHSPCSC 424
           C S  CS  SC   C  CCS+ CG+SCC  S   CC  +   C CC  P   S     SC
Sbjct: 72  CGSCGCSQCSCCKPC--CCSSGCGSSCCQCS---CCKPYCSQCSCC-KPCCSSSGRGSSC 125

Query: 425 C--ICCRLPIWSST---SSTFPVWICTSVCS 502
           C   CC+ P  SS+   SS      C   CS
Sbjct: 126 CQSSCCK-PCCSSSGCGSSCCQSSCCKPCCS 155



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 25/85 (29%), Positives = 28/85 (32%), Gaps = 2/85 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           C   CC+  C  +   CC   C  S C   G        C  C     G     CS C C
Sbjct: 31  CGPSCCAPVCCCKPVCCCVPACSCSSCGKRG--------CGSCGGSKGGCGSCGCSQCSC 82

Query: 434 CRLPIWSS--TSSTFPVWICTSVCS 502
           C+    SS   SS      C   CS
Sbjct: 83  CKPCCCSSGCGSSCCQCSCCKPYCS 107



 Score = 37.1 bits (82), Expect = 0.052
 Identities = 24/76 (31%), Positives = 29/76 (38%), Gaps = 2/76 (2%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCI 430
           C  +CC   +C+  C+ C    CG+      G   C    C CC  P   S     SCC 
Sbjct: 42  CKPVCCCVPACS--CSSCGKRGCGSCGGSKGGCGSCGCSQCSCC-KPCCCSSGCGSSCCQ 98

Query: 431 C-CRLPIWSSTSSTFP 475
           C C  P  S  S   P
Sbjct: 99  CSCCKPYCSQCSCCKP 114



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 2/45 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLR-C-TFCCSNRCGTSCCPSSGILCCFAILCWCC 382
           C S CC   C+   C + CC + C   CC  S   CC  + C+ C
Sbjct: 126 CQSSCCKPCCSSSGCGSSCCQSSCCKPCCSQS--RCCVPV-CYQC 167


>X55293-1|CAA39005.1|  169|Homo sapiens ultra high-sulphur keratin
           protein protein.
          Length = 169

 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 36/91 (39%), Positives = 41/91 (45%), Gaps = 8/91 (8%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGILCC--FAILCWCCSNPASGSLHSPCSC 424
           C S  CS  SC   C  CCS+ CG+SCC  S   CC  +   C CC  P   S     SC
Sbjct: 72  CGSCGCSQCSCCKPC--CCSSGCGSSCCQCS---CCKPYCSQCSCC-KPCCSSSGRGSSC 125

Query: 425 C--ICCRLPIWSST---SSTFPVWICTSVCS 502
           C   CC+ P  SS+   SS      C   CS
Sbjct: 126 CQSSCCK-PCCSSSGCGSSCCQSSCCKPCCS 155



 Score = 37.1 bits (82), Expect = 0.052
 Identities = 24/76 (31%), Positives = 29/76 (38%), Gaps = 2/76 (2%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCI 430
           C  +CC   +C+  C+ C    CG+      G   C    C CC  P   S     SCC 
Sbjct: 42  CKPVCCCVPACS--CSSCGKRGCGSCGGSKGGCGSCGCSQCSCC-KPCCCSSGCGSSCCQ 98

Query: 431 C-CRLPIWSSTSSTFP 475
           C C  P  S  S   P
Sbjct: 99  CSCCKPYCSQCSCCKP 114



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 27/87 (31%), Positives = 29/87 (33%), Gaps = 4/87 (4%)
 Frame = +2

Query: 254 CNSICCS--YSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           C   CC+  Y C   C  CC   C  S C   G        C  C     G     CS C
Sbjct: 31  CGPSCCAPVYCCKPVC--CCVPACSCSSCGKRG--------CGSCGGSKGGCGSCGCSQC 80

Query: 428 ICCRLPIWSS--TSSTFPVWICTSVCS 502
            CC+    SS   SS      C   CS
Sbjct: 81  SCCKPCCCSSGCGSSCCQCSCCKPYCS 107



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 2/45 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLR-C-TFCCSNRCGTSCCPSSGILCCFAILCWCC 382
           C S CC   C+   C + CC + C   CC  S   CC  + C+ C
Sbjct: 126 CQSSCCKPCCSSSGCGSSCCQSSCCKPCCSQS--RCCVPV-CYQC 167


>BC101744-1|AAI01745.2|  169|Homo sapiens keratin associated protein
           5-9 protein.
          Length = 169

 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 36/91 (39%), Positives = 41/91 (45%), Gaps = 8/91 (8%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGILCC--FAILCWCCSNPASGSLHSPCSC 424
           C S  CS  SC   C  CCS+ CG+SCC  S   CC  +   C CC  P   S     SC
Sbjct: 72  CGSCGCSQCSCCKPC--CCSSGCGSSCCQCS---CCKPYCSQCSCC-KPCCSSSGRGSSC 125

Query: 425 C--ICCRLPIWSST---SSTFPVWICTSVCS 502
           C   CC+ P  SS+   SS      C   CS
Sbjct: 126 CQSSCCK-PCCSSSGCGSSCCQSSCCKPCCS 155



 Score = 37.1 bits (82), Expect = 0.052
 Identities = 24/76 (31%), Positives = 29/76 (38%), Gaps = 2/76 (2%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCI 430
           C  +CC   +C+  C+ C    CG+      G   C    C CC  P   S     SCC 
Sbjct: 42  CKPVCCCVPACS--CSSCGKRGCGSCGGSKGGCGSCGCSQCSCC-KPCCCSSGCGSSCCQ 98

Query: 431 C-CRLPIWSSTSSTFP 475
           C C  P  S  S   P
Sbjct: 99  CSCCKPYCSQCSCCKP 114



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 27/87 (31%), Positives = 29/87 (33%), Gaps = 4/87 (4%)
 Frame = +2

Query: 254 CNSICCS--YSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           C   CC+  Y C   C  CC   C  S C   G        C  C     G     CS C
Sbjct: 31  CGPSCCAPVYCCKPVC--CCVPACSCSSCGKRG--------CGSCGGSKGGCGSCGCSQC 80

Query: 428 ICCRLPIWSS--TSSTFPVWICTSVCS 502
            CC+    SS   SS      C   CS
Sbjct: 81  SCCKPCCCSSGCGSSCCQCSCCKPYCS 107



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 2/45 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLR-C-TFCCSNRCGTSCCPSSGILCCFAILCWCC 382
           C S CC   C+   C + CC + C   CC  S   CC  + C+ C
Sbjct: 126 CQSSCCKPCCSSSGCGSSCCQSSCCKPCCSQS--RCCVPV-CYQC 167


>BC069531-1|AAH69531.1|  169|Homo sapiens keratin associated protein
           5-9 protein.
          Length = 169

 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 36/91 (39%), Positives = 41/91 (45%), Gaps = 8/91 (8%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGILCC--FAILCWCCSNPASGSLHSPCSC 424
           C S  CS  SC   C  CCS+ CG+SCC  S   CC  +   C CC  P   S     SC
Sbjct: 72  CGSCGCSQCSCCKPC--CCSSGCGSSCCQCS---CCKPYCSQCSCC-KPCCSSSGRGSSC 125

Query: 425 C--ICCRLPIWSST---SSTFPVWICTSVCS 502
           C   CC+ P  SS+   SS      C   CS
Sbjct: 126 CQSSCCK-PCCSSSGCGSSCCQSSCCKPCCS 155



 Score = 37.1 bits (82), Expect = 0.052
 Identities = 24/76 (31%), Positives = 29/76 (38%), Gaps = 2/76 (2%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCI 430
           C  +CC   +C+  C+ C    CG+      G   C    C CC  P   S     SCC 
Sbjct: 42  CKPVCCCVPACS--CSSCGKRGCGSCGGSKGGCGSCGCSQCSCC-KPCCCSSGCGSSCCQ 98

Query: 431 C-CRLPIWSSTSSTFP 475
           C C  P  S  S   P
Sbjct: 99  CSCCKPYCSQCSCCKP 114



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 27/87 (31%), Positives = 29/87 (33%), Gaps = 4/87 (4%)
 Frame = +2

Query: 254 CNSICCS--YSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           C   CC+  Y C   C  CC   C  S C   G        C  C     G     CS C
Sbjct: 31  CGPSCCAPVYCCKPVC--CCVPACSCSSCGKRG--------CGSCGGSKGGCGSCGCSQC 80

Query: 428 ICCRLPIWSS--TSSTFPVWICTSVCS 502
            CC+    SS   SS      C   CS
Sbjct: 81  SCCKPCCCSSGCGSSCCQCSCCKPYCS 107



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 2/45 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLR-C-TFCCSNRCGTSCCPSSGILCCFAILCWCC 382
           C S CC   C+   C + CC + C   CC  S   CC  + C+ C
Sbjct: 126 CQSSCCKPCCSSSGCGSSCCQSSCCKPCCSQS--RCCVPV-CYQC 167


>AJ006693-1|CAA07189.1|  169|Homo sapiens ultra high sulfer keratin
           protein.
          Length = 169

 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 36/91 (39%), Positives = 41/91 (45%), Gaps = 8/91 (8%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGILCC--FAILCWCCSNPASGSLHSPCSC 424
           C S  CS  SC   C  CCS+ CG+SCC  S   CC  +   C CC  P   S     SC
Sbjct: 72  CGSCGCSQCSCCKPC--CCSSGCGSSCCQCS---CCKPYCSQCSCC-KPCCSSSGRGSSC 125

Query: 425 C--ICCRLPIWSST---SSTFPVWICTSVCS 502
           C   CC+ P  SS+   SS      C   CS
Sbjct: 126 CQSSCCK-PCCSSSGCGSSCCQSSCCKPCCS 155



 Score = 37.1 bits (82), Expect = 0.052
 Identities = 24/76 (31%), Positives = 29/76 (38%), Gaps = 2/76 (2%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCI 430
           C  +CC   +C+  C+ C    CG+      G   C    C CC  P   S     SCC 
Sbjct: 42  CKPVCCCVPACS--CSSCGKRGCGSCGGSKGGCGSCGCSQCSCC-KPCCCSSGCGSSCCQ 98

Query: 431 C-CRLPIWSSTSSTFP 475
           C C  P  S  S   P
Sbjct: 99  CSCCKPYCSQCSCCKP 114



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 27/87 (31%), Positives = 29/87 (33%), Gaps = 4/87 (4%)
 Frame = +2

Query: 254 CNSICCS--YSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           C   CC+  Y C   C  CC   C  S C   G        C  C     G     CS C
Sbjct: 31  CGPSCCAPVYCCKPVC--CCVPACSCSSCGKRG--------CGSCGGSKGGCGSCGCSQC 80

Query: 428 ICCRLPIWSS--TSSTFPVWICTSVCS 502
            CC+    SS   SS      C   CS
Sbjct: 81  SCCKPCCCSSGCGSSCCQCSCCKPYCS 107



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 2/45 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLR-C-TFCCSNRCGTSCCPSSGILCCFAILCWCC 382
           C S CC   C+   C + CC + C   CC  S   CC  + C+ C
Sbjct: 126 CQSSCCKPCCSSSGCGSSCCQSSCCKPCCSQS--RCCVPV-CYQC 167


>AB126078-1|BAD20205.1|  169|Homo sapiens keratin associated protein
           protein.
          Length = 169

 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 36/91 (39%), Positives = 41/91 (45%), Gaps = 8/91 (8%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGILCC--FAILCWCCSNPASGSLHSPCSC 424
           C S  CS  SC   C  CCS+ CG+SCC  S   CC  +   C CC  P   S     SC
Sbjct: 72  CGSCGCSQCSCCKPC--CCSSGCGSSCCQCS---CCKPYCSQCSCC-KPCCSSSGRGSSC 125

Query: 425 C--ICCRLPIWSST---SSTFPVWICTSVCS 502
           C   CC+ P  SS+   SS      C   CS
Sbjct: 126 CQSSCCK-PCCSSSGCGSSCCQSSCCKPCCS 155



 Score = 37.1 bits (82), Expect = 0.052
 Identities = 24/76 (31%), Positives = 29/76 (38%), Gaps = 2/76 (2%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCI 430
           C  +CC   +C+  C+ C    CG+      G   C    C CC  P   S     SCC 
Sbjct: 42  CKPVCCCVPACS--CSSCGKRGCGSCGGSKGGCGSCGCSQCSCC-KPCCCSSGCGSSCCQ 98

Query: 431 C-CRLPIWSSTSSTFP 475
           C C  P  S  S   P
Sbjct: 99  CSCCKPYCSQCSCCKP 114



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 27/87 (31%), Positives = 29/87 (33%), Gaps = 4/87 (4%)
 Frame = +2

Query: 254 CNSICCS--YSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           C   CC+  Y C   C  CC   C  S C   G        C  C     G     CS C
Sbjct: 31  CGPSCCAPVYCCKPVC--CCVPACSCSSCGKRG--------CGSCGGSKGGCGSCGCSQC 80

Query: 428 ICCRLPIWSS--TSSTFPVWICTSVCS 502
            CC+    SS   SS      C   CS
Sbjct: 81  SCCKPCCCSSGCGSSCCQCSCCKPYCS 107



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 2/45 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLR-C-TFCCSNRCGTSCCPSSGILCCFAILCWCC 382
           C S CC   C+   C + CC + C   CC  S   CC  + C+ C
Sbjct: 126 CQSSCCKPCCSSSGCGSSCCQSSCCKPCCSQS--RCCVPV-CYQC 167


>AJ628247-1|CAF31639.1|  221|Homo sapiens keratin associated protein
           5-11 protein.
          Length = 221

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 28/75 (37%), Positives = 35/75 (46%), Gaps = 10/75 (13%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILC-------WCCSNPASGS 403
           C S  CS  SC   C  CCS+ CG+SCC SS     CC +  C        C S+    S
Sbjct: 143 CGSYGCSQCSCCKPC--CCSSGCGSSCCQSSCCKPYCCQSSCCKPCSCFSGCGSSCCQSS 200

Query: 404 LHSPCSCCICCRLPI 448
            + PC C   C +P+
Sbjct: 201 CYKPCCCQSSCCVPV 215



 Score = 29.9 bits (64), Expect = 7.8
 Identities = 16/55 (29%), Positives = 17/55 (30%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC 418
           C S CC   C  +   CC   C  S C   G   C      C S   S      C
Sbjct: 62  CGSGCCVPVCCCKPMCCCVPACSCSSCGKGGCGSCGGSKRGCVSCGVSKGACGSC 116


>AB126074-1|BAD20201.1|  221|Homo sapiens keratin associated protein
           protein.
          Length = 221

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 28/75 (37%), Positives = 35/75 (46%), Gaps = 10/75 (13%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILC-------WCCSNPASGS 403
           C S  CS  SC   C  CCS+ CG+SCC SS     CC +  C        C S+    S
Sbjct: 143 CGSYGCSQCSCCKPC--CCSSGCGSSCCQSSCCKPYCCQSSCCKPCSCFSGCGSSCCQSS 200

Query: 404 LHSPCSCCICCRLPI 448
            + PC C   C +P+
Sbjct: 201 CYKPCCCQSSCCVPV 215



 Score = 29.9 bits (64), Expect = 7.8
 Identities = 16/55 (29%), Positives = 17/55 (30%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC 418
           C S CC   C  +   CC   C  S C   G   C      C S   S      C
Sbjct: 62  CGSGCCVPVCCCKPMCCCVPACSCSSCGKGGCGSCGGSKRGCVSCGVSKGACGSC 116


>AJ628245-1|CAF31637.1|  177|Homo sapiens keratin associated protein
           5-8 protein.
          Length = 177

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 27/67 (40%), Positives = 31/67 (46%), Gaps = 2/67 (2%)
 Frame = +2

Query: 254 CNSICCSYS-CTLRCTFCCSNRCGTSCCPSSGIL-CCFAILCWCCSNPASGSLHSPCSCC 427
           C S  CS S C   C  CCS+ CG+SCC SS    CC    C C       S   PC C 
Sbjct: 108 CGSCGCSQSSCCKPC--CCSSGCGSSCCQSSCCKPCCCQSSC-CVPVCCQSSCCKPCCCQ 164

Query: 428 ICCRLPI 448
             C +P+
Sbjct: 165 SNCCVPV 171


>AB126071-1|BAD20198.1|  177|Homo sapiens keratin associated protein
           protein.
          Length = 177

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 27/67 (40%), Positives = 31/67 (46%), Gaps = 2/67 (2%)
 Frame = +2

Query: 254 CNSICCSYS-CTLRCTFCCSNRCGTSCCPSSGIL-CCFAILCWCCSNPASGSLHSPCSCC 427
           C S  CS S C   C  CCS+ CG+SCC SS    CC    C C       S   PC C 
Sbjct: 108 CGSCGCSQSSCCKPC--CCSSGCGSSCCQSSCCKPCCCQSSC-CVPVCCQSSCCKPCCCQ 164

Query: 428 ICCRLPI 448
             C +P+
Sbjct: 165 SNCCVPV 171


>BC126423-1|AAI26424.1|  210|Homo sapiens keratin associated protein
           4-7 protein.
          Length = 210

 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 28/84 (33%), Positives = 37/84 (44%), Gaps = 2/84 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C S+CC  +C  R + C S+ C  SCC SS   CC    C   CC  P  G +    SC 
Sbjct: 135 CQSVCCQPTCC-RPSCCISSCCRPSCCESS---CCRPCCCRPCCCLRPVCGRV----SCH 186

Query: 428 ICCRLPIWSSTSSTFPVWICTSVC 499
             C  P    ++   P+   +S C
Sbjct: 187 TTCYRPTCVISTCPRPLCCASSCC 210



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 33/90 (36%), Positives = 37/90 (41%), Gaps = 7/90 (7%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRC-GTSCCPSSGIL--CCFAILCW--CC--SNPASGSLH 409
           LC   CC  SC    T CC   C   SCC SS     CC ++ C   CC  S   +   H
Sbjct: 19  LCQETCCRPSCCQ--TTCCRTTCYRPSCCVSSCCRPQCCQSVCCQPTCCRPSCCETTCCH 76

Query: 410 SPCSCCICCRLPIWSSTSSTFPVWICTSVC 499
             C    CCR P    +S   P   C SVC
Sbjct: 77  PRCCISSCCR-PSCCMSSCCKP-QCCQSVC 104



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/70 (40%), Positives = 35/70 (50%), Gaps = 8/70 (11%)
 Frame = +2

Query: 254 CNSICCSYSCTL-RCTFCCSNRCGTSCCPSSGI--LCCFAILCW-CCSNPASGSLHSPC- 418
           C   CC  +C   RC  C S+ C  SCC SS     CC ++ C   C +P S  + S C 
Sbjct: 65  CRPSCCETTCCHPRC--CISSCCRPSCCMSSCCKPQCCQSVCCQPTCCHP-SCCISSCCR 121

Query: 419 -SCCI--CCR 439
            SCC+  CCR
Sbjct: 122 PSCCVSRCCR 131



 Score = 41.5 bits (93), Expect = 0.002
 Identities = 30/88 (34%), Positives = 37/88 (42%), Gaps = 6/88 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPCS 421
           C S+CC  +C  R + C +  C   CC SS     CC +  C   CC +          S
Sbjct: 55  CQSVCCQPTCC-RPSCCETTCCHPRCCISSCCRPSCCMSSCCKPQCCQSVCCQPTCCHPS 113

Query: 422 CCI--CCRLPIWSSTSSTFPVWICTSVC 499
           CCI  CCR P    +    P   C SVC
Sbjct: 114 CCISSCCR-PSCCVSRCCRP-QCCQSVC 139



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 26/69 (37%), Positives = 33/69 (47%), Gaps = 7/69 (10%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCW-CCSNPASGSLHSPC-- 418
           C S+CC  +C    + C S+ C  SCC S      CC ++ C   C  P S  + S C  
Sbjct: 100 CQSVCCQPTCC-HPSCCISSCCRPSCCVSRCCRPQCCQSVCCQPTCCRP-SCCISSCCRP 157

Query: 419 SCC--ICCR 439
           SCC   CCR
Sbjct: 158 SCCESSCCR 166



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 23/66 (34%), Positives = 27/66 (40%), Gaps = 4/66 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C+  CC  SC  R + C S  C   CC S   +CC    C   CC +          SCC
Sbjct: 110 CHPSCCISSCC-RPSCCVSRCCRPQCCQS---VCCQPTCCRPSCCISSCCRPSCCESSCC 165

Query: 428 --ICCR 439
              CCR
Sbjct: 166 RPCCCR 171



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 26/69 (37%), Positives = 31/69 (44%), Gaps = 6/69 (8%)
 Frame = +2

Query: 254 CNSICCSYSCTL-RCTF--CCSNRC-GTSCCPSSGILCCFAILCW--CCSNPASGSLHSP 415
           C S CC  SC + RC    CC + C   +CC  S   CC +  C   CC +    S   P
Sbjct: 115 CISSCCRPSCCVSRCCRPQCCQSVCCQPTCCRPS---CCISSCCRPSCCES----SCCRP 167

Query: 416 CSCCICCRL 442
           C C  CC L
Sbjct: 168 CCCRPCCCL 176



 Score = 29.9 bits (64), Expect = 7.8
 Identities = 23/72 (31%), Positives = 26/72 (36%), Gaps = 5/72 (6%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCC--PSSGILCCFAILCW---CCSNP 391
           RPS      C   CC  SC   C  CC   C   CC  P  G + C    C+   C  + 
Sbjct: 146 RPSCCISSCCRPSCCESSC---CRPCCCRPC---CCLRPVCGRVSCHT-TCYRPTCVIST 198

Query: 392 ASGSLHSPCSCC 427
               L    SCC
Sbjct: 199 CPRPLCCASSCC 210


>BC126421-1|AAI26422.1|  210|Homo sapiens keratin associated protein
           4-7 protein.
          Length = 210

 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 28/84 (33%), Positives = 37/84 (44%), Gaps = 2/84 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C S+CC  +C  R + C S+ C  SCC SS   CC    C   CC  P  G +    SC 
Sbjct: 135 CQSVCCQPTCC-RPSCCISSCCRPSCCESS---CCRPCCCRPCCCLRPVCGRV----SCH 186

Query: 428 ICCRLPIWSSTSSTFPVWICTSVC 499
             C  P    ++   P+   +S C
Sbjct: 187 TTCYRPTCVISTCPRPLCCASSCC 210



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 33/90 (36%), Positives = 37/90 (41%), Gaps = 7/90 (7%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRC-GTSCCPSSGIL--CCFAILCW--CC--SNPASGSLH 409
           LC   CC  SC    T CC   C   SCC SS     CC ++ C   CC  S   +   H
Sbjct: 19  LCQETCCRPSCCQ--TTCCRTTCYRPSCCVSSCCRPQCCQSVCCQPTCCRPSCCETTCCH 76

Query: 410 SPCSCCICCRLPIWSSTSSTFPVWICTSVC 499
             C    CCR P    +S   P   C SVC
Sbjct: 77  PRCCISSCCR-PSCCMSSCCKP-QCCQSVC 104



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/70 (40%), Positives = 35/70 (50%), Gaps = 8/70 (11%)
 Frame = +2

Query: 254 CNSICCSYSCTL-RCTFCCSNRCGTSCCPSSGI--LCCFAILCW-CCSNPASGSLHSPC- 418
           C   CC  +C   RC  C S+ C  SCC SS     CC ++ C   C +P S  + S C 
Sbjct: 65  CRPSCCETTCCHPRC--CISSCCRPSCCMSSCCKPQCCQSVCCQPTCCHP-SCCISSCCR 121

Query: 419 -SCCI--CCR 439
            SCC+  CCR
Sbjct: 122 PSCCVSRCCR 131



 Score = 41.5 bits (93), Expect = 0.002
 Identities = 30/88 (34%), Positives = 37/88 (42%), Gaps = 6/88 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPCS 421
           C S+CC  +C  R + C +  C   CC SS     CC +  C   CC +          S
Sbjct: 55  CQSVCCQPTCC-RPSCCETTCCHPRCCISSCCRPSCCMSSCCKPQCCQSVCCQPTCCHPS 113

Query: 422 CCI--CCRLPIWSSTSSTFPVWICTSVC 499
           CCI  CCR P    +    P   C SVC
Sbjct: 114 CCISSCCR-PSCCVSRCCRP-QCCQSVC 139



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 26/69 (37%), Positives = 33/69 (47%), Gaps = 7/69 (10%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCW-CCSNPASGSLHSPC-- 418
           C S+CC  +C    + C S+ C  SCC S      CC ++ C   C  P S  + S C  
Sbjct: 100 CQSVCCQPTCC-HPSCCISSCCRPSCCVSRCCRPQCCQSVCCQPTCCRP-SCCISSCCRP 157

Query: 419 SCC--ICCR 439
           SCC   CCR
Sbjct: 158 SCCESSCCR 166



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 23/66 (34%), Positives = 27/66 (40%), Gaps = 4/66 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C+  CC  SC  R + C S  C   CC S   +CC    C   CC +          SCC
Sbjct: 110 CHPSCCISSCC-RPSCCVSRCCRPQCCQS---VCCQPTCCRPSCCISSCCRPSCCESSCC 165

Query: 428 --ICCR 439
              CCR
Sbjct: 166 RPCCCR 171



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 26/69 (37%), Positives = 31/69 (44%), Gaps = 6/69 (8%)
 Frame = +2

Query: 254 CNSICCSYSCTL-RCTF--CCSNRC-GTSCCPSSGILCCFAILCW--CCSNPASGSLHSP 415
           C S CC  SC + RC    CC + C   +CC  S   CC +  C   CC +    S   P
Sbjct: 115 CISSCCRPSCCVSRCCRPQCCQSVCCQPTCCRPS---CCISSCCRPSCCES----SCCRP 167

Query: 416 CSCCICCRL 442
           C C  CC L
Sbjct: 168 CCCRPCCCL 176



 Score = 29.9 bits (64), Expect = 7.8
 Identities = 23/72 (31%), Positives = 26/72 (36%), Gaps = 5/72 (6%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCC--PSSGILCCFAILCW---CCSNP 391
           RPS      C   CC  SC   C  CC   C   CC  P  G + C    C+   C  + 
Sbjct: 146 RPSCCISSCCRPSCCESSC---CRPCCCRPC---CCLRPVCGRVSCHT-TCYRPTCVIST 198

Query: 392 ASGSLHSPCSCC 427
               L    SCC
Sbjct: 199 CPRPLCCASSCC 210


>AJ406939-1|CAC27578.1|  210|Homo sapiens keratin associated protein
           4.7 protein.
          Length = 210

 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 28/84 (33%), Positives = 37/84 (44%), Gaps = 2/84 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C S+CC  +C  R + C S+ C  SCC SS   CC    C   CC  P  G +    SC 
Sbjct: 135 CQSVCCQPTCC-RPSCCISSCCRPSCCESS---CCRPCCCRPCCCLRPVCGRV----SCH 186

Query: 428 ICCRLPIWSSTSSTFPVWICTSVC 499
             C  P    ++   P+   +S C
Sbjct: 187 TTCYRPTCVISTCPRPLCCASSCC 210



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 33/90 (36%), Positives = 37/90 (41%), Gaps = 7/90 (7%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRC-GTSCCPSSGIL--CCFAILCW--CC--SNPASGSLH 409
           LC   CC  SC    T CC   C   SCC SS     CC ++ C   CC  S   +   H
Sbjct: 19  LCQETCCRPSCCQ--TTCCRTTCYRPSCCVSSCCRPQCCQSVCCQPTCCRPSCCETTCCH 76

Query: 410 SPCSCCICCRLPIWSSTSSTFPVWICTSVC 499
             C    CCR P    +S   P   C SVC
Sbjct: 77  PRCCISSCCR-PSCCMSSCCKP-QCCQSVC 104



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/70 (40%), Positives = 35/70 (50%), Gaps = 8/70 (11%)
 Frame = +2

Query: 254 CNSICCSYSCTL-RCTFCCSNRCGTSCCPSSGI--LCCFAILCW-CCSNPASGSLHSPC- 418
           C   CC  +C   RC  C S+ C  SCC SS     CC ++ C   C +P S  + S C 
Sbjct: 65  CRPSCCETTCCHPRC--CISSCCRPSCCMSSCCKPQCCQSVCCQPTCCHP-SCCISSCCR 121

Query: 419 -SCCI--CCR 439
            SCC+  CCR
Sbjct: 122 PSCCVSRCCR 131



 Score = 41.5 bits (93), Expect = 0.002
 Identities = 30/88 (34%), Positives = 37/88 (42%), Gaps = 6/88 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPCS 421
           C S+CC  +C  R + C +  C   CC SS     CC +  C   CC +          S
Sbjct: 55  CQSVCCQPTCC-RPSCCETTCCHPRCCISSCCRPSCCMSSCCKPQCCQSVCCQPTCCHPS 113

Query: 422 CCI--CCRLPIWSSTSSTFPVWICTSVC 499
           CCI  CCR P    +    P   C SVC
Sbjct: 114 CCISSCCR-PSCCVSRCCRP-QCCQSVC 139



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 26/69 (37%), Positives = 33/69 (47%), Gaps = 7/69 (10%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCW-CCSNPASGSLHSPC-- 418
           C S+CC  +C    + C S+ C  SCC S      CC ++ C   C  P S  + S C  
Sbjct: 100 CQSVCCQPTCC-HPSCCISSCCRPSCCVSRCCRPQCCQSVCCQPTCCRP-SCCISSCCRP 157

Query: 419 SCC--ICCR 439
           SCC   CCR
Sbjct: 158 SCCESSCCR 166



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 23/66 (34%), Positives = 27/66 (40%), Gaps = 4/66 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C+  CC  SC  R + C S  C   CC S   +CC    C   CC +          SCC
Sbjct: 110 CHPSCCISSCC-RPSCCVSRCCRPQCCQS---VCCQPTCCRPSCCISSCCRPSCCESSCC 165

Query: 428 --ICCR 439
              CCR
Sbjct: 166 RPCCCR 171



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 26/69 (37%), Positives = 31/69 (44%), Gaps = 6/69 (8%)
 Frame = +2

Query: 254 CNSICCSYSCTL-RCTF--CCSNRC-GTSCCPSSGILCCFAILCW--CCSNPASGSLHSP 415
           C S CC  SC + RC    CC + C   +CC  S   CC +  C   CC +    S   P
Sbjct: 115 CISSCCRPSCCVSRCCRPQCCQSVCCQPTCCRPS---CCISSCCRPSCCES----SCCRP 167

Query: 416 CSCCICCRL 442
           C C  CC L
Sbjct: 168 CCCRPCCCL 176



 Score = 29.9 bits (64), Expect = 7.8
 Identities = 23/72 (31%), Positives = 26/72 (36%), Gaps = 5/72 (6%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCC--PSSGILCCFAILCW---CCSNP 391
           RPS      C   CC  SC   C  CC   C   CC  P  G + C    C+   C  + 
Sbjct: 146 RPSCCISSCCRPSCCESSC---CRPCCCRPC---CCLRPVCGRVSCHT-TCYRPTCVIST 198

Query: 392 ASGSLHSPCSCC 427
               L    SCC
Sbjct: 199 CPRPLCCASSCC 210


>AJ406937-1|CAC27576.1|  186|Homo sapiens keratin associated protein
           4.5 protein.
          Length = 186

 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 30/88 (34%), Positives = 37/88 (42%), Gaps = 9/88 (10%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCC--SNPA 394
           RP       C + CC  +C  R T CC + C +SCC      CC ++ C   CC  S   
Sbjct: 77  RPCCCRPSCCQTTCCRTTC-CRTTCCCPSCCVSSCCRPQ---CCQSVCCQPTCCRPSYCI 132

Query: 395 SGSLHSPC---SCC--ICCRLPIWSSTS 463
           S   H  C   SCC   CC  P+    S
Sbjct: 133 SSCCHPSCCESSCCRPCCCVRPVCGRVS 160



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 28/82 (34%), Positives = 38/82 (46%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           C S+CC  +C  R ++C S+ C  SCC SS   CC    C CC  P  G +    SC   
Sbjct: 116 CQSVCCQPTCC-RPSYCISSCCHPSCCESS---CCRP--C-CCVRPVCGRV----SCHTT 164

Query: 434 CRLPIWSSTSSTFPVWICTSVC 499
           C  P    ++   P+   +S C
Sbjct: 165 CYRPTCVISTCPRPLCCASSCC 186



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 28/86 (32%), Positives = 35/86 (40%), Gaps = 4/86 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C S+    SC L    CC + C T+CC ++   CC    C   CC +          SCC
Sbjct: 6   CGSVSSEQSCGLE-NCCCPSCCQTTCCRTT---CCRPSCCKPQCCQSVCYQPTCCHPSCC 61

Query: 428 I--CCRLPIWSSTSSTFPVWICTSVC 499
           I  CCR P    +S   P     S C
Sbjct: 62  ISSCCR-PYCCESSCCRPCCCRPSCC 86



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 25/77 (32%), Positives = 31/77 (40%), Gaps = 6/77 (7%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILC--WCCSNPA 394
           RPS      C S+C   +C    + C S+ C   CC SS     CC    C   CC    
Sbjct: 37  RPSCCKPQCCQSVCYQPTCC-HPSCCISSCCRPYCCESSCCRPCCCRPSCCQTTCCRTTC 95

Query: 395 SGSLHSPCSCCI--CCR 439
             +     SCC+  CCR
Sbjct: 96  CRTTCCCPSCCVSSCCR 112



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 26/82 (31%), Positives = 34/82 (41%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           C S CC   C  R + C +  C T+CC ++   CC +     C  P      S C    C
Sbjct: 71  CESSCCR-PCCCRPSCCQTTCCRTTCCRTT--CCCPSCCVSSCCRPQ--CCQSVCCQPTC 125

Query: 434 CRLPIWSSTSSTFPVWICTSVC 499
           CR P +  +S   P   C S C
Sbjct: 126 CR-PSYCISSCCHPS-CCESSC 145



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 26/86 (30%), Positives = 33/86 (38%), Gaps = 4/86 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW-CCSNPASGSLHSPCSCCI 430
           C   CC   C  + T C  + C +SCC      CC +  C  CC  P+     + C    
Sbjct: 41  CKPQCCQSVC-YQPTCCHPSCCISSCCRP---YCCESSCCRPCCCRPS--CCQTTCCRTT 94

Query: 431 CCRLPIWSST---SSTFPVWICTSVC 499
           CCR      +   SS      C SVC
Sbjct: 95  CCRTTCCCPSCCVSSCCRPQCCQSVC 120


>AB126080-1|BAD20207.1|  156|Homo sapiens keratin associated protein
           protein.
          Length = 156

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 25/65 (38%), Positives = 30/65 (46%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           C S CC  SC+  C  CC +    SCC SS   CC    C C S+    S   PC C   
Sbjct: 97  CGSFCCQSSCSKPC--CCQS----SCCQSS---CCKP--CCCQSSCCQSSCFKPCCCQSS 145

Query: 434 CRLPI 448
           C +P+
Sbjct: 146 CCVPV 150



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 31/86 (36%), Positives = 37/86 (43%), Gaps = 2/86 (2%)
 Frame = +2

Query: 254 CNSICCSYS-CTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSC-C 427
           C S  CS S C   C  C S+ CG+ CC SS   C  +  C C S+    S   PC C  
Sbjct: 77  CGSCGCSQSNCCKPC--CSSSGCGSFCCQSS---C--SKPCCCQSSCCQSSCCKPCCCQS 129

Query: 428 ICCRLPIWSSTSSTFPVWICTSVCSI 505
            CC+       SS F    C S C +
Sbjct: 130 SCCQ-------SSCFKPCCCQSSCCV 148



 Score = 37.5 bits (83), Expect = 0.039
 Identities = 26/83 (31%), Positives = 30/83 (36%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           C S CC   C  +   CC   C  S C S G        C  C +   G     CS   C
Sbjct: 31  CGSSCCVPICCCKPVCCCVPACSCSSCGSCG---GSKGGCGSCGSSKGGCGSCGCSQSNC 87

Query: 434 CRLPIWSSTSSTFPVWICTSVCS 502
           C+    SS   +F    C S CS
Sbjct: 88  CKPCCSSSGCGSF---CCQSSCS 107



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 19/47 (40%), Positives = 22/47 (46%), Gaps = 5/47 (10%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTS-----CCPSSGILCCFAILCWC 379
           C S CC  SC   C  C S+ C +S     CC SS   CC  + C C
Sbjct: 112 CQSSCCQSSCCKPCC-CQSSCCQSSCFKPCCCQSS---CCVPVCCQC 154


>BC130562-1|AAI30563.1|  195|Homo sapiens keratin associated protein
           4-14 protein.
          Length = 195

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 30/70 (42%), Positives = 37/70 (52%), Gaps = 8/70 (11%)
 Frame = +2

Query: 254 CNSICCSYSCTL-RCTFCCSNRCGTSCCPSSGI--LCCFAILCW-CCSNPASGSLHSPC- 418
           C S+CC  +C   RC  C S+ C  SCC SS     CC ++ C   C +P S S+ S C 
Sbjct: 90  CQSMCCQPTCCRPRC--CISSCCRPSCCVSSCCRPQCCQSVCCQPTCCHP-SCSISSCCR 146

Query: 419 -SCC--ICCR 439
            SCC   CCR
Sbjct: 147 PSCCESSCCR 156



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 27/69 (39%), Positives = 33/69 (47%), Gaps = 7/69 (10%)
 Frame = +2

Query: 254 CNSICCSYSCTL-RCTFCCSNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPC 418
           C S+CC  +C   RC  C S+ C  SCC SS     CC ++ C   CC      S     
Sbjct: 55  CQSVCCQPTCCRPRC--CISSCCRPSCCVSSCCKPQCCQSMCCQPTCCRPRCCISSCCRP 112

Query: 419 SCCI--CCR 439
           SCC+  CCR
Sbjct: 113 SCCVSSCCR 121



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 25/69 (36%), Positives = 30/69 (43%), Gaps = 6/69 (8%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPC 418
           LC   CC  SC    T C +  C  SCC SS     CC ++ C   CC      S     
Sbjct: 19  LCQETCCRPSCC-ETTCCRTTYCRPSCCVSSCCRPQCCQSVCCQPTCCRPRCCISSCCRP 77

Query: 419 SCCI--CCR 439
           SCC+  CC+
Sbjct: 78  SCCVSSCCK 86



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 29/84 (34%), Positives = 36/84 (42%), Gaps = 2/84 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS--NRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           C S+CC  +C   C   CS  + C  SCC SS   CC    C CC  P  G +    SC 
Sbjct: 125 CQSVCCQPTC---CHPSCSISSCCRPSCCESS---CCRP--C-CCLRPVCGGV----SCH 171

Query: 428 ICCRLPIWSSTSSTFPVWICTSVC 499
             C  P    +S   P+   +S C
Sbjct: 172 TTCYRPTCVISSCPRPLCCASSCC 195



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 25/74 (33%), Positives = 31/74 (41%), Gaps = 4/74 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC--SCC 427
           C   CC  SC  R + C S+ C   CC S   +CC    C    + +S    S C  SCC
Sbjct: 100 CRPRCCISSCC-RPSCCVSSCCRPQCCQS---VCCQPTCCHPSCSISSCCRPSCCESSCC 155

Query: 428 --ICCRLPIWSSTS 463
              CC  P+    S
Sbjct: 156 RPCCCLRPVCGGVS 169


>BC126131-1|AAI26132.1|  195|Homo sapiens keratin associated protein
           4-14 protein.
          Length = 195

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 30/70 (42%), Positives = 37/70 (52%), Gaps = 8/70 (11%)
 Frame = +2

Query: 254 CNSICCSYSCTL-RCTFCCSNRCGTSCCPSSGI--LCCFAILCW-CCSNPASGSLHSPC- 418
           C S+CC  +C   RC  C S+ C  SCC SS     CC ++ C   C +P S S+ S C 
Sbjct: 90  CQSMCCQPTCCRPRC--CISSCCRPSCCVSSCCRPQCCQSVCCQPTCCHP-SCSISSCCR 146

Query: 419 -SCC--ICCR 439
            SCC   CCR
Sbjct: 147 PSCCESSCCR 156



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 27/69 (39%), Positives = 33/69 (47%), Gaps = 7/69 (10%)
 Frame = +2

Query: 254 CNSICCSYSCTL-RCTFCCSNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPC 418
           C S+CC  +C   RC  C S+ C  SCC SS     CC ++ C   CC      S     
Sbjct: 55  CQSVCCQPTCCRPRC--CISSCCRPSCCVSSCCKPQCCQSMCCQPTCCRPRCCISSCCRP 112

Query: 419 SCCI--CCR 439
           SCC+  CCR
Sbjct: 113 SCCVSSCCR 121



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 25/69 (36%), Positives = 30/69 (43%), Gaps = 6/69 (8%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPC 418
           LC   CC  SC    T C +  C  SCC SS     CC ++ C   CC      S     
Sbjct: 19  LCQETCCRPSCC-ETTCCRTTYCRPSCCVSSCCRPQCCQSVCCQPTCCRPRCCISSCCRP 77

Query: 419 SCCI--CCR 439
           SCC+  CC+
Sbjct: 78  SCCVSSCCK 86



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 29/84 (34%), Positives = 36/84 (42%), Gaps = 2/84 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS--NRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           C S+CC  +C   C   CS  + C  SCC SS   CC    C CC  P  G +    SC 
Sbjct: 125 CQSVCCQPTC---CHPSCSISSCCRPSCCESS---CCRP--C-CCLRPVCGGV----SCH 171

Query: 428 ICCRLPIWSSTSSTFPVWICTSVC 499
             C  P    +S   P+   +S C
Sbjct: 172 TTCYRPTCVISSCPRPLCCASSCC 195



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 25/74 (33%), Positives = 31/74 (41%), Gaps = 4/74 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC--SCC 427
           C   CC  SC  R + C S+ C   CC S   +CC    C    + +S    S C  SCC
Sbjct: 100 CRPRCCISSCC-RPSCCVSSCCRPQCCQS---VCCQPTCCHPSCSISSCCRPSCCESSCC 155

Query: 428 --ICCRLPIWSSTS 463
              CC  P+    S
Sbjct: 156 RPCCCLRPVCGGVS 169


>BC110619-1|AAI10620.1|  174|Homo sapiens keratin associated protein
           9-2 protein.
          Length = 174

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 28/88 (31%), Positives = 34/88 (38%), Gaps = 6/88 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRC--TFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASG--SLHSP 415
           C   C   SC   C  T CC   C TSCC  S   CC    C   CC +   G  S  S 
Sbjct: 48  CQPCCRPTSCQNTCCRTTCCQPTCVTSCCQPS---CCSTPCCQPTCCGSSCCGQTSCGSS 104

Query: 416 CSCCICCRLPIWSSTSSTFPVWICTSVC 499
           C     C  P++   +  +P  +C   C
Sbjct: 105 CGQSSSC-APVYCRRTCYYPTTVCLPGC 131



 Score = 37.5 bits (83), Expect = 0.039
 Identities = 28/89 (31%), Positives = 37/89 (41%), Gaps = 11/89 (12%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCG--TSCCPSSGILCCFAILCWC---CSNP 391
           +PS    P C   CC  SC  + +  C + CG  +SC P      C+     C   C N 
Sbjct: 77  QPSCCSTPCCQPTCCGSSCCGQTS--CGSSCGQSSSCAPVYCRRTCYYPTTVCLPGCLNQ 134

Query: 392 ASGS-LHSPC---SCC--ICCRLPIWSST 460
           + GS    PC   +CC   CCR   +  T
Sbjct: 135 SCGSNCCQPCCRPACCETTCCRTTCFQPT 163



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 4/52 (7%)
 Frame = +2

Query: 296 TFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC--SCCI--CCR 439
           T CCS  C  +CC ++   CC    CW  +   + S  S C  +CC+  CC+
Sbjct: 2   THCCSPCCQPTCCRTT---CC-RTTCWKPTTVTTCSSTSCCQPACCVSSCCQ 49


>BC074919-1|AAH74919.1|  159|Homo sapiens keratin associated protein
           9-3 protein.
          Length = 159

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 29/84 (34%), Positives = 32/84 (38%), Gaps = 8/84 (9%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTF--CCSNR-CGTSCC-PSSGILCCFAILCW--CCSNPASGSLH 409
           P C   CC  SC   C    CC N  C T+CC P     CC    C   CC     GS  
Sbjct: 31  PCCQPSCCVSSCCQPCCHPTCCQNTCCRTTCCQPICVTSCCQPSCCSTPCCQPTCCGSSC 90

Query: 410 SPCSCC--ICCRLPIWSSTSSTFP 475
              S C  + CR   +  TS   P
Sbjct: 91  GQSSSCAPVYCRRTCYHPTSVCLP 114



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 19/78 (24%), Positives = 27/78 (34%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSL 406
           +PS    P C   CC  SC  + + C    C  +C   + +     +   C SN      
Sbjct: 72  QPSCCSTPCCQPTCCGSSCG-QSSSCAPVYCRRTCYHPTSVCLPGCLNQSCGSNCCQPCC 130

Query: 407 HSPCSCCICCRLPIWSST 460
              C    CCR   +  T
Sbjct: 131 RPACCETTCCRTTCFQPT 148


>BC074918-1|AAH74918.1|  159|Homo sapiens keratin associated protein
           9-3 protein.
          Length = 159

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 29/84 (34%), Positives = 32/84 (38%), Gaps = 8/84 (9%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTF--CCSNR-CGTSCC-PSSGILCCFAILCW--CCSNPASGSLH 409
           P C   CC  SC   C    CC N  C T+CC P     CC    C   CC     GS  
Sbjct: 31  PCCQPSCCVSSCCQPCCHPTCCQNTCCRTTCCQPICVTSCCQPSCCSTPCCQPTCCGSSC 90

Query: 410 SPCSCC--ICCRLPIWSSTSSTFP 475
              S C  + CR   +  TS   P
Sbjct: 91  GQSSSCAPVYCRRTCYHPTSVCLP 114



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 19/78 (24%), Positives = 27/78 (34%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSL 406
           +PS    P C   CC  SC  + + C    C  +C   + +     +   C SN      
Sbjct: 72  QPSCCSTPCCQPTCCGSSCG-QSSSCAPVYCRRTCYHPTSVCLPGCLNQSCGSNCCQPCC 130

Query: 407 HSPCSCCICCRLPIWSST 460
              C    CCR   +  T
Sbjct: 131 RPACCETTCCRTTCFQPT 148


>AJ406947-1|CAC27586.1|  159|Homo sapiens keratin associated protein
           9.3 protein.
          Length = 159

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 29/84 (34%), Positives = 32/84 (38%), Gaps = 8/84 (9%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTF--CCSNR-CGTSCC-PSSGILCCFAILCW--CCSNPASGSLH 409
           P C   CC  SC   C    CC N  C T+CC P     CC    C   CC     GS  
Sbjct: 31  PCCQPSCCVSSCCQPCCHPTCCQNTCCRTTCCQPICVTSCCQPSCCSTPCCQPTCCGSSC 90

Query: 410 SPCSCC--ICCRLPIWSSTSSTFP 475
              S C  + CR   +  TS   P
Sbjct: 91  GQSSSCAPVYCRRTCYHPTSVCLP 114



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 19/78 (24%), Positives = 27/78 (34%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSL 406
           +PS    P C   CC  SC  + + C    C  +C   + +     +   C SN      
Sbjct: 72  QPSCCSTPCCQPTCCGSSCG-QSSSCAPVYCRRTCYHPTSVCLPGCLNQSCGSNCCQPCC 130

Query: 407 HSPCSCCICCRLPIWSST 460
              C    CCR   +  T
Sbjct: 131 RPACCETTCCRTTCFQPT 148


>AJ406946-1|CAC27585.1|  174|Homo sapiens keratin associated protein
           9.2 protein.
          Length = 174

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 28/88 (31%), Positives = 34/88 (38%), Gaps = 6/88 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRC--TFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASG--SLHSP 415
           C   C   SC   C  T CC   C TSCC  S   CC    C   CC +   G  S  S 
Sbjct: 48  CQPCCRPTSCQNTCCRTTCCQPTCVTSCCQPS---CCSTPCCQPTCCGSSCCGQTSCGSS 104

Query: 416 CSCCICCRLPIWSSTSSTFPVWICTSVC 499
           C     C  P++   +  +P  +C   C
Sbjct: 105 CGQSSSC-APVYCRRTCYYPTTVCLPGC 131



 Score = 37.5 bits (83), Expect = 0.039
 Identities = 28/89 (31%), Positives = 37/89 (41%), Gaps = 11/89 (12%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCG--TSCCPSSGILCCFAILCWC---CSNP 391
           +PS    P C   CC  SC  + +  C + CG  +SC P      C+     C   C N 
Sbjct: 77  QPSCCSTPCCQPTCCGSSCCGQTS--CGSSCGQSSSCAPVYCRRTCYYPTTVCLPGCLNQ 134

Query: 392 ASGS-LHSPC---SCC--ICCRLPIWSST 460
           + GS    PC   +CC   CCR   +  T
Sbjct: 135 SCGSNCCQPCCRPACCETTCCRTTCFQPT 163



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 4/52 (7%)
 Frame = +2

Query: 296 TFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC--SCCI--CCR 439
           T CCS  C  +CC ++   CC    CW  +   + S  S C  +CC+  CC+
Sbjct: 2   THCCSPCCQPTCCRTT---CC-RTTCWKPTTVTTCSSTSCCQPACCVSSCCQ 49


>AJ406944-1|CAC27583.1|  195|Homo sapiens keratin associated protein
           4.14 protein.
          Length = 195

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 30/70 (42%), Positives = 37/70 (52%), Gaps = 8/70 (11%)
 Frame = +2

Query: 254 CNSICCSYSCTL-RCTFCCSNRCGTSCCPSSGI--LCCFAILCW-CCSNPASGSLHSPC- 418
           C S+CC  +C   RC  C S+ C  SCC SS     CC ++ C   C +P S S+ S C 
Sbjct: 90  CQSMCCQPTCCRPRC--CISSCCRPSCCVSSCCRPQCCQSVCCQPTCCHP-SCSISSCCR 146

Query: 419 -SCC--ICCR 439
            SCC   CCR
Sbjct: 147 PSCCESSCCR 156



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 27/69 (39%), Positives = 33/69 (47%), Gaps = 7/69 (10%)
 Frame = +2

Query: 254 CNSICCSYSCTL-RCTFCCSNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPC 418
           C S+CC  +C   RC  C S+ C  SCC SS     CC ++ C   CC      S     
Sbjct: 55  CQSVCCQPTCCRPRC--CISSCCRPSCCVSSCCKPQCCQSMCCQPTCCRPRCCISSCCRP 112

Query: 419 SCCI--CCR 439
           SCC+  CCR
Sbjct: 113 SCCVSSCCR 121



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 25/69 (36%), Positives = 30/69 (43%), Gaps = 6/69 (8%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPC 418
           LC   CC  SC    T C +  C  SCC SS     CC ++ C   CC      S     
Sbjct: 19  LCQETCCRPSCC-ETTCCRTTYCRPSCCVSSCCRPQCCQSVCCQPTCCRPRCCISSCCRP 77

Query: 419 SCCI--CCR 439
           SCC+  CC+
Sbjct: 78  SCCVSSCCK 86



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 29/84 (34%), Positives = 36/84 (42%), Gaps = 2/84 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS--NRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           C S+CC  +C   C   CS  + C  SCC SS   CC    C CC  P  G +    SC 
Sbjct: 125 CQSVCCQPTC---CHPSCSISSCCRPSCCESS---CCRP--C-CCLRPVCGGV----SCH 171

Query: 428 ICCRLPIWSSTSSTFPVWICTSVC 499
             C  P    +S   P+   +S C
Sbjct: 172 TTCYRPTCVISSCPRPLCCASSCC 195



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 25/74 (33%), Positives = 31/74 (41%), Gaps = 4/74 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC--SCC 427
           C   CC  SC  R + C S+ C   CC S   +CC    C    + +S    S C  SCC
Sbjct: 100 CRPRCCISSCC-RPSCCVSSCCRPQCCQS---VCCQPTCCHPSCSISSCCRPSCCESSCC 155

Query: 428 --ICCRLPIWSSTS 463
              CC  P+    S
Sbjct: 156 RPCCCLRPVCGGVS 169


>AJ406940-1|CAC27579.1|  114|Homo sapiens keratin associated protein
           4.8 protein.
          Length = 114

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 28/69 (40%), Positives = 36/69 (52%), Gaps = 7/69 (10%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCW-CCSNPASGSLHSPC-- 418
           C S+CC  +C    + C S+ C  SCC SS     CC ++ C   C +P S S+ S C  
Sbjct: 9   CQSVCCQPTCC-HPSCCISSCCRPSCCVSSCCKPQCCQSVCCQPTCCHP-SCSISSCCRP 66

Query: 419 SCC--ICCR 439
           SCC   CCR
Sbjct: 67  SCCESSCCR 75



 Score = 39.1 bits (87), Expect = 0.013
 Identities = 29/84 (34%), Positives = 36/84 (42%), Gaps = 2/84 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS--NRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           C S+CC  +C   C   CS  + C  SCC SS   CC    C CC  P  G +    SC 
Sbjct: 44  CQSVCCQPTC---CHPSCSISSCCRPSCCESS---CCRP--C-CCVRPVCGRV----SCH 90

Query: 428 ICCRLPIWSSTSSTFPVWICTSVC 499
             C  P    ++   PV   +S C
Sbjct: 91  TTCYRPTCVISTCPRPVCCASSCC 114



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 25/74 (33%), Positives = 32/74 (43%), Gaps = 4/74 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC--SCC 427
           C+  CC  SC  R + C S+ C   CC S   +CC    C    + +S    S C  SCC
Sbjct: 19  CHPSCCISSCC-RPSCCVSSCCKPQCCQS---VCCQPTCCHPSCSISSCCRPSCCESSCC 74

Query: 428 --ICCRLPIWSSTS 463
              CC  P+    S
Sbjct: 75  RPCCCVRPVCGRVS 88


>BC074982-1|AAH74982.1|  159|Homo sapiens keratin associated protein
           9-8 protein.
          Length = 159

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 27/86 (31%), Positives = 32/86 (37%), Gaps = 4/86 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRC--TFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCS 421
           C S CC   C   C    CC   C TSCC  S   CC    C   CC   + GS     S
Sbjct: 38  CVSSCCQPCCRPTCCQNTCCQPICVTSCCQPS---CCSTPCCQPTCCGQTSCGSSCGQSS 94

Query: 422 CCICCRLPIWSSTSSTFPVWICTSVC 499
            C     P++   +   P  +C   C
Sbjct: 95  SC----APVYCRRTCYHPTTVCLPGC 116



 Score = 33.1 bits (72), Expect = 0.84
 Identities = 24/70 (34%), Positives = 32/70 (45%), Gaps = 8/70 (11%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC-WCCSNPAS----GSLHSPC 418
           C++ CC  +C      C    CG+SC  SS    C  + C   C +P +    G L+  C
Sbjct: 71  CSTPCCQPTC------CGQTSCGSSCGQSSS---CAPVYCRRTCYHPTTVCLPGCLNQSC 121

Query: 419 --SCC-ICCR 439
             SCC  CCR
Sbjct: 122 GSSCCQPCCR 131



 Score = 33.1 bits (72), Expect = 0.84
 Identities = 23/66 (34%), Positives = 29/66 (43%), Gaps = 8/66 (12%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFC---CSNR-CGTSCC-PSSGILCCFAILC-WCCSNPASGSLHSP 415
           C  + C  +C    T C   C N+ CG+SCC P     CC    C   C  P    ++S 
Sbjct: 96  CAPVYCRRTCYHPTTVCLPGCLNQSCGSSCCQPCCRPACCETTCCRTTCFQPT--CVYSC 153

Query: 416 C--SCC 427
           C  SCC
Sbjct: 154 CQPSCC 159



 Score = 30.3 bits (65), Expect = 5.9
 Identities = 20/70 (28%), Positives = 28/70 (40%), Gaps = 2/70 (2%)
 Frame = +2

Query: 296 TFCCSNRCGTSCCPSSGILCCF--AILCWCCSNPASGSLHSPCSCCICCRLPIWSSTSST 469
           T CCS  C  +CC ++    C+    +  C S P         SCC  C  P     +  
Sbjct: 2   THCCSPCCQPTCCRTT----CWKPTTVTTCSSTPCCQPSCCVSSCCQPCCRPTCCQNTCC 57

Query: 470 FPVWICTSVC 499
            P+ + TS C
Sbjct: 58  QPICV-TSCC 66


>BC074981-1|AAH74981.1|  159|Homo sapiens keratin associated protein
           9-8 protein.
          Length = 159

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 27/86 (31%), Positives = 32/86 (37%), Gaps = 4/86 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRC--TFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCS 421
           C S CC   C   C    CC   C TSCC  S   CC    C   CC   + GS     S
Sbjct: 38  CVSSCCQPCCRPTCCQNTCCQPICVTSCCQPS---CCSTPCCQPTCCGQTSCGSSCGQSS 94

Query: 422 CCICCRLPIWSSTSSTFPVWICTSVC 499
            C     P++   +   P  +C   C
Sbjct: 95  SC----APVYCRRTCYHPTTVCLPGC 116



 Score = 33.1 bits (72), Expect = 0.84
 Identities = 24/70 (34%), Positives = 32/70 (45%), Gaps = 8/70 (11%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC-WCCSNPAS----GSLHSPC 418
           C++ CC  +C      C    CG+SC  SS    C  + C   C +P +    G L+  C
Sbjct: 71  CSTPCCQPTC------CGQTSCGSSCGQSSS---CAPVYCRRTCYHPTTVCLPGCLNQSC 121

Query: 419 --SCC-ICCR 439
             SCC  CCR
Sbjct: 122 GSSCCQPCCR 131



 Score = 33.1 bits (72), Expect = 0.84
 Identities = 23/66 (34%), Positives = 29/66 (43%), Gaps = 8/66 (12%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFC---CSNR-CGTSCC-PSSGILCCFAILC-WCCSNPASGSLHSP 415
           C  + C  +C    T C   C N+ CG+SCC P     CC    C   C  P    ++S 
Sbjct: 96  CAPVYCRRTCYHPTTVCLPGCLNQSCGSSCCQPCCRPACCETTCCRTTCFQPT--CVYSC 153

Query: 416 C--SCC 427
           C  SCC
Sbjct: 154 CQPSCC 159



 Score = 30.3 bits (65), Expect = 5.9
 Identities = 20/70 (28%), Positives = 28/70 (40%), Gaps = 2/70 (2%)
 Frame = +2

Query: 296 TFCCSNRCGTSCCPSSGILCCF--AILCWCCSNPASGSLHSPCSCCICCRLPIWSSTSST 469
           T CCS  C  +CC ++    C+    +  C S P         SCC  C  P     +  
Sbjct: 2   THCCSPCCQPTCCRTT----CWKPTTVTTCSSTPCCQPSCCVSSCCQPCCRPTCCQNTCC 57

Query: 470 FPVWICTSVC 499
            P+ + TS C
Sbjct: 58  QPICV-TSCC 66


>AJ406950-1|CAC27589.1|  159|Homo sapiens keratin associated protein
           9.8 protein.
          Length = 159

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 27/86 (31%), Positives = 32/86 (37%), Gaps = 4/86 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRC--TFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCS 421
           C S CC   C   C    CC   C TSCC  S   CC    C   CC   + GS     S
Sbjct: 38  CVSSCCQPCCRPTCCQNTCCQPICVTSCCQPS---CCSTPCCQPTCCGQTSCGSSCGQSS 94

Query: 422 CCICCRLPIWSSTSSTFPVWICTSVC 499
            C     P++   +   P  +C   C
Sbjct: 95  SC----APVYCRRTCYHPTTVCLPGC 116



 Score = 33.1 bits (72), Expect = 0.84
 Identities = 24/70 (34%), Positives = 32/70 (45%), Gaps = 8/70 (11%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC-WCCSNPAS----GSLHSPC 418
           C++ CC  +C      C    CG+SC  SS    C  + C   C +P +    G L+  C
Sbjct: 71  CSTPCCQPTC------CGQTSCGSSCGQSSS---CAPVYCRRTCYHPTTVCLPGCLNQSC 121

Query: 419 --SCC-ICCR 439
             SCC  CCR
Sbjct: 122 GSSCCQPCCR 131



 Score = 33.1 bits (72), Expect = 0.84
 Identities = 23/66 (34%), Positives = 29/66 (43%), Gaps = 8/66 (12%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFC---CSNR-CGTSCC-PSSGILCCFAILC-WCCSNPASGSLHSP 415
           C  + C  +C    T C   C N+ CG+SCC P     CC    C   C  P    ++S 
Sbjct: 96  CAPVYCRRTCYHPTTVCLPGCLNQSCGSSCCQPCCRPACCETTCCRTTCFQPT--CVYSC 153

Query: 416 C--SCC 427
           C  SCC
Sbjct: 154 CQPSCC 159



 Score = 30.3 bits (65), Expect = 5.9
 Identities = 20/70 (28%), Positives = 28/70 (40%), Gaps = 2/70 (2%)
 Frame = +2

Query: 296 TFCCSNRCGTSCCPSSGILCCF--AILCWCCSNPASGSLHSPCSCCICCRLPIWSSTSST 469
           T CCS  C  +CC ++    C+    +  C S P         SCC  C  P     +  
Sbjct: 2   THCCSPCCQPTCCRTT----CWKPTTVTTCSSTPCCQPSCCVSSCCQPCCRPTCCQNTCC 57

Query: 470 FPVWICTSVC 499
            P+ + TS C
Sbjct: 58  QPICV-TSCC 66


>BC101162-1|AAI01163.1|  201|Homo sapiens keratin associated protein
           4-12 protein.
          Length = 201

 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 28/82 (34%), Positives = 37/82 (45%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           C S+CC  +C  R + C S+ C  SCC SS   CC    C CC  P  G +    SC   
Sbjct: 131 CQSVCCQPTCC-RPSCCISSSCCPSCCESS---CCRP--C-CCLRPVCGRV----SCHTT 179

Query: 434 CRLPIWSSTSSTFPVWICTSVC 499
           C  P    ++   P+   +S C
Sbjct: 180 CYRPTCVISTCPRPLCCASSCC 201



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 29/89 (32%), Positives = 37/89 (41%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C S+CC  +C  R + C +  C T+CC  S   CC +  C   CC +          SCC
Sbjct: 51  CQSVCCQPTCC-RPSCCQTTCCRTTCCRPS---CCVSSCCRPQCCQSVCCQPTCCRPSCC 106

Query: 428 --ICCRLPIWSST---SSTFPVWICTSVC 499
              CCR      +   SS      C SVC
Sbjct: 107 QTTCCRTTCCRPSCCVSSCCRPQCCQSVC 135



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/87 (32%), Positives = 36/87 (41%), Gaps = 5/87 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C S+CC  +C  R + C +  C T+CC  S   CC +  C   CC +          SCC
Sbjct: 91  CQSVCCQPTCC-RPSCCQTTCCRTTCCRPS---CCVSSCCRPQCCQSVCCQPTCCRPSCC 146

Query: 428 I---CCRLPIWSSTSSTFPVWICTSVC 499
           I   CC  P    +S   P      VC
Sbjct: 147 ISSSCC--PSCCESSCCRPCCCLRPVC 171



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 22/66 (33%), Positives = 29/66 (43%), Gaps = 4/66 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C + CC  +C  R + C S+ C   CC S   +CC    C   CC      +     SCC
Sbjct: 26  CQTTCCRTTCC-RPSCCVSSCCRPQCCQS---VCCQPTCCRPSCCQTTCCRTTCCRPSCC 81

Query: 428 I--CCR 439
           +  CCR
Sbjct: 82  VSSCCR 87



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 23/74 (31%), Positives = 31/74 (41%), Gaps = 4/74 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C + CC  +C  R + C S+ C   CC S   +CC    C   CC + +        SCC
Sbjct: 106 CQTTCCRTTCC-RPSCCVSSCCRPQCCQS---VCCQPTCCRPSCCISSSCCPSCCESSCC 161

Query: 428 --ICCRLPIWSSTS 463
              CC  P+    S
Sbjct: 162 RPCCCLRPVCGRVS 175



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 30/93 (32%), Positives = 35/93 (37%), Gaps = 11/93 (11%)
 Frame = +2

Query: 254 CNSICCSYSCTLR--CT-FCCSNRC-GTSCCPSSGILCCFAILC--WCCSNPASGSLHSP 415
           C S+C    C L   C   CC   C  T+CC  S   CC +  C   CC +         
Sbjct: 6   CGSVCSDQGCGLENCCRPSCCQTTCCRTTCCRPS---CCVSSCCRPQCCQSVCCQPTCCR 62

Query: 416 CSCC--ICCRLPIWSST---SSTFPVWICTSVC 499
            SCC   CCR      +   SS      C SVC
Sbjct: 63  PSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVC 95


>BC101160-1|AAI01161.1|  201|Homo sapiens keratin associated protein
           4-12 protein.
          Length = 201

 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 28/82 (34%), Positives = 37/82 (45%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           C S+CC  +C  R + C S+ C  SCC SS   CC    C CC  P  G +    SC   
Sbjct: 131 CQSVCCQPTCC-RPSCCISSSCCPSCCESS---CCRP--C-CCLRPVCGRV----SCHTT 179

Query: 434 CRLPIWSSTSSTFPVWICTSVC 499
           C  P    ++   P+   +S C
Sbjct: 180 CYRPTCVISTCPRPLCCASSCC 201



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 29/89 (32%), Positives = 37/89 (41%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C S+CC  +C  R + C +  C T+CC  S   CC +  C   CC +          SCC
Sbjct: 51  CQSVCCQPTCC-RPSCCQTTCCRTTCCRPS---CCVSSCCRPQCCQSVCCQPTCCRPSCC 106

Query: 428 --ICCRLPIWSST---SSTFPVWICTSVC 499
              CCR      +   SS      C SVC
Sbjct: 107 QTTCCRTTCCRPSCCVSSCCRPQCCQSVC 135



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/87 (32%), Positives = 36/87 (41%), Gaps = 5/87 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C S+CC  +C  R + C +  C T+CC  S   CC +  C   CC +          SCC
Sbjct: 91  CQSVCCQPTCC-RPSCCQTTCCRTTCCRPS---CCVSSCCRPQCCQSVCCQPTCCRPSCC 146

Query: 428 I---CCRLPIWSSTSSTFPVWICTSVC 499
           I   CC  P    +S   P      VC
Sbjct: 147 ISSSCC--PSCCESSCCRPCCCLRPVC 171



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 22/66 (33%), Positives = 29/66 (43%), Gaps = 4/66 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C + CC  +C  R + C S+ C   CC S   +CC    C   CC      +     SCC
Sbjct: 26  CQTTCCRTTCC-RPSCCVSSCCRPQCCQS---VCCQPTCCRPSCCQTTCCRTTCCRPSCC 81

Query: 428 I--CCR 439
           +  CCR
Sbjct: 82  VSSCCR 87



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 23/74 (31%), Positives = 31/74 (41%), Gaps = 4/74 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C + CC  +C  R + C S+ C   CC S   +CC    C   CC + +        SCC
Sbjct: 106 CQTTCCRTTCC-RPSCCVSSCCRPQCCQS---VCCQPTCCRPSCCISSSCCPSCCESSCC 161

Query: 428 --ICCRLPIWSSTS 463
              CC  P+    S
Sbjct: 162 RPCCCLRPVCGRVS 175



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 30/93 (32%), Positives = 35/93 (37%), Gaps = 11/93 (11%)
 Frame = +2

Query: 254 CNSICCSYSCTLR--CT-FCCSNRC-GTSCCPSSGILCCFAILC--WCCSNPASGSLHSP 415
           C S+C    C L   C   CC   C  T+CC  S   CC +  C   CC +         
Sbjct: 6   CGSVCSDQGCGLENCCRPSCCQTTCCRTTCCRPS---CCVSSCCRPQCCQSVCCQPTCCR 62

Query: 416 CSCC--ICCRLPIWSST---SSTFPVWICTSVC 499
            SCC   CCR      +   SS      C SVC
Sbjct: 63  PSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVC 95


>BC101159-1|AAI01160.1|  201|Homo sapiens keratin associated protein
           4-12 protein.
          Length = 201

 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 28/82 (34%), Positives = 37/82 (45%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           C S+CC  +C  R + C S+ C  SCC SS   CC    C CC  P  G +    SC   
Sbjct: 131 CQSVCCQPTCC-RPSCCISSSCCPSCCESS---CCRP--C-CCLRPVCGRV----SCHTT 179

Query: 434 CRLPIWSSTSSTFPVWICTSVC 499
           C  P    ++   P+   +S C
Sbjct: 180 CYRPTCVISTCPRPLCCASSCC 201



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 29/89 (32%), Positives = 37/89 (41%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C S+CC  +C  R + C +  C T+CC  S   CC +  C   CC +          SCC
Sbjct: 51  CQSVCCQPTCC-RPSCCQTTCCRTTCCRPS---CCVSSCCRPQCCQSVCCQPTCCRPSCC 106

Query: 428 --ICCRLPIWSST---SSTFPVWICTSVC 499
              CCR      +   SS      C SVC
Sbjct: 107 QTTCCRTTCCRPSCCVSSCCRPQCCQSVC 135



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/87 (32%), Positives = 36/87 (41%), Gaps = 5/87 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C S+CC  +C  R + C +  C T+CC  S   CC +  C   CC +          SCC
Sbjct: 91  CQSVCCQPTCC-RPSCCQTTCCRTTCCRPS---CCVSSCCRPQCCQSVCCQPTCCRPSCC 146

Query: 428 I---CCRLPIWSSTSSTFPVWICTSVC 499
           I   CC  P    +S   P      VC
Sbjct: 147 ISSSCC--PSCCESSCCRPCCCLRPVC 171



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 22/66 (33%), Positives = 29/66 (43%), Gaps = 4/66 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C + CC  +C  R + C S+ C   CC S   +CC    C   CC      +     SCC
Sbjct: 26  CQTTCCRTTCC-RPSCCVSSCCRPQCCQS---VCCQPTCCRPSCCQTTCCRTTCCRPSCC 81

Query: 428 I--CCR 439
           +  CCR
Sbjct: 82  VSSCCR 87



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 23/74 (31%), Positives = 31/74 (41%), Gaps = 4/74 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C + CC  +C  R + C S+ C   CC S   +CC    C   CC + +        SCC
Sbjct: 106 CQTTCCRTTCC-RPSCCVSSCCRPQCCQS---VCCQPTCCRPSCCISSSCCPSCCESSCC 161

Query: 428 --ICCRLPIWSSTS 463
              CC  P+    S
Sbjct: 162 RPCCCLRPVCGRVS 175



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 30/93 (32%), Positives = 35/93 (37%), Gaps = 11/93 (11%)
 Frame = +2

Query: 254 CNSICCSYSCTLR--CT-FCCSNRC-GTSCCPSSGILCCFAILC--WCCSNPASGSLHSP 415
           C S+C    C L   C   CC   C  T+CC  S   CC +  C   CC +         
Sbjct: 6   CGSVCSDQGCGLENCCRPSCCQTTCCRTTCCRPS---CCVSSCCRPQCCQSVCCQPTCCR 62

Query: 416 CSCC--ICCRLPIWSST---SSTFPVWICTSVC 499
            SCC   CCR      +   SS      C SVC
Sbjct: 63  PSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVC 95


>BC004212-1|AAH04212.1|  201|Homo sapiens keratin associated protein
           4-12 protein.
          Length = 201

 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 28/82 (34%), Positives = 37/82 (45%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           C S+CC  +C  R + C S+ C  SCC SS   CC    C CC  P  G +    SC   
Sbjct: 131 CQSVCCQPTCC-RPSCCISSSCCPSCCESS---CCRP--C-CCLRPVCGRV----SCHTT 179

Query: 434 CRLPIWSSTSSTFPVWICTSVC 499
           C  P    ++   P+   +S C
Sbjct: 180 CYRPTCVISTCPRPLCCASSCC 201



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 29/89 (32%), Positives = 37/89 (41%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C S+CC  +C  R + C +  C T+CC  S   CC +  C   CC +          SCC
Sbjct: 51  CQSVCCQPTCC-RPSCCQTTCCRTTCCRPS---CCVSSCCRPQCCQSVCCQPTCCRPSCC 106

Query: 428 --ICCRLPIWSST---SSTFPVWICTSVC 499
              CCR      +   SS      C SVC
Sbjct: 107 QTTCCRTTCCRPSCCVSSCCRPQCCQSVC 135



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/87 (32%), Positives = 36/87 (41%), Gaps = 5/87 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C S+CC  +C  R + C +  C T+CC  S   CC +  C   CC +          SCC
Sbjct: 91  CQSVCCQPTCC-RPSCCQTTCCRTTCCRPS---CCVSSCCRPQCCQSVCCQPTCCRPSCC 146

Query: 428 I---CCRLPIWSSTSSTFPVWICTSVC 499
           I   CC  P    +S   P      VC
Sbjct: 147 ISSSCC--PSCCESSCCRPCCCLRPVC 171



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 22/66 (33%), Positives = 29/66 (43%), Gaps = 4/66 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C + CC  +C  R + C S+ C   CC S   +CC    C   CC      +     SCC
Sbjct: 26  CQTTCCRTTCC-RPSCCVSSCCRPQCCQS---VCCQPTCCRPSCCQTTCCRTTCCRPSCC 81

Query: 428 I--CCR 439
           +  CCR
Sbjct: 82  VSSCCR 87



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 23/74 (31%), Positives = 31/74 (41%), Gaps = 4/74 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C + CC  +C  R + C S+ C   CC S   +CC    C   CC + +        SCC
Sbjct: 106 CQTTCCRTTCC-RPSCCVSSCCRPQCCQS---VCCQPTCCRPSCCISSSCCPSCCESSCC 161

Query: 428 --ICCRLPIWSSTS 463
              CC  P+    S
Sbjct: 162 RPCCCLRPVCGRVS 175



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 30/93 (32%), Positives = 35/93 (37%), Gaps = 11/93 (11%)
 Frame = +2

Query: 254 CNSICCSYSCTLR--CT-FCCSNRC-GTSCCPSSGILCCFAILC--WCCSNPASGSLHSP 415
           C S+C    C L   C   CC   C  T+CC  S   CC +  C   CC +         
Sbjct: 6   CGSVCSDQGCGLENCCRPSCCQTTCCRTTCCRPS---CCVSSCCRPQCCQSVCCQPTCCR 62

Query: 416 CSCC--ICCRLPIWSST---SSTFPVWICTSVC 499
            SCC   CCR      +   SS      C SVC
Sbjct: 63  PSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVC 95


>BC004180-1|AAH04180.1|  201|Homo sapiens keratin associated protein
           4-12 protein.
          Length = 201

 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 28/82 (34%), Positives = 37/82 (45%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           C S+CC  +C  R + C S+ C  SCC SS   CC    C CC  P  G +    SC   
Sbjct: 131 CQSVCCQPTCC-RPSCCISSSCCPSCCESS---CCRP--C-CCLRPVCGRV----SCHTT 179

Query: 434 CRLPIWSSTSSTFPVWICTSVC 499
           C  P    ++   P+   +S C
Sbjct: 180 CYRPTCVISTCPRPLCCASSCC 201



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 29/89 (32%), Positives = 37/89 (41%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C S+CC  +C  R + C +  C T+CC  S   CC +  C   CC +          SCC
Sbjct: 51  CQSVCCQPTCC-RPSCCQTTCCRTTCCRPS---CCVSSCCRPQCCQSVCCQPTCCRPSCC 106

Query: 428 --ICCRLPIWSST---SSTFPVWICTSVC 499
              CCR      +   SS      C SVC
Sbjct: 107 QTTCCRTTCCRPSCCVSSCCRPQCCQSVC 135



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/87 (32%), Positives = 36/87 (41%), Gaps = 5/87 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C S+CC  +C  R + C +  C T+CC  S   CC +  C   CC +          SCC
Sbjct: 91  CQSVCCQPTCC-RPSCCQTTCCRTTCCRPS---CCVSSCCRPQCCQSVCCQPTCCRPSCC 146

Query: 428 I---CCRLPIWSSTSSTFPVWICTSVC 499
           I   CC  P    +S   P      VC
Sbjct: 147 ISSSCC--PSCCESSCCRPCCCLRPVC 171



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 22/66 (33%), Positives = 29/66 (43%), Gaps = 4/66 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C + CC  +C  R + C S+ C   CC S   +CC    C   CC      +     SCC
Sbjct: 26  CQTTCCRTTCC-RPSCCVSSCCRPQCCQS---VCCQPTCCRPSCCQTTCCRTTCCRPSCC 81

Query: 428 I--CCR 439
           +  CCR
Sbjct: 82  VSSCCR 87



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 23/74 (31%), Positives = 31/74 (41%), Gaps = 4/74 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C + CC  +C  R + C S+ C   CC S   +CC    C   CC + +        SCC
Sbjct: 106 CQTTCCRTTCC-RPSCCVSSCCRPQCCQS---VCCQPTCCRPSCCISSSCCPSCCESSCC 161

Query: 428 --ICCRLPIWSSTS 463
              CC  P+    S
Sbjct: 162 RPCCCLRPVCGRVS 175



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 30/93 (32%), Positives = 35/93 (37%), Gaps = 11/93 (11%)
 Frame = +2

Query: 254 CNSICCSYSCTLR--CT-FCCSNRC-GTSCCPSSGILCCFAILC--WCCSNPASGSLHSP 415
           C S+C    C L   C   CC   C  T+CC  S   CC +  C   CC +         
Sbjct: 6   CGSVCSDQGCGLENCCRPSCCQTTCCRTTCCRPS---CCVSSCCRPQCCQSVCCQPTCCR 62

Query: 416 CSCC--ICCRLPIWSST---SSTFPVWICTSVC 499
            SCC   CCR      +   SS      C SVC
Sbjct: 63  PSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVC 95


>AJ406943-1|CAC27582.1|  201|Homo sapiens keratin associated protein
           4.12 protein.
          Length = 201

 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 28/82 (34%), Positives = 37/82 (45%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           C S+CC  +C  R + C S+ C  SCC SS   CC    C CC  P  G +    SC   
Sbjct: 131 CQSVCCQPTCC-RPSCCISSSCCPSCCESS---CCRP--C-CCLRPVCGRV----SCHTT 179

Query: 434 CRLPIWSSTSSTFPVWICTSVC 499
           C  P    ++   P+   +S C
Sbjct: 180 CYRPTCVISTCPRPLCCASSCC 201



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 29/89 (32%), Positives = 37/89 (41%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C S+CC  +C  R + C +  C T+CC  S   CC +  C   CC +          SCC
Sbjct: 51  CQSVCCQPTCC-RPSCCQTTCCRTTCCRPS---CCVSSCCRPQCCQSVCCQPTCCRPSCC 106

Query: 428 --ICCRLPIWSST---SSTFPVWICTSVC 499
              CCR      +   SS      C SVC
Sbjct: 107 QTTCCRTTCCRPSCCVSSCCRPQCCQSVC 135



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/87 (32%), Positives = 36/87 (41%), Gaps = 5/87 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C S+CC  +C  R + C +  C T+CC  S   CC +  C   CC +          SCC
Sbjct: 91  CQSVCCQPTCC-RPSCCQTTCCRTTCCRPS---CCVSSCCRPQCCQSVCCQPTCCRPSCC 146

Query: 428 I---CCRLPIWSSTSSTFPVWICTSVC 499
           I   CC  P    +S   P      VC
Sbjct: 147 ISSSCC--PSCCESSCCRPCCCLRPVC 171



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 22/66 (33%), Positives = 29/66 (43%), Gaps = 4/66 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C + CC  +C  R + C S+ C   CC S   +CC    C   CC      +     SCC
Sbjct: 26  CQTTCCRTTCC-RPSCCVSSCCRPQCCQS---VCCQPTCCRPSCCQTTCCRTTCCRPSCC 81

Query: 428 I--CCR 439
           +  CCR
Sbjct: 82  VSSCCR 87



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 23/74 (31%), Positives = 31/74 (41%), Gaps = 4/74 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPCSCC 427
           C + CC  +C  R + C S+ C   CC S   +CC    C   CC + +        SCC
Sbjct: 106 CQTTCCRTTCC-RPSCCVSSCCRPQCCQS---VCCQPTCCRPSCCISSSCCPSCCESSCC 161

Query: 428 --ICCRLPIWSSTS 463
              CC  P+    S
Sbjct: 162 RPCCCLRPVCGRVS 175



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 30/93 (32%), Positives = 35/93 (37%), Gaps = 11/93 (11%)
 Frame = +2

Query: 254 CNSICCSYSCTLR--CT-FCCSNRC-GTSCCPSSGILCCFAILC--WCCSNPASGSLHSP 415
           C S+C    C L   C   CC   C  T+CC  S   CC +  C   CC +         
Sbjct: 6   CGSVCSDQGCGLENCCRPSCCQTTCCRTTCCRPS---CCVSSCCRPQCCQSVCCQPTCCR 62

Query: 416 CSCC--ICCRLPIWSST---SSTFPVWICTSVC 499
            SCC   CCR      +   SS      C SVC
Sbjct: 63  PSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVC 95


>AB126070-1|BAD20197.1|  278|Homo sapiens keratin associated protein
           protein.
          Length = 278

 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 26/65 (40%), Positives = 30/65 (46%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           C S C   SC   C  CCS+ CG+SCC SS   CC      CCS        S C   +C
Sbjct: 230 CGSSCSQCSCCKPC--CCSSGCGSSCCQSS---CCKP----CCS-------QSSCCVPVC 273

Query: 434 CRLPI 448
           C+  I
Sbjct: 274 CQCKI 278



 Score = 33.9 bits (74), Expect = 0.48
 Identities = 24/60 (40%), Positives = 30/60 (50%), Gaps = 7/60 (11%)
 Frame = +2

Query: 305 CSNRCGTSC--CPSSGILCCFAILCWCCSNPASGSLHSPC---SCC--ICCRLPIWSSTS 463
           CS  CG+SC  C  SG   C +  C  C +   GS  S C    CC  +CCR+P  S +S
Sbjct: 6   CSGGCGSSCGGC-GSGCGGCGSG-CGGCGSGCGGSGSSCCVPVCCCKPVCCRVPTCSCSS 63



 Score = 33.1 bits (72), Expect = 0.84
 Identities = 27/79 (34%), Positives = 30/79 (37%), Gaps = 4/79 (5%)
 Frame = +2

Query: 254 CNSIC--CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           C S C  C   C +    CCS     SC  S G        C CC  P   S     SCC
Sbjct: 197 CGSGCGGCGSGCGVPVC-CCSCSSCGSCAGSKGGCGSSCSQCSCC-KPCCCSSGCGSSCC 254

Query: 428 --ICCRLPIWSSTSSTFPV 478
              CC+ P  S +S   PV
Sbjct: 255 QSSCCK-PCCSQSSCCVPV 272



 Score = 31.5 bits (68), Expect = 2.6
 Identities = 19/61 (31%), Positives = 20/61 (32%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           C S CC   C  +   CC   C  S C   G   C       CS  A GS       C  
Sbjct: 126 CGSSCCVPVCCCKPMCCCVPACSCSSCGKGGCGSC------GCSKGACGSCGGSKGGCGS 179

Query: 434 C 436
           C
Sbjct: 180 C 180


>AB076353-1|BAD01540.1|  365|Homo sapiens keratin associated protein
           protein.
          Length = 365

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 24/86 (27%), Positives = 33/86 (38%), Gaps = 3/86 (3%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCWCCSNPASGSLHSPCSCC 427
           C  +CC   C    + C  + C ++CC SS     CC  + C    +  S S     SC 
Sbjct: 120 CKPVCCVSVCCGDSSCCQQSSCQSACCTSSPCQQACCVPVCCKPVCSGISSSCCQQSSCV 179

Query: 428 ICCRLPIWSSTSSTFPVWI-CTSVCS 502
            C   P   +     P    CTS C+
Sbjct: 180 SCVSSPCCQAVCEPSPCQSGCTSSCT 205



 Score = 38.7 bits (86), Expect = 0.017
 Identities = 29/88 (32%), Positives = 36/88 (40%), Gaps = 6/88 (6%)
 Frame = +2

Query: 254 CNSICCSYS-CTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCWCCSNPASGSL--HSPC 418
           C   CC+ S C   C     +   TSCC  S     CC A    CC + +S SL  H  C
Sbjct: 256 CQPACCTSSPCQHACCVPVCSGASTSCCQQSSCQPACCTAS---CCRSSSSVSLLCHPVC 312

Query: 419 SCCICCRLP-IWSSTSSTFPVWICTSVC 499
               C  +P   +S SS  P    T+ C
Sbjct: 313 KSTCCVPVPSCGASASSCQPSCCRTASC 340



 Score = 36.7 bits (81), Expect = 0.068
 Identities = 30/95 (31%), Positives = 36/95 (37%), Gaps = 11/95 (11%)
 Frame = +2

Query: 254 CNSICCSYS-CTLRCTF--CCSNRCG---TSCCP-SSGILCCFAILCW--CCSNPASGSL 406
           C S CC+ S C   C    CC   C    +SCC  SS + C  +  C   C  +P     
Sbjct: 141 CQSACCTSSPCQQACCVPVCCKPVCSGISSSCCQQSSCVSCVSSPCCQAVCEPSPCQSGC 200

Query: 407 HSPC--SCCICCRLPIWSSTSSTFPVWICTSVCSI 505
            S C  SCC          TSS      C  VC +
Sbjct: 201 TSSCTPSCCQQSSCQPTCCTSSPCQQACCVPVCCV 235



 Score = 36.7 bits (81), Expect = 0.068
 Identities = 29/95 (30%), Positives = 34/95 (35%), Gaps = 10/95 (10%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCT-----FCC-SNRCGTSCCPSSGI--LCCFAILC--WCCSNPAS 397
           P C ++C    C   CT      CC  + C  +CC SS     CC  + C   CC    S
Sbjct: 185 PCCQAVCEPSPCQSGCTSSCTPSCCQQSSCQPTCCTSSPCQQACCVPVCCVPVCCVPTCS 244

Query: 398 GSLHSPCSCCICCRLPIWSSTSSTFPVWICTSVCS 502
                  SCC          TSS      C  VCS
Sbjct: 245 ---EDSSSCCQQSSCQPACCTSSPCQHACCVPVCS 276



 Score = 33.9 bits (74), Expect = 0.48
 Identities = 28/93 (30%), Positives = 34/93 (36%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLH 409
           P   P P  + +C   S     + CC   C  S C S     C    C   S   +    
Sbjct: 45  PCCAPAPCLSLVCTPVSRV--SSPCCPVTCEPSPCQSGCTSSCTPSCCQQSSCQLACCAS 102

Query: 410 SPCSCCICCRLPIWSSTSSTFPVWICTSVCSID 508
           SPC    CC +P+   T    PV  C SVC  D
Sbjct: 103 SPCQQA-CC-VPVCCKTVCCKPV-CCVSVCCGD 132



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 1/61 (1%)
 Frame = +2

Query: 233 SLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW-CCSNPASGSLH 409
           SLL  P+C S CC     +      ++ C  SCC ++    C ++LC   CS PA  SL 
Sbjct: 305 SLLCHPVCKSTCC---VPVPSCGASASSCQPSCCRTAS---CVSLLCRPMCSRPACYSLC 358

Query: 410 S 412
           S
Sbjct: 359 S 359



 Score = 30.7 bits (66), Expect = 4.5
 Identities = 27/87 (31%), Positives = 35/87 (40%), Gaps = 13/87 (14%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCC-PS---SGIL------CCFAILC--WCC-SN 388
           P+C+ I  S      C  C S+ C  + C PS   SG        CC    C   CC S+
Sbjct: 163 PVCSGISSSCCQQSSCVSCVSSPCCQAVCEPSPCQSGCTSSCTPSCCQQSSCQPTCCTSS 222

Query: 389 PASGSLHSPCSCCICCRLPIWSSTSST 469
           P   +   P  C   C +P  S  SS+
Sbjct: 223 PCQQACCVPVCCVPVCCVPTCSEDSSS 249


>BC131611-1|AAI31612.1|  298|Homo sapiens keratin associated protein
           10-11 protein.
          Length = 298

 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 26/87 (29%), Positives = 34/87 (39%), Gaps = 5/87 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCC-SNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPC 418
           C  +CC   C    + CC  + C  +CC SS     CC  + C   CC +  S       
Sbjct: 110 CKPVCCVPVCCGAASSCCRQSSCQPACCASSSCQPACCVPVCCKPVCCVSTCS---EDSS 166

Query: 419 SCCICCRLPIWSSTSSTFPVWICTSVC 499
           SCC          TSS++    C  VC
Sbjct: 167 SCCQQSSCQPACCTSSSYQQACCVPVC 193



 Score = 42.3 bits (95), Expect = 0.001
 Identities = 32/103 (31%), Positives = 45/103 (43%), Gaps = 19/103 (18%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCC-SNRCGTSCCPSSGI--LCCFAILC---WC--------CSNP 391
           C  +CC  +C+   + CC  + C  +CC SS     CC  + C   +C        CS  
Sbjct: 152 CKPVCCVSTCSEDSSSCCQQSSCQPACCTSSSYQQACCVPVCCKTVYCKPICCVPVCSRA 211

Query: 392 ASGSLHSP-C--SCCI--CCRLPIWSSTSSTFPVWICTSVCSI 505
           +S     P C  +CC   CCR P  SS+ S     +C S C +
Sbjct: 212 SSSRCQQPSCQPACCTTSCCR-P--SSSVSLLCHPVCRSTCCV 251



 Score = 36.7 bits (81), Expect = 0.068
 Identities = 23/73 (31%), Positives = 26/73 (35%), Gaps = 2/73 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASGSLHSPCSCC 427
           C   CC   C    T CC   C    C  +   CC    C   CC   AS S    C   
Sbjct: 95  CQQACCVPVCCK--TVCCKPVCCVPVCCGAASSCCRQSSCQPACC---ASSSCQPACCVP 149

Query: 428 ICCRLPIWSSTSS 466
           +CC+     ST S
Sbjct: 150 VCCKPVCCVSTCS 162



 Score = 36.3 bits (80), Expect = 0.090
 Identities = 26/86 (30%), Positives = 32/86 (37%)
 Frame = +2

Query: 242 P*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS 421
           P P  + +C   SC    + CC   C  S C S     C    C   S   +    SPC 
Sbjct: 39  PAPSLSLVCTPVSCV--SSPCCQAACEPSACQSGCTSSCTPSCCQQSSCQPACCTSSPCQ 96

Query: 422 CCICCRLPIWSSTSSTFPVWICTSVC 499
              CC +P+   T    PV  C  VC
Sbjct: 97  QA-CC-VPVCCKTVCCKPV-CCVPVC 119



 Score = 33.1 bits (72), Expect = 0.84
 Identities = 26/70 (37%), Positives = 38/70 (54%), Gaps = 5/70 (7%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCC--SNRCGTS-CCPSSGILCCFAILCWCCSNPAS 397
           RPS     LC+ +C S +C +  + CC  ++ C +S CCP+S    C ++LC     PAS
Sbjct: 232 RPSSSVSLLCHPVCRS-TCCVPVSSCCAPTSSCQSSCCCPAS----CVSLLC----RPAS 282

Query: 398 GSL--HSPCS 421
             L  +S CS
Sbjct: 283 SRLACYSLCS 292



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 27/85 (31%), Positives = 33/85 (38%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           P C   CC+ SC   C    S+     C P     CC  +   CC+ P S S  S C C 
Sbjct: 219 PSCQPACCTTSC---CR--PSSSVSLLCHPVCRSTCCVPVSS-CCA-PTS-SCQSSCCCP 270

Query: 428 ICCRLPIWSSTSSTFPVWICTSVCS 502
             C   +    SS      C S+CS
Sbjct: 271 ASCVSLLCRPASSRL---ACYSLCS 292


>BC121094-1|AAI21095.1|  154|Homo sapiens keratin associated protein
           9-4 protein.
          Length = 154

 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 26/88 (29%), Positives = 32/88 (36%), Gaps = 4/88 (4%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRC--TFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASGSLHSP 415
           P C   CC  SC   C    CC N C   C P+    CC    C   CC     GS    
Sbjct: 36  PCCQPSCCVSSCCQPCCRPTCCQNTC---CQPTCVTSCCQPSCCSTPCCQPTCCGSSCDQ 92

Query: 416 CSCCICCRLPIWSSTSSTFPVWICTSVC 499
            S C     P++   +  +P  +C   C
Sbjct: 93  SSSC----APVYCRRTCYYPTTVCLPGC 116



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 5/53 (9%)
 Frame = +2

Query: 296 TFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC---SCCI--CCR 439
           T CCS  C  +CC ++   CC    CW  +   + S  +PC   SCC+  CC+
Sbjct: 2   THCCSPCCQPTCCRTT---CC-RTTCWKPTTVTTCS-STPCCQPSCCVSSCCQ 49


>AJ406948-1|CAC27587.1|  154|Homo sapiens keratin associated protein
           9.4 protein.
          Length = 154

 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 26/88 (29%), Positives = 32/88 (36%), Gaps = 4/88 (4%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRC--TFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASGSLHSP 415
           P C   CC  SC   C    CC N C   C P+    CC    C   CC     GS    
Sbjct: 36  PCCQPSCCVSSCCQPCCRPTCCQNTC---CQPTCVTSCCQPSCCSTPCCQPTCCGSSCDQ 92

Query: 416 CSCCICCRLPIWSSTSSTFPVWICTSVC 499
            S C     P++   +  +P  +C   C
Sbjct: 93  SSSC----APVYCRRTCYYPTTVCLPGC 116



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 5/53 (9%)
 Frame = +2

Query: 296 TFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC---SCCI--CCR 439
           T CCS  C  +CC ++   CC    CW  +   + S  +PC   SCC+  CC+
Sbjct: 2   THCCSPCCQPTCCRTT---CC-RTTCWKPTTVTTCS-STPCCQPSCCVSSCCQ 49


>AB076359-1|BAD01546.1|  298|Homo sapiens keratin associated protein
           protein.
          Length = 298

 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 26/87 (29%), Positives = 34/87 (39%), Gaps = 5/87 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCC-SNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPC 418
           C  +CC   C    + CC  + C  +CC SS     CC  + C   CC +  S       
Sbjct: 110 CKPVCCVPVCCGAASSCCRQSSCQPACCASSSCQPACCVPVCCKPVCCVSTCS---EDSS 166

Query: 419 SCCICCRLPIWSSTSSTFPVWICTSVC 499
           SCC          TSS++    C  VC
Sbjct: 167 SCCQQSSCQPACCTSSSYQQACCVPVC 193



 Score = 42.3 bits (95), Expect = 0.001
 Identities = 31/103 (30%), Positives = 45/103 (43%), Gaps = 19/103 (18%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCC-SNRCGTSCCPSSGI-------LCCFAILC--WCCSNPASGS 403
           C  +CC  +C+   + CC  + C  +CC SS         +CC  + C   CC    S +
Sbjct: 152 CKPVCCVSTCSEDSSSCCQQSSCQPACCTSSSYQQACCVPVCCKTVYCKPICCVPVCSRA 211

Query: 404 LHSPC-------SCCI--CCRLPIWSSTSSTFPVWICTSVCSI 505
            +S C       +CC   CCR P  SS+ S     +C S C +
Sbjct: 212 SYSRCQQPSCQPACCTTSCCR-P--SSSVSLLCHPVCRSTCCV 251



 Score = 36.7 bits (81), Expect = 0.068
 Identities = 23/73 (31%), Positives = 26/73 (35%), Gaps = 2/73 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASGSLHSPCSCC 427
           C   CC   C    T CC   C    C  +   CC    C   CC   AS S    C   
Sbjct: 95  CQQACCVPVCCK--TVCCKPVCCVPVCCGAASSCCRQSSCQPACC---ASSSCQPACCVP 149

Query: 428 ICCRLPIWSSTSS 466
           +CC+     ST S
Sbjct: 150 VCCKPVCCVSTCS 162



 Score = 36.3 bits (80), Expect = 0.090
 Identities = 26/86 (30%), Positives = 32/86 (37%)
 Frame = +2

Query: 242 P*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS 421
           P P  + +C   SC    + CC   C  S C S     C    C   S   +    SPC 
Sbjct: 39  PAPSLSLVCTPVSCV--SSPCCQAACEPSACQSGCTSSCTPSCCQQSSCQPACCTSSPCQ 96

Query: 422 CCICCRLPIWSSTSSTFPVWICTSVC 499
              CC +P+   T    PV  C  VC
Sbjct: 97  QA-CC-VPVCCKTVCCKPV-CCVPVC 119



 Score = 33.1 bits (72), Expect = 0.84
 Identities = 26/70 (37%), Positives = 38/70 (54%), Gaps = 5/70 (7%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCC--SNRCGTS-CCPSSGILCCFAILCWCCSNPAS 397
           RPS     LC+ +C S +C +  + CC  ++ C +S CCP+S    C ++LC     PAS
Sbjct: 232 RPSSSVSLLCHPVCRS-TCCVPVSSCCAPTSSCQSSCCCPAS----CVSLLC----RPAS 282

Query: 398 GSL--HSPCS 421
             L  +S CS
Sbjct: 283 SRLACYSLCS 292



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 27/85 (31%), Positives = 33/85 (38%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           P C   CC+ SC   C    S+     C P     CC  +   CC+ P S S  S C C 
Sbjct: 219 PSCQPACCTTSC---CR--PSSSVSLLCHPVCRSTCCVPVSS-CCA-PTS-SCQSSCCCP 270

Query: 428 ICCRLPIWSSTSSTFPVWICTSVCS 502
             C   +    SS      C S+CS
Sbjct: 271 ASCVSLLCRPASSRL---ACYSLCS 292


>AJ406941-1|CAC27580.1|  191|Homo sapiens keratin associated protein
           4.9 protein.
          Length = 191

 Score = 42.3 bits (95), Expect = 0.001
 Identities = 33/92 (35%), Positives = 39/92 (42%), Gaps = 10/92 (10%)
 Frame = +2

Query: 254 CNSICCSYSCTL-RC--TFCCSNRC-GTSCCPSSGIL--CCFAILCW--CC--SNPASGS 403
           C S+CC  +C+   C  T CC   C   SCC SS     CC  + C   CC  S   +  
Sbjct: 36  CQSVCCQPTCSRPSCCQTTCCRTTCYRPSCCVSSCCRPQCCQPVCCQPTCCRPSCCETTC 95

Query: 404 LHSPCSCCICCRLPIWSSTSSTFPVWICTSVC 499
            H  C    CCR P    +S   P   C SVC
Sbjct: 96  CHPRCCISSCCR-PSCCVSSCCKP-QCCQSVC 125



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 27/69 (39%), Positives = 31/69 (44%), Gaps = 7/69 (10%)
 Frame = +2

Query: 254 CNSICCSYSCTL-RCTFCCSNRCGTSCCPSSGI--LCCFAILCW--CCSNPASGSLHSPC 418
           C   CC  +C   RC  C S+ C  SCC SS     CC ++ C   CC    S S     
Sbjct: 86  CRPSCCETTCCHPRC--CISSCCRPSCCVSSCCKPQCCQSVCCQPNCCRPSCSISSCCRP 143

Query: 419 SCC--ICCR 439
           SCC   CCR
Sbjct: 144 SCCESSCCR 152



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 28/82 (34%), Positives = 36/82 (43%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           C S+CC  +C  R +   S+ C  SCC SS   CC    C CC  P  G +    SC   
Sbjct: 121 CQSVCCQPNCC-RPSCSISSCCRPSCCESS---CCRP--C-CCVRPVCGRV----SCHTT 169

Query: 434 CRLPIWSSTSSTFPVWICTSVC 499
           C  P    +S   P+   +S C
Sbjct: 170 CYRPTCVISSCPRPLCCASSCC 191



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 26/73 (35%), Positives = 33/73 (45%), Gaps = 11/73 (15%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCW-CCSNPA---SGSLHSP 415
           C   CC  SC    T C +  C  SCC SS     CC ++ C   CS P+   +    + 
Sbjct: 1   CQETCCRPSCC-ETTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPTCSRPSCCQTTCCRTT 59

Query: 416 C---SCCI--CCR 439
           C   SCC+  CCR
Sbjct: 60  CYRPSCCVSSCCR 72



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 31/96 (32%), Positives = 35/96 (36%), Gaps = 5/96 (5%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRC-GTSCCPSSGILCCFAILC--WCCSNPA- 394
           RP       C   CC  SC    T CC  RC  +SCC  S   CC +  C   CC +   
Sbjct: 72  RPQCCQPVCCQPTCCRPSCCE--TTCCHPRCCISSCCRPS---CCVSSCCKPQCCQSVCC 126

Query: 395 -SGSLHSPCSCCICCRLPIWSSTSSTFPVWICTSVC 499
                   CS   CCR P    +S   P      VC
Sbjct: 127 QPNCCRPSCSISSCCR-PSCCESSCCRPCCCVRPVC 161


>BC127252-1|AAI27253.1|  136|Homo sapiens keratin associated protein
           4-2 protein.
          Length = 136

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 31/93 (33%), Positives = 36/93 (38%), Gaps = 11/93 (11%)
 Frame = +2

Query: 254 CNSICCSYSCTLR--CT-FCCSNRC-GTSCCPSSGILCCFAILC--WCCSNPASGSLHSP 415
           C S+C    C L   C   CC   C  T+CC  S   CC +  C   CC +         
Sbjct: 6   CGSVCSDQGCGLENCCRPSCCQTTCCRTTCCRPS---CCVSSCCRPQCCQSVCCQPTCCS 62

Query: 416 CSCC--ICCRLPIWSST---SSTFPVWICTSVC 499
            SCC   CCR      +   SS F    C SVC
Sbjct: 63  PSCCQTTCCRTTCCRPSCCVSSCFRPQCCQSVC 95



 Score = 39.1 bits (87), Expect = 0.013
 Identities = 24/74 (32%), Positives = 29/74 (39%), Gaps = 8/74 (10%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYSCTLRCTF---CCSNRC--GTSCCPSSGILCCFAILCW---CCS 385
           PS      C + CC  SC +   F   CC + C   T C PS G   C    C+   CC 
Sbjct: 63  PSCCQTTCCRTTCCRPSCCVSSCFRPQCCQSVCCQPTCCRPSCGQTTCCRTTCYRPSCCV 122

Query: 386 NPASGSLHSPCSCC 427
           +       S  SCC
Sbjct: 123 STCCRPTCSSGSCC 136



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 33/92 (35%), Positives = 40/92 (43%), Gaps = 13/92 (14%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSC--TLRC-TFCCS-NRCGTSCCPSSGILCCFAILCW-CCSNP 391
           RP       C   CCS SC  T  C T CC  + C +SC       CC ++ C   C  P
Sbjct: 47  RPQCCQSVCCQPTCCSPSCCQTTCCRTTCCRPSCCVSSCFRPQ---CCQSVCCQPTCCRP 103

Query: 392 ASGS---LHSPC---SCCI--CCRLPIWSSTS 463
           + G      + C   SCC+  CCR P  SS S
Sbjct: 104 SCGQTTCCRTTCYRPSCCVSTCCR-PTCSSGS 134


>BC125049-1|AAI25050.1|  401|Homo sapiens keratin associated protein
           10-4 protein.
          Length = 401

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 27/89 (30%), Positives = 35/89 (39%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCC-SNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPC 418
           C ++CC   C+   + CC  + C  +CC SS     CC  + C   CC    S  + S  
Sbjct: 234 CKTVCCKPVCSEDSSSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCKPVGSVPICSGA 293

Query: 419 S--CCICCRLPIWSSTSSTFPVWICTSVC 499
           S  CC          TSS      C  VC
Sbjct: 294 SSLCCQQSSCQPACCTSSQSQQGCCVPVC 322



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 25/89 (28%), Positives = 35/89 (39%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPCS 421
           C  +CC   C    + C  + C ++CC SS     CC  I C   C    +S    S C 
Sbjct: 120 CKPVCCVPVCCGDSSCCQQSSCQSACCTSSPCQQACCVPICCKPVCSGISSSCCQQSSCV 179

Query: 422 CCI---CCRLPIWSSTSSTFPVWICTSVC 499
            C+   CC+     S   +  +  CT  C
Sbjct: 180 SCVSSPCCQAVCEPSPCQSGCISSCTPSC 208



 Score = 38.7 bits (86), Expect = 0.017
 Identities = 29/90 (32%), Positives = 34/90 (37%), Gaps = 11/90 (12%)
 Frame = +2

Query: 230 PSLLP*PLCNSICC-SYSCTLRCTF--CCSNRCGTSCCPSSGILCCFAILCW--CC-SNP 391
           PS      C   CC S SC   C    CC   C    C      CC    C   CC S+P
Sbjct: 206 PSCCQQSSCQPACCTSSSCQQACCVPVCCKTVCCKPVCSEDSSSCCQQSSCQPACCTSSP 265

Query: 392 ASGSLHSPCSC-CICCR----LPIWSSTSS 466
              +   P  C  +CC+    +PI S  SS
Sbjct: 266 CQQACCVPVCCKPVCCKPVGSVPICSGASS 295



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 27/89 (30%), Positives = 33/89 (37%)
 Frame = +2

Query: 242 P*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS 421
           P P  + +C   SC    + CC   C  S C S     C    C   S   +    SPC 
Sbjct: 49  PAPCLSLVCTPVSCV--SSPCCPVTCEPSPCQSGCTSSCTPSCCQQSSCQLACCASSPCQ 106

Query: 422 CCICCRLPIWSSTSSTFPVWICTSVCSID 508
              CC +P+   T    PV  C  VC  D
Sbjct: 107 QA-CC-VPVCCKTVCCKPV-CCVPVCCGD 132



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 21/78 (26%), Positives = 29/78 (37%), Gaps = 6/78 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASGSLHSPCSCC 427
           C   CC   C      CC        C  +  LCC    C   CC++  S      C   
Sbjct: 266 CQQACCVPVCCK--PVCCKPVGSVPICSGASSLCCQQSSCQPACCTSSQS---QQGCCVP 320

Query: 428 ICCR----LPIWSSTSST 469
           +CC+    +P+ S  SS+
Sbjct: 321 VCCKPVSCVPVCSGASSS 338



 Score = 31.1 bits (67), Expect = 3.4
 Identities = 26/88 (29%), Positives = 38/88 (43%), Gaps = 14/88 (15%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCC-PS---SGIL------CCFAILCW--CCSNP 391
           P+C+ I  S      C  C S+ C  + C PS   SG +      CC    C   CC++ 
Sbjct: 163 PVCSGISSSCCQQSSCVSCVSSPCCQAVCEPSPCQSGCISSCTPSCCQQSSCQPACCTSS 222

Query: 392 ASGSLHSPCSCC--ICCRLPIWSSTSST 469
           +         CC  +CC+ P+ S  SS+
Sbjct: 223 SCQQACCVPVCCKTVCCK-PVCSEDSSS 249


>BC125048-1|AAI25049.1|  401|Homo sapiens keratin associated protein
           10-4 protein.
          Length = 401

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 27/89 (30%), Positives = 35/89 (39%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCC-SNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPC 418
           C ++CC   C+   + CC  + C  +CC SS     CC  + C   CC    S  + S  
Sbjct: 234 CKTVCCKPVCSEDSSSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCKPVGSVPICSGA 293

Query: 419 S--CCICCRLPIWSSTSSTFPVWICTSVC 499
           S  CC          TSS      C  VC
Sbjct: 294 SSLCCQQSSCQPACCTSSQSQQGCCVPVC 322



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 25/89 (28%), Positives = 35/89 (39%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPCS 421
           C  +CC   C    + C  + C ++CC SS     CC  I C   C    +S    S C 
Sbjct: 120 CKPVCCVPVCCGDSSCCQQSSCQSACCTSSPCQQACCVPICCKPVCSGISSSCCQQSSCV 179

Query: 422 CCI---CCRLPIWSSTSSTFPVWICTSVC 499
            C+   CC+     S   +  +  CT  C
Sbjct: 180 SCVSSPCCQAVCEPSPCQSGCISSCTPSC 208



 Score = 38.7 bits (86), Expect = 0.017
 Identities = 29/90 (32%), Positives = 34/90 (37%), Gaps = 11/90 (12%)
 Frame = +2

Query: 230 PSLLP*PLCNSICC-SYSCTLRCTF--CCSNRCGTSCCPSSGILCCFAILCW--CC-SNP 391
           PS      C   CC S SC   C    CC   C    C      CC    C   CC S+P
Sbjct: 206 PSCCQQSSCQPACCTSSSCQQACCVPVCCKTVCCKPVCSEDSSSCCQQSSCQPACCTSSP 265

Query: 392 ASGSLHSPCSC-CICCR----LPIWSSTSS 466
              +   P  C  +CC+    +PI S  SS
Sbjct: 266 CQQACCVPVCCKPVCCKPVGSVPICSGASS 295



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 27/89 (30%), Positives = 33/89 (37%)
 Frame = +2

Query: 242 P*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS 421
           P P  + +C   SC    + CC   C  S C S     C    C   S   +    SPC 
Sbjct: 49  PAPCLSLVCTPVSCV--SSPCCPVTCEPSPCQSGCTSSCTPSCCQQSSCQLACCASSPCQ 106

Query: 422 CCICCRLPIWSSTSSTFPVWICTSVCSID 508
              CC +P+   T    PV  C  VC  D
Sbjct: 107 QA-CC-VPVCCKTVCCKPV-CCVPVCCGD 132



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 21/78 (26%), Positives = 29/78 (37%), Gaps = 6/78 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASGSLHSPCSCC 427
           C   CC   C      CC        C  +  LCC    C   CC++  S      C   
Sbjct: 266 CQQACCVPVCCK--PVCCKPVGSVPICSGASSLCCQQSSCQPACCTSSQS---QQGCCVP 320

Query: 428 ICCR----LPIWSSTSST 469
           +CC+    +P+ S  SS+
Sbjct: 321 VCCKPVSCVPVCSGASSS 338



 Score = 31.1 bits (67), Expect = 3.4
 Identities = 26/88 (29%), Positives = 38/88 (43%), Gaps = 14/88 (15%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCC-PS---SGIL------CCFAILCW--CCSNP 391
           P+C+ I  S      C  C S+ C  + C PS   SG +      CC    C   CC++ 
Sbjct: 163 PVCSGISSSCCQQSSCVSCVSSPCCQAVCEPSPCQSGCISSCTPSCCQQSSCQPACCTSS 222

Query: 392 ASGSLHSPCSCC--ICCRLPIWSSTSST 469
           +         CC  +CC+ P+ S  SS+
Sbjct: 223 SCQQACCVPVCCKTVCCK-PVCSEDSSS 249


>BC120960-1|AAI20961.1|  282|Homo sapiens keratin associated protein
           10-1 protein.
          Length = 282

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 28/72 (38%), Positives = 32/72 (44%), Gaps = 10/72 (13%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNR------CGTSCC-PSSGI-LCCFAILCWCCSNPASGSLH 409
           C  ICC   C+   T CC         C TSCC PSS + L C  +    C  P S S  
Sbjct: 194 CKPICCVPVCSGASTSCCQQSSCQPACCTTSCCRPSSSVSLLCRPVCQPACCMPVS-SCC 252

Query: 410 SPCSCC--ICCR 439
           +P S C   CCR
Sbjct: 253 APASSCQASCCR 264



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 26/86 (30%), Positives = 33/86 (38%), Gaps = 6/86 (6%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYS-CTLRCTF--CCSNRCGTSCCPSSGILCCFAILC--WCCSNPA 394
           PS      C   CC+ S C   C    CC   C    C      CC    C   CC++ +
Sbjct: 77  PSCCQQSSCQPACCTSSPCQQACCMPVCCKPVCCLPTCSKDSSSCCQQSSCQPTCCASSS 136

Query: 395 S-GSLHSPCSCCICCRLPIWSSTSST 469
           S  S   P  C   C +P  S +SS+
Sbjct: 137 SQQSCCVPVCCKPVCYVPTCSESSSS 162



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 4/62 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCC-SNRCGTSCCPSSGI--LCCFAILCW-CCSNPASGSLHSPCS 421
           C  +CC  +C+   + CC  + C  +CC SS     CC  + C   C  P      S  S
Sbjct: 105 CKPVCCLPTCSKDSSSCCQQSSCQPTCCASSSSQQSCCVPVCCKPVCYVPTCS--ESSSS 162

Query: 422 CC 427
           CC
Sbjct: 163 CC 164



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 27/84 (32%), Positives = 36/84 (42%), Gaps = 12/84 (14%)
 Frame = +2

Query: 254 CNSICCSYSCTLR--CT-FCCSNRCGTSCCPSSGILCCFAILCW--CC-SNPASGSLHSP 415
           C   CC+ S + +  C   CC   C    C  S   CC    C   CC S+P   +   P
Sbjct: 127 CQPTCCASSSSQQSCCVPVCCKPVCYVPTCSESSSSCCQQSSCHPACCTSSPCQQACCVP 186

Query: 416 --CS--CC--ICCRLPIWSSTSST 469
             C   CC  ICC +P+ S  S++
Sbjct: 187 VRCKPVCCKPICC-VPVCSGASTS 209



 Score = 33.5 bits (73), Expect = 0.64
 Identities = 31/98 (31%), Positives = 37/98 (37%), Gaps = 22/98 (22%)
 Frame = +2

Query: 242 P*PLCNSICCSYSC-------TLRCTF-------CCSNRCGTSCCPSSGILCCFAILCWC 379
           P   C   CC+ SC       TL CT        CC   C  S C S     C    C  
Sbjct: 23  PESCCEPHCCALSCCALAPCLTLVCTPVSRVSSPCCQAACEPSPCQSGCTSSCTPSCCQQ 82

Query: 380 CSNPASGSLHSPC--SCC--ICCR----LPIWSSTSST 469
            S   +    SPC  +CC  +CC+    LP  S  SS+
Sbjct: 83  SSCQPACCTSSPCQQACCMPVCCKPVCCLPTCSKDSSS 120



 Score = 31.9 bits (69), Expect = 1.9
 Identities = 25/92 (27%), Positives = 33/92 (35%), Gaps = 10/92 (10%)
 Frame = +2

Query: 254 CNSICCSYSCTL--RCT-FCCSNRCGTSCCPSSGILCCFAILCW-------CCSNPASGS 403
           C S  C  +C +  RC   CC   C    C  +   CC    C        CC   +S S
Sbjct: 174 CTSSPCQQACCVPVRCKPVCCKPICCVPVCSGASTSCCQQSSCQPACCTTSCCRPSSSVS 233

Query: 404 LHSPCSCCICCRLPIWSSTSSTFPVWICTSVC 499
           L     C   C +P+   +S   P   C + C
Sbjct: 234 LLCRPVCQPACCMPV---SSCCAPASSCQASC 262


>BC120959-1|AAI20960.1|  282|Homo sapiens keratin associated protein
           10-1 protein.
          Length = 282

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 28/72 (38%), Positives = 32/72 (44%), Gaps = 10/72 (13%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNR------CGTSCC-PSSGI-LCCFAILCWCCSNPASGSLH 409
           C  ICC   C+   T CC         C TSCC PSS + L C  +    C  P S S  
Sbjct: 194 CKPICCVPVCSGASTSCCQQSSCQPACCTTSCCRPSSSVSLLCRPVCQPACCMPVS-SCC 252

Query: 410 SPCSCC--ICCR 439
           +P S C   CCR
Sbjct: 253 APASSCQASCCR 264



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 26/86 (30%), Positives = 33/86 (38%), Gaps = 6/86 (6%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYS-CTLRCTF--CCSNRCGTSCCPSSGILCCFAILC--WCCSNPA 394
           PS      C   CC+ S C   C    CC   C    C      CC    C   CC++ +
Sbjct: 77  PSCCQQSSCQPACCTSSPCQQACCMPVCCKPVCCLPTCSKDSSSCCQQSSCQPTCCASSS 136

Query: 395 S-GSLHSPCSCCICCRLPIWSSTSST 469
           S  S   P  C   C +P  S +SS+
Sbjct: 137 SQQSCCVPVCCKPVCYVPTCSESSSS 162



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 4/62 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCC-SNRCGTSCCPSSGI--LCCFAILCW-CCSNPASGSLHSPCS 421
           C  +CC  +C+   + CC  + C  +CC SS     CC  + C   C  P      S  S
Sbjct: 105 CKPVCCLPTCSKDSSSCCQQSSCQPTCCASSSSQQSCCVPVCCKPVCYVPTCS--ESSSS 162

Query: 422 CC 427
           CC
Sbjct: 163 CC 164



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 27/84 (32%), Positives = 36/84 (42%), Gaps = 12/84 (14%)
 Frame = +2

Query: 254 CNSICCSYSCTLR--CT-FCCSNRCGTSCCPSSGILCCFAILCW--CC-SNPASGSLHSP 415
           C   CC+ S + +  C   CC   C    C  S   CC    C   CC S+P   +   P
Sbjct: 127 CQPTCCASSSSQQSCCVPVCCKPVCYVPTCSESSSSCCQQSSCHPACCTSSPCQQACCVP 186

Query: 416 --CS--CC--ICCRLPIWSSTSST 469
             C   CC  ICC +P+ S  S++
Sbjct: 187 VRCKPVCCKPICC-VPVCSGASTS 209



 Score = 33.5 bits (73), Expect = 0.64
 Identities = 31/98 (31%), Positives = 37/98 (37%), Gaps = 22/98 (22%)
 Frame = +2

Query: 242 P*PLCNSICCSYSC-------TLRCTF-------CCSNRCGTSCCPSSGILCCFAILCWC 379
           P   C   CC+ SC       TL CT        CC   C  S C S     C    C  
Sbjct: 23  PESCCEPHCCALSCCALAPCLTLVCTPVSRVSSPCCQAACEPSPCQSGCTSSCTPSCCQQ 82

Query: 380 CSNPASGSLHSPC--SCC--ICCR----LPIWSSTSST 469
            S   +    SPC  +CC  +CC+    LP  S  SS+
Sbjct: 83  SSCQPACCTSSPCQQACCMPVCCKPVCCLPTCSKDSSS 120



 Score = 31.9 bits (69), Expect = 1.9
 Identities = 25/92 (27%), Positives = 33/92 (35%), Gaps = 10/92 (10%)
 Frame = +2

Query: 254 CNSICCSYSCTL--RCT-FCCSNRCGTSCCPSSGILCCFAILCW-------CCSNPASGS 403
           C S  C  +C +  RC   CC   C    C  +   CC    C        CC   +S S
Sbjct: 174 CTSSPCQQACCVPVRCKPVCCKPICCVPVCSGASTSCCQQSSCQPACCTTSCCRPSSSVS 233

Query: 404 LHSPCSCCICCRLPIWSSTSSTFPVWICTSVC 499
           L     C   C +P+   +S   P   C + C
Sbjct: 234 LLCRPVCQPACCMPV---SSCCAPASSCQASC 262


>BC103846-1|AAI03847.1|  127|Homo sapiens keratin associated protein
           4-10 protein.
          Length = 127

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 28/76 (36%), Positives = 34/76 (44%), Gaps = 5/76 (6%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI-LCCFAILCWCCSNPASGS 403
           RPS      C + CC  SC   C   C   C T+C PS G+  CC  + C     P+ G 
Sbjct: 46  RPSCSQTTCCQTTCCRPSC---CRPVC---CQTTCRPSCGVSSCCRPLCCQTTCRPSCG- 98

Query: 404 LHSPCS--CC--ICCR 439
           + S C   CC   CCR
Sbjct: 99  VSSCCRPLCCQTTCCR 114



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 27/76 (35%), Positives = 33/76 (43%), Gaps = 5/76 (6%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCC-PS-SGILCCFAILC--WCCSNPASGSLHSP- 415
           LC   CC  SC  + T CC +   +SCC PS S   CC    C   CC      +   P 
Sbjct: 19  LCQETCCRPSC-CQTTCCCPSCVVSSCCRPSCSQTTCCQTTCCRPSCCRPVCCQTTCRPS 77

Query: 416 CSCCICCRLPIWSSTS 463
           C    CCR P+   T+
Sbjct: 78  CGVSSCCR-PLCCQTT 92



 Score = 30.7 bits (66), Expect = 4.5
 Identities = 14/35 (40%), Positives = 18/35 (51%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSC 331
           RPS      C  +CC  +C  R T C  + CG+SC
Sbjct: 94  RPSCGVSSCCRPLCCQTTCC-RTTCCRPSCCGSSC 127


>BC103845-1|AAI03846.1|  127|Homo sapiens keratin associated protein
           4-10 protein.
          Length = 127

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 28/76 (36%), Positives = 34/76 (44%), Gaps = 5/76 (6%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI-LCCFAILCWCCSNPASGS 403
           RPS      C + CC  SC   C   C   C T+C PS G+  CC  + C     P+ G 
Sbjct: 46  RPSCSQTTCCQTTCCRPSC---CRPVC---CQTTCRPSCGVSSCCRPLCCQTTCRPSCG- 98

Query: 404 LHSPCS--CC--ICCR 439
           + S C   CC   CCR
Sbjct: 99  VSSCCRPLCCQTTCCR 114



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 27/76 (35%), Positives = 33/76 (43%), Gaps = 5/76 (6%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCC-PS-SGILCCFAILC--WCCSNPASGSLHSP- 415
           LC   CC  SC  + T CC +   +SCC PS S   CC    C   CC      +   P 
Sbjct: 19  LCQETCCRPSC-CQTTCCCPSCVVSSCCRPSCSQTTCCQTTCCRPSCCRPVCCQTTCRPS 77

Query: 416 CSCCICCRLPIWSSTS 463
           C    CCR P+   T+
Sbjct: 78  CGVSSCCR-PLCCQTT 92



 Score = 30.7 bits (66), Expect = 4.5
 Identities = 14/35 (40%), Positives = 18/35 (51%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSC 331
           RPS      C  +CC  +C  R T C  + CG+SC
Sbjct: 94  RPSCGVSSCCRPLCCQTTCC-RTTCCRPSCCGSSC 127


>AJ406949-1|CAC27588.1|  111|Homo sapiens keratin associated protein
           9.5 protein.
          Length = 111

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 23/72 (31%), Positives = 29/72 (40%), Gaps = 4/72 (5%)
 Frame = +2

Query: 296 TFCCSNRCGTSCCPSS--GILCCFAILCW--CCSNPASGSLHSPCSCCICCRLPIWSSTS 463
           T CC   C TSCC  S     CC  I C   CC   + GS     S C     P++   +
Sbjct: 1   TTCCQPTCLTSCCQPSCCSTTCCQPICCGSSCCGQTSCGSSCGQSSSC----APVYCRRT 56

Query: 464 STFPVWICTSVC 499
             +P  +C   C
Sbjct: 57  CYYPTTVCLPGC 68



 Score = 37.1 bits (82), Expect = 0.052
 Identities = 30/80 (37%), Positives = 35/80 (43%), Gaps = 16/80 (20%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRC-GTSCC--PSSGILC-----CFAILC-WCCSNPAS- 397
           P C + CC  SC    T CC   C G+SCC   S G  C     C  + C   C  P + 
Sbjct: 6   PTCLTSCCQPSCC--STTCCQPICCGSSCCGQTSCGSSCGQSSSCAPVYCRRTCYYPTTV 63

Query: 398 ---GSLHSPC--SCC-ICCR 439
              G L+  C  SCC  CCR
Sbjct: 64  CLPGCLNQSCGSSCCQPCCR 83



 Score = 35.5 bits (78), Expect = 0.16
 Identities = 19/55 (34%), Positives = 22/55 (40%), Gaps = 2/55 (3%)
 Frame = +2

Query: 269 CSYSCTLRCTFCCSNRCGTSCC-PSSGILCCFAILC-WCCSNPASGSLHSPCSCC 427
           C Y  T+    C +  CG+SCC P     CC    C   C  P   S     SCC
Sbjct: 57  CYYPTTVCLPGCLNQSCGSSCCQPCCRPACCETTCCRTTCFQPTCVSSCCQPSCC 111


>AJ406942-1|CAC27581.1|  127|Homo sapiens keratin associated protein
           4.10 protein.
          Length = 127

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 28/76 (36%), Positives = 34/76 (44%), Gaps = 5/76 (6%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI-LCCFAILCWCCSNPASGS 403
           RPS      C + CC  SC   C   C   C T+C PS G+  CC  + C     P+ G 
Sbjct: 46  RPSCSQTTCCQTTCCRPSC---CRPVC---CQTTCRPSCGVSSCCRPLCCQTTCRPSCG- 98

Query: 404 LHSPCS--CC--ICCR 439
           + S C   CC   CCR
Sbjct: 99  VSSCCRPLCCQTTCCR 114



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 27/76 (35%), Positives = 33/76 (43%), Gaps = 5/76 (6%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCC-PS-SGILCCFAILC--WCCSNPASGSLHSP- 415
           LC   CC  SC  + T CC +   +SCC PS S   CC    C   CC      +   P 
Sbjct: 19  LCQETCCRPSC-CQTTCCCPSCVVSSCCRPSCSQTTCCQTTCCRPSCCRPVCCQTTCRPS 77

Query: 416 CSCCICCRLPIWSSTS 463
           C    CCR P+   T+
Sbjct: 78  CGVSSCCR-PLCCQTT 92



 Score = 30.7 bits (66), Expect = 4.5
 Identities = 14/35 (40%), Positives = 18/35 (51%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSC 331
           RPS      C  +CC  +C  R T C  + CG+SC
Sbjct: 94  RPSCGVSSCCRPLCCQTTCC-RTTCCRPSCCGSSC 127


>AJ406936-1|CAC27575.1|  166|Homo sapiens keratin associated protein
           4.4 protein.
          Length = 166

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 23/70 (32%), Positives = 31/70 (44%), Gaps = 8/70 (11%)
 Frame = +2

Query: 254 CNSICCSYSCTL----RCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSP 415
           C S+C    C L    R ++C +  C T+CC  S   CC +  C   CC      +    
Sbjct: 6   CGSVCSDQGCGLENCCRPSYCQTTCCRTTCCRPS---CCVSSCCRPQCCQTTCCRTTCCH 62

Query: 416 CSCCI--CCR 439
            SCC+  CCR
Sbjct: 63  PSCCVSSCCR 72



 Score = 41.5 bits (93), Expect = 0.002
 Identities = 33/106 (31%), Positives = 41/106 (38%), Gaps = 15/106 (14%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTL------RC--TFCCSNRC-GTSCCPSSGI--LCCFAILC 373
           RPS      C + CC  SC +      +C  T CC   C   SCC SS     CC ++ C
Sbjct: 22  RPSYCQTTCCRTTCCRPSCCVSSCCRPQCCQTTCCRTTCCHPSCCVSSCCRPQCCQSVCC 81

Query: 374 --WCCSNPASGSLHSPCSCC--ICCRLPIWSSTSSTFPVWICTSVC 499
              CC      +     +CC   CCR P    +    P   C S C
Sbjct: 82  QPTCCRPQCCQTTCCRTTCCRPSCCR-PQCCQSVCCQPTCCCPSYC 126



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 23/68 (33%), Positives = 30/68 (44%), Gaps = 6/68 (8%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGIL--CCFAILCW---CCSNPASGSLHSPC 418
           C S+CC  +C  R   C +  C T+CC  S     CC ++ C    CC +    S   P 
Sbjct: 76  CQSVCCQPTCC-RPQCCQTTCCRTTCCRPSCCRPQCCQSVCCQPTCCCPSYCVSSCCRPQ 134

Query: 419 SC-CICCR 439
            C   CCR
Sbjct: 135 CCQTTCCR 142



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 24/74 (32%), Positives = 29/74 (39%), Gaps = 4/74 (5%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCC--SNPA 394
           RPS      C S+CC  +C      CC + C +SCC      CC    C   CC  S   
Sbjct: 102 RPSCCRPQCCQSVCCQPTC------CCPSYCVSSCCRPQ---CCQTTCCRTTCCRPSCCV 152

Query: 395 SGSLHSPCSCCICC 436
           S      C   +CC
Sbjct: 153 SRCYRPHCGQSLCC 166


>AJ406934-1|CAC27573.1|  136|Homo sapiens keratin associated protein
           4.2 protein.
          Length = 136

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 31/93 (33%), Positives = 36/93 (38%), Gaps = 11/93 (11%)
 Frame = +2

Query: 254 CNSICCSYSCTLR--CT-FCCSNRC-GTSCCPSSGILCCFAILC--WCCSNPASGSLHSP 415
           C S+C    C L   C   CC   C  T+CC  S   CC +  C   CC +         
Sbjct: 6   CGSVCSDQGCGLENCCRPSCCQTTCCRTTCCRPS---CCVSSCCRPQCCQSVCCQPTCCS 62

Query: 416 CSCC--ICCRLPIWSST---SSTFPVWICTSVC 499
            SCC   CCR      +   SS F    C SVC
Sbjct: 63  PSCCQTTCCRTTCCRPSCCVSSCFRPQCCQSVC 95



 Score = 39.1 bits (87), Expect = 0.013
 Identities = 24/74 (32%), Positives = 29/74 (39%), Gaps = 8/74 (10%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYSCTLRCTF---CCSNRC--GTSCCPSSGILCCFAILCW---CCS 385
           PS      C + CC  SC +   F   CC + C   T C PS G   C    C+   CC 
Sbjct: 63  PSCCQTTCCRTTCCRPSCCVSSCFRPQCCQSVCCQPTCCRPSCGQTTCCRTTCYRPSCCV 122

Query: 386 NPASGSLHSPCSCC 427
           +       S  SCC
Sbjct: 123 STCCRPTCSSGSCC 136



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 33/92 (35%), Positives = 40/92 (43%), Gaps = 13/92 (14%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSC--TLRC-TFCCS-NRCGTSCCPSSGILCCFAILCW-CCSNP 391
           RP       C   CCS SC  T  C T CC  + C +SC       CC ++ C   C  P
Sbjct: 47  RPQCCQSVCCQPTCCSPSCCQTTCCRTTCCRPSCCVSSCFRPQ---CCQSVCCQPTCCRP 103

Query: 392 ASGS---LHSPC---SCCI--CCRLPIWSSTS 463
           + G      + C   SCC+  CCR P  SS S
Sbjct: 104 SCGQTTCCRTTCYRPSCCVSTCCR-PTCSSGS 134


>AB076351-1|BAD01538.1|  401|Homo sapiens keratin associated protein
           protein.
          Length = 401

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 27/89 (30%), Positives = 35/89 (39%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCC-SNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPC 418
           C ++CC   C+   + CC  + C  +CC SS     CC  + C   CC    S  + S  
Sbjct: 234 CKTVCCKPVCSEDSSSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCKPVGSVPICSGA 293

Query: 419 S--CCICCRLPIWSSTSSTFPVWICTSVC 499
           S  CC          TSS      C  VC
Sbjct: 294 SSLCCQQSSCQPACCTSSQSQQGCCVPVC 322



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 25/89 (28%), Positives = 35/89 (39%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPCS 421
           C  +CC   C    + C  + C ++CC SS     CC  I C   C    +S    S C 
Sbjct: 120 CKPVCCVPVCCGDSSCCQQSSCQSACCTSSPCQQACCVPICCKPVCSGISSSCCQQSSCV 179

Query: 422 CCI---CCRLPIWSSTSSTFPVWICTSVC 499
            C+   CC+     S   +  +  CT  C
Sbjct: 180 SCVSSPCCQAVCEPSPCQSGCISSCTPSC 208



 Score = 38.7 bits (86), Expect = 0.017
 Identities = 29/90 (32%), Positives = 34/90 (37%), Gaps = 11/90 (12%)
 Frame = +2

Query: 230 PSLLP*PLCNSICC-SYSCTLRCTF--CCSNRCGTSCCPSSGILCCFAILCW--CC-SNP 391
           PS      C   CC S SC   C    CC   C    C      CC    C   CC S+P
Sbjct: 206 PSCCQQSSCQPACCTSSSCQQACCVPVCCKTVCCKPVCSEDSSSCCQQSSCQPACCTSSP 265

Query: 392 ASGSLHSPCSC-CICCR----LPIWSSTSS 466
              +   P  C  +CC+    +PI S  SS
Sbjct: 266 CQQACCVPVCCKPVCCKPVGSVPICSGASS 295



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 21/78 (26%), Positives = 29/78 (37%), Gaps = 6/78 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASGSLHSPCSCC 427
           C   CC   C      CC        C  +  LCC    C   CC++  S      C   
Sbjct: 266 CQQACCVPVCCK--PVCCKPVGSVPICSGASSLCCQQSSCQPACCTSSQS---QQGCCVP 320

Query: 428 ICCR----LPIWSSTSST 469
           +CC+    +P+ S  SS+
Sbjct: 321 VCCKPVSCVPVCSGASSS 338



 Score = 31.5 bits (68), Expect = 2.6
 Identities = 30/96 (31%), Positives = 36/96 (37%), Gaps = 9/96 (9%)
 Frame = +2

Query: 248 PLCNSICCSYS-C-TLRCTF-------CCSNRCGTSCCPSSGILCCFAILCWCCSNPASG 400
           P C   CC+ + C +L CT        CC   C  S C S     C    C   S   + 
Sbjct: 40  PCCAPSCCAPAPCLSLVCTPVSRVSSPCCPVTCEPSPCQSGCTSSCTPSCCQQSSCQLAC 99

Query: 401 SLHSPCSCCICCRLPIWSSTSSTFPVWICTSVCSID 508
              SPC    CC +P+   T    PV  C  VC  D
Sbjct: 100 CASSPCQQA-CC-VPVCCKTVCCKPV-CCVPVCCGD 132



 Score = 31.1 bits (67), Expect = 3.4
 Identities = 26/88 (29%), Positives = 38/88 (43%), Gaps = 14/88 (15%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCC-PS---SGIL------CCFAILCW--CCSNP 391
           P+C+ I  S      C  C S+ C  + C PS   SG +      CC    C   CC++ 
Sbjct: 163 PVCSGISSSCCQQSSCVSCVSSPCCQAVCEPSPCQSGCISSCTPSCCQQSSCQPACCTSS 222

Query: 392 ASGSLHSPCSCC--ICCRLPIWSSTSST 469
           +         CC  +CC+ P+ S  SS+
Sbjct: 223 SCQQACCVPVCCKTVCCK-PVCSEDSSS 249


>AB076347-1|BAD01534.1|  282|Homo sapiens keratin associated protein
           protein.
          Length = 282

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 28/72 (38%), Positives = 32/72 (44%), Gaps = 10/72 (13%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNR------CGTSCC-PSSGI-LCCFAILCWCCSNPASGSLH 409
           C  ICC   C+   T CC         C TSCC PSS + L C  +    C  P S S  
Sbjct: 194 CKPICCVPVCSGASTSCCQQSSCQPACCTTSCCRPSSSVSLLCRPVCRPACCMPVS-SCC 252

Query: 410 SPCSCC--ICCR 439
           +P S C   CCR
Sbjct: 253 APASSCQASCCR 264



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 26/86 (30%), Positives = 33/86 (38%), Gaps = 6/86 (6%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYS-CTLRCTF--CCSNRCGTSCCPSSGILCCFAILC--WCCSNPA 394
           PS      C   CC+ S C   C    CC   C    C      CC    C   CC++ +
Sbjct: 77  PSCCQQSSCQPACCTSSPCQQACCMPVCCKPVCCLPTCSKDSSSCCQQSSCQPTCCASSS 136

Query: 395 S-GSLHSPCSCCICCRLPIWSSTSST 469
           S  S   P  C   C +P  S +SS+
Sbjct: 137 SQQSCCVPVCCKPVCYVPTCSESSSS 162



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 4/62 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCC-SNRCGTSCCPSSGI--LCCFAILCW-CCSNPASGSLHSPCS 421
           C  +CC  +C+   + CC  + C  +CC SS     CC  + C   C  P      S  S
Sbjct: 105 CKPVCCLPTCSKDSSSCCQQSSCQPTCCASSSSQQSCCVPVCCKPVCYVPTCS--ESSSS 162

Query: 422 CC 427
           CC
Sbjct: 163 CC 164



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 27/84 (32%), Positives = 36/84 (42%), Gaps = 12/84 (14%)
 Frame = +2

Query: 254 CNSICCSYSCTLR--CT-FCCSNRCGTSCCPSSGILCCFAILCW--CC-SNPASGSLHSP 415
           C   CC+ S + +  C   CC   C    C  S   CC    C   CC S+P   +   P
Sbjct: 127 CQPTCCASSSSQQSCCVPVCCKPVCYVPTCSESSSSCCQQSSCHPACCTSSPCQQACCVP 186

Query: 416 --CS--CC--ICCRLPIWSSTSST 469
             C   CC  ICC +P+ S  S++
Sbjct: 187 VRCKPVCCKPICC-VPVCSGASTS 209



 Score = 33.5 bits (73), Expect = 0.64
 Identities = 31/98 (31%), Positives = 37/98 (37%), Gaps = 22/98 (22%)
 Frame = +2

Query: 242 P*PLCNSICCSYSC-------TLRCTF-------CCSNRCGTSCCPSSGILCCFAILCWC 379
           P   C   CC+ SC       TL CT        CC   C  S C S     C    C  
Sbjct: 23  PESCCEPHCCALSCCAPAPCLTLVCTPVSRVSSPCCQAACEPSPCQSGCTSSCTPSCCQQ 82

Query: 380 CSNPASGSLHSPC--SCC--ICCR----LPIWSSTSST 469
            S   +    SPC  +CC  +CC+    LP  S  SS+
Sbjct: 83  SSCQPACCTSSPCQQACCMPVCCKPVCCLPTCSKDSSS 120



 Score = 31.9 bits (69), Expect = 1.9
 Identities = 25/92 (27%), Positives = 33/92 (35%), Gaps = 10/92 (10%)
 Frame = +2

Query: 254 CNSICCSYSCTL--RCT-FCCSNRCGTSCCPSSGILCCFAILCW-------CCSNPASGS 403
           C S  C  +C +  RC   CC   C    C  +   CC    C        CC   +S S
Sbjct: 174 CTSSPCQQACCVPVRCKPVCCKPICCVPVCSGASTSCCQQSSCQPACCTTSCCRPSSSVS 233

Query: 404 LHSPCSCCICCRLPIWSSTSSTFPVWICTSVC 499
           L     C   C +P+   +S   P   C + C
Sbjct: 234 LLCRPVCRPACCMPV---SSCCAPASSCQASC 262


>AJ406945-1|CAC27584.1|  193|Homo sapiens keratin associated protein
           4.15 protein.
          Length = 193

 Score = 41.1 bits (92), Expect = 0.003
 Identities = 28/85 (32%), Positives = 36/85 (42%), Gaps = 3/85 (3%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW-CCSNPASGSLHSPCSCC- 427
           C   CC  +C  R T C  + C +SCC      CC ++ C   C  P+        +CC 
Sbjct: 9   CRPSCCQTTCC-RTTCCRPSCCVSSCCRPQ---CCQSVCCQPTCCRPSCCPSCCQTTCCR 64

Query: 428 -ICCRLPIWSSTSSTFPVWICTSVC 499
             CCR P    +S   P   C SVC
Sbjct: 65  TTCCR-PSCCVSSCCRP-QCCQSVC 87



 Score = 39.1 bits (87), Expect = 0.013
 Identities = 34/105 (32%), Positives = 40/105 (38%), Gaps = 14/105 (13%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTL------RC--TFCCSNRC-GTSCCPS-SGILCCFAILC- 373
           RPS      C + CC  SC +      +C  + CC   C   SCCPS     CC    C 
Sbjct: 10  RPSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPTCCRPSCCPSCCQTTCCRTTCCR 69

Query: 374 -WCCSNPASGSLHSPCSCC--ICCRLPIWSSTSSTFPVWICTSVC 499
             CC +           CC   CCR P  S +S   P   C S C
Sbjct: 70  PSCCVSSCCRPQCCQSVCCQPTCCR-PSCSISSCCRPS-CCVSRC 112



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 28/81 (34%), Positives = 32/81 (39%), Gaps = 9/81 (11%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLR--CT-FCCSNRCGTS-CCPSSGI--LCCFAILCWC-CS 385
           RP       C   CC  SC++   C   CC +RC  S CC S      CC    C   C 
Sbjct: 79  RPQCCQSVCCQPTCCRPSCSISSCCRPSCCVSRCCRSQCCQSVCCQPTCCRPSCCISSCC 138

Query: 386 NPA--SGSLHSPCSCCICCRL 442
            P+    S   PC C  CC L
Sbjct: 139 RPSCCESSCCRPCCCRPCCCL 159


>AB126079-1|BAD20206.1|  202|Homo sapiens keratin associated protein
           protein.
          Length = 202

 Score = 41.1 bits (92), Expect = 0.003
 Identities = 26/67 (38%), Positives = 30/67 (44%), Gaps = 2/67 (2%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGIL-CCFAILCWCCSNPASGSLHSPCSCC 427
           C S  CS  +C   C  CCS+ CG SCC SS    CC    C C       S   PC C 
Sbjct: 134 CGSCGCSQCNCCKPC--CCSSGCG-SCCQSSCCNPCCCQSSC-CVPVCCQSSCCKPCCCQ 189

Query: 428 ICCRLPI 448
             C +P+
Sbjct: 190 SSCCVPV 196



 Score = 36.3 bits (80), Expect = 0.090
 Identities = 20/72 (27%), Positives = 28/72 (38%), Gaps = 1/72 (1%)
 Frame = +2

Query: 293 CTFCCSNRCGTSCCPSSGILCCFAILCWC-CSNPASGSLHSPCSCCICCRLPIWSSTSST 469
           C  C  ++ G   C  S   CC    C   C +    S  +PC C   C +P+   +S  
Sbjct: 124 CGSCGGSKGGCGSCGCSQCNCCKPCCCSSGCGSCCQSSCCNPCCCQSSCCVPVCCQSSCC 183

Query: 470 FPVWICTSVCSI 505
            P   C S C +
Sbjct: 184 KPC-CCQSSCCV 194



 Score = 31.1 bits (67), Expect = 3.4
 Identities = 18/58 (31%), Positives = 21/58 (36%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           C S C  Y     C  C S+ C   CC     +CC    C C S  + G     C  C
Sbjct: 24  CGSGCGGYGSG--CGGCGSSCCVPVCCCKP--VCCCVPACSCSSCGSCGGSKGDCGSC 77


>BC119643-1|AAI19644.1|  370|Homo sapiens keratin associated protein
           10-7 protein.
          Length = 370

 Score = 40.7 bits (91), Expect = 0.004
 Identities = 28/88 (31%), Positives = 35/88 (39%), Gaps = 6/88 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPC--S 421
           C  +CC  +C+     CC   C TS     G  CC  + C   CC    SG+  S C  S
Sbjct: 234 CKPVCCVPTCSDDSGSCCQPACCTSSQSQQG--CCVPVCCKPVCCVPVCSGASTSCCQQS 291

Query: 422 CC--ICCRLPIWSSTSSTFPVWICTSVC 499
            C   CC       +SS     +C  VC
Sbjct: 292 SCQPACCTTSCCRPSSSV--SLLCRPVC 317



 Score = 39.1 bits (87), Expect = 0.013
 Identities = 28/93 (30%), Positives = 35/93 (37%), Gaps = 9/93 (9%)
 Frame = +2

Query: 248 PLCNSI---CCSYSCTLRCTF--CCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHS 412
           P+C+ I   CC  S  + C    CC   C  S C S  I  C    C   S   +    S
Sbjct: 163 PVCSGISSSCCQQSSCVSCVSSPCCQAVCEPSPCQSGCISSCTPSCCQQSSCKPACCTSS 222

Query: 413 PC--SCC--ICCRLPIWSSTSSTFPVWICTSVC 499
           PC  +CC  +CC+      T S      C   C
Sbjct: 223 PCQQACCVPVCCKPVCCVPTCSDDSGSCCQPAC 255



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 27/94 (28%), Positives = 38/94 (40%), Gaps = 12/94 (12%)
 Frame = +2

Query: 254 CNSICCS-YSCTLRCT---FCCS-NRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSL 406
           C ++CC    C   C+    CC  + C ++CC SS     CC  I C   C    +S   
Sbjct: 115 CKTVCCKPVYCVPVCSGDSSCCQQSSCQSACCTSSPCQQACCVPICCKPVCSGISSSCCQ 174

Query: 407 HSPCSCCI---CCRLPIWSSTSSTFPVWICTSVC 499
            S C  C+   CC+     S   +  +  CT  C
Sbjct: 175 QSSCVSCVSSPCCQAVCEPSPCQSGCISSCTPSC 208



 Score = 35.5 bits (78), Expect = 0.16
 Identities = 28/93 (30%), Positives = 35/93 (37%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLH 409
           P   P P  + +C   S     + CC   C  S C S     C    C   S   +    
Sbjct: 45  PCCAPAPCLSLVCTPVSYV--SSPCCRVTCEPSPCQSGCTSSCTPSCCQQSSCQLACCAS 102

Query: 410 SPCSCCICCRLPIWSSTSSTFPVWICTSVCSID 508
           SPC    CC +P+   T    PV+ C  VCS D
Sbjct: 103 SPCQQA-CC-VPVCCKTVCCKPVY-CVPVCSGD 132



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 26/84 (30%), Positives = 30/84 (35%), Gaps = 2/84 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC--SCC 427
           C  ICC   C+   + CC      SC  S    CC A+   C  +P      S C  SCC
Sbjct: 156 CVPICCKPVCSGISSSCCQQSSCVSCVSSP---CCQAV---CEPSPCQSGCISSCTPSCC 209

Query: 428 ICCRLPIWSSTSSTFPVWICTSVC 499
                     TSS      C  VC
Sbjct: 210 QQSSCKPACCTSSPCQQACCVPVC 233



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 23/83 (27%), Positives = 29/83 (34%), Gaps = 3/83 (3%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYS-CTLRCTF--CCSNRCGTSCCPSSGILCCFAILCWCCSNPASG 400
           PS      C   CC+ S C   C    CC   C    C      CC    C   S    G
Sbjct: 206 PSCCQQSSCKPACCTSSPCQQACCVPVCCKPVCCVPTCSDDSGSCCQPACC-TSSQSQQG 264

Query: 401 SLHSPCSCCICCRLPIWSSTSST 469
                C   +CC +P+ S  S++
Sbjct: 265 CCVPVCCKPVCC-VPVCSGASTS 286



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 24/74 (32%), Positives = 29/74 (39%), Gaps = 2/74 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCWCCSNPASGSLHSPCSCC 427
           C  +CC   C   C   CS    TSCC  S     CC      CC   +S SL     C 
Sbjct: 266 CVPVCCKPVC---CVPVCSG-ASTSCCQQSSCQPACCTTS---CCRPSSSVSLLCRPVCR 318

Query: 428 ICCRLPIWSSTSST 469
             C +P+ S  + T
Sbjct: 319 PACCVPVPSCCAPT 332


>AJ406951-1|CAC27590.1|  154|Homo sapiens keratin associated protein
           9.9 protein.
          Length = 154

 Score = 40.7 bits (91), Expect = 0.004
 Identities = 26/87 (29%), Positives = 34/87 (39%), Gaps = 3/87 (3%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRC--TFCCSNR-CGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC 418
           P C   CC  SC   C    CC N  C T+CC  +   C    L  CC   + GS     
Sbjct: 36  PCCQPSCCVSSCCQPCCRPACCQNTCCRTTCCQPT---C----LSSCCGQTSCGSSCGQS 88

Query: 419 SCCICCRLPIWSSTSSTFPVWICTSVC 499
           S C     P++   +  +P  +C   C
Sbjct: 89  SSC----APVYCRRTCYYPTTVCLPGC 111



 Score = 39.1 bits (87), Expect = 0.013
 Identities = 27/79 (34%), Positives = 34/79 (43%), Gaps = 8/79 (10%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC-WCCSNPAS-- 397
           RP+      C + CC  +C   C  C    CG+SC  SS    C  + C   C  P +  
Sbjct: 53  RPACCQNTCCRTTCCQPTCLSSC--CGQTSCGSSCGQSSS---CAPVYCRRTCYYPTTVC 107

Query: 398 --GSLHSPC--SCC-ICCR 439
             G L+  C  SCC  CCR
Sbjct: 108 LPGCLNQSCGSSCCQPCCR 126



 Score = 35.5 bits (78), Expect = 0.16
 Identities = 22/64 (34%), Positives = 26/64 (40%), Gaps = 6/64 (9%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFC---CSNR-CGTSCC-PSSGILCCFAILC-WCCSNPASGSLHSP 415
           C  + C  +C    T C   C N+ CG+SCC P     CC    C   C  P   S    
Sbjct: 91  CAPVYCRRTCYYPTTVCLPGCLNQSCGSSCCQPCCRPACCETTCCRTTCFQPTCVSSCCQ 150

Query: 416 CSCC 427
            SCC
Sbjct: 151 PSCC 154



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 5/53 (9%)
 Frame = +2

Query: 296 TFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC---SCCI--CCR 439
           T CCS  C  +CC ++   CC    CW  +   + S  +PC   SCC+  CC+
Sbjct: 2   THCCSPCCQPTCCRTT---CC-RTTCWKPTTVTTCS-STPCCQPSCCVSSCCQ 49


>AB076354-1|BAD01541.1|  370|Homo sapiens keratin associated protein
           protein.
          Length = 370

 Score = 40.7 bits (91), Expect = 0.004
 Identities = 28/88 (31%), Positives = 35/88 (39%), Gaps = 6/88 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSPC--S 421
           C  +CC  +C+     CC   C TS     G  CC  + C   CC    SG+  S C  S
Sbjct: 234 CKPVCCVPTCSDDSGSCCQPACCTSSQSQQG--CCVPVCCKPVCCVPVCSGASTSCCQQS 291

Query: 422 CC--ICCRLPIWSSTSSTFPVWICTSVC 499
            C   CC       +SS     +C  VC
Sbjct: 292 SCQPACCTTSCCRPSSSV--SLLCRPVC 317



 Score = 39.1 bits (87), Expect = 0.013
 Identities = 28/93 (30%), Positives = 35/93 (37%), Gaps = 9/93 (9%)
 Frame = +2

Query: 248 PLCNSI---CCSYSCTLRCTF--CCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHS 412
           P+C+ I   CC  S  + C    CC   C  S C S  I  C    C   S   +    S
Sbjct: 163 PVCSGISSSCCQQSSCVSCVSSPCCQAVCEPSPCQSGCISSCTPSCCQQSSCKPACCTSS 222

Query: 413 PC--SCC--ICCRLPIWSSTSSTFPVWICTSVC 499
           PC  +CC  +CC+      T S      C   C
Sbjct: 223 PCQQACCVPVCCKPVCCVPTCSDDSGSCCQPAC 255



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 27/94 (28%), Positives = 38/94 (40%), Gaps = 12/94 (12%)
 Frame = +2

Query: 254 CNSICCS-YSCTLRCT---FCCS-NRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSL 406
           C ++CC    C   C+    CC  + C ++CC SS     CC  I C   C    +S   
Sbjct: 115 CKTVCCKPVYCVPVCSGDSSCCQQSSCQSACCTSSPCQQACCVPICCKPVCSGISSSCCQ 174

Query: 407 HSPCSCCI---CCRLPIWSSTSSTFPVWICTSVC 499
            S C  C+   CC+     S   +  +  CT  C
Sbjct: 175 QSSCVSCVSSPCCQAVCEPSPCQSGCISSCTPSC 208



 Score = 35.5 bits (78), Expect = 0.16
 Identities = 28/93 (30%), Positives = 35/93 (37%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLH 409
           P   P P  + +C   S     + CC   C  S C S     C    C   S   +    
Sbjct: 45  PCCAPAPCLSLVCTPVSYV--SSPCCRVTCEPSPCQSGCTSSCTPSCCQQSSCQLACCAS 102

Query: 410 SPCSCCICCRLPIWSSTSSTFPVWICTSVCSID 508
           SPC    CC +P+   T    PV+ C  VCS D
Sbjct: 103 SPCQQA-CC-VPVCCKTVCCKPVY-CVPVCSGD 132



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 26/84 (30%), Positives = 30/84 (35%), Gaps = 2/84 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC--SCC 427
           C  ICC   C+   + CC      SC  S    CC A+   C  +P      S C  SCC
Sbjct: 156 CVPICCKPVCSGISSSCCQQSSCVSCVSSP---CCQAV---CEPSPCQSGCISSCTPSCC 209

Query: 428 ICCRLPIWSSTSSTFPVWICTSVC 499
                     TSS      C  VC
Sbjct: 210 QQSSCKPACCTSSPCQQACCVPVC 233



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 23/83 (27%), Positives = 29/83 (34%), Gaps = 3/83 (3%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYS-CTLRCTF--CCSNRCGTSCCPSSGILCCFAILCWCCSNPASG 400
           PS      C   CC+ S C   C    CC   C    C      CC    C   S    G
Sbjct: 206 PSCCQQSSCKPACCTSSPCQQACCVPVCCKPVCCVPTCSDDSGSCCQPACC-TSSQSQQG 264

Query: 401 SLHSPCSCCICCRLPIWSSTSST 469
                C   +CC +P+ S  S++
Sbjct: 265 CCVPVCCKPVCC-VPVCSGASTS 286



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 24/74 (32%), Positives = 29/74 (39%), Gaps = 2/74 (2%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCWCCSNPASGSLHSPCSCC 427
           C  +CC   C   C   CS    TSCC  S     CC      CC   +S SL     C 
Sbjct: 266 CVPVCCKPVC---CVPVCSG-ASTSCCQQSSCQPACCTTS---CCRPSSSVSLLCRPVCR 318

Query: 428 ICCRLPIWSSTSST 469
             C +P+ S  + T
Sbjct: 319 PACCVPVPSCCAPT 332


>BC101153-1|AAI01154.1|  167|Homo sapiens keratin associated protein
           1-3 protein.
          Length = 167

 Score = 40.3 bits (90), Expect = 0.006
 Identities = 29/76 (38%), Positives = 33/76 (43%), Gaps = 5/76 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC---SC 424
           C    CS S T   + C  + C TSCC  S   CC    C   S   SG+  S C   SC
Sbjct: 9   CGYPSCSTSGTCGSSCCQPSCCETSCCQPS---CCQTSFCGFPSFSTSGTCSSSCCQPSC 65

Query: 425 C--ICCRLPIWSSTSS 466
           C   CC+ P    TSS
Sbjct: 66  CETSCCQ-PSCCQTSS 80



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 26/82 (31%), Positives = 30/82 (36%), Gaps = 4/82 (4%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASG--SLHSPCSCCIC 433
           CC  S     +   S  CG+SCC  S   CC    C   CC     G  S  +  +C   
Sbjct: 3   CCQTSFCGYPSCSTSGTCGSSCCQPS---CCETSCCQPSCCQTSFCGFPSFSTSGTCSSS 59

Query: 434 CRLPIWSSTSSTFPVWICTSVC 499
           C  P    TS   P    TS C
Sbjct: 60  CCQPSCCETSCCQPSCCQTSSC 81



 Score = 33.9 bits (74), Expect = 0.48
 Identities = 20/57 (35%), Positives = 25/57 (43%), Gaps = 7/57 (12%)
 Frame = +2

Query: 254 CNSICCSYSC--TLRC---TFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASGS 403
           C + CC  SC  T  C   +F  S  C +SCC  S   CC    C   CC   + G+
Sbjct: 30  CETSCCQPSCCQTSFCGFPSFSTSGTCSSSCCQPS---CCETSCCQPSCCQTSSCGT 83



 Score = 29.9 bits (64), Expect = 7.8
 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 4/44 (9%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYSC--TLRCT-FCC-SNRCGTSCCPSSGI 349
           PS      C+S CC  SC  T  C   CC ++ CGT C    GI
Sbjct: 48  PSFSTSGTCSSSCCQPSCCETSCCQPSCCQTSSCGTGCGIGGGI 91


>BC101151-1|AAI01152.1|  167|Homo sapiens keratin associated protein
           1-3 protein.
          Length = 167

 Score = 40.3 bits (90), Expect = 0.006
 Identities = 29/76 (38%), Positives = 33/76 (43%), Gaps = 5/76 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC---SC 424
           C    CS S T   + C  + C TSCC  S   CC    C   S   SG+  S C   SC
Sbjct: 9   CGYPSCSTSGTCGSSCCQPSCCETSCCQPS---CCQTSFCGFPSFSTSGTCSSSCCQPSC 65

Query: 425 C--ICCRLPIWSSTSS 466
           C   CC+ P    TSS
Sbjct: 66  CETSCCQ-PSCCQTSS 80



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 26/82 (31%), Positives = 30/82 (36%), Gaps = 4/82 (4%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASG--SLHSPCSCCIC 433
           CC  S     +   S  CG+SCC  S   CC    C   CC     G  S  +  +C   
Sbjct: 3   CCQTSFCGYPSCSTSGTCGSSCCQPS---CCETSCCQPSCCQTSFCGFPSFSTSGTCSSS 59

Query: 434 CRLPIWSSTSSTFPVWICTSVC 499
           C  P    TS   P    TS C
Sbjct: 60  CCQPSCCETSCCQPSCCQTSSC 81



 Score = 33.9 bits (74), Expect = 0.48
 Identities = 20/57 (35%), Positives = 25/57 (43%), Gaps = 7/57 (12%)
 Frame = +2

Query: 254 CNSICCSYSC--TLRC---TFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASGS 403
           C + CC  SC  T  C   +F  S  C +SCC  S   CC    C   CC   + G+
Sbjct: 30  CETSCCQPSCCQTSFCGFPSFSTSGTCSSSCCQPS---CCETSCCQPSCCQTSSCGT 83



 Score = 29.9 bits (64), Expect = 7.8
 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 4/44 (9%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYSC--TLRCT-FCC-SNRCGTSCCPSSGI 349
           PS      C+S CC  SC  T  C   CC ++ CGT C    GI
Sbjct: 48  PSFSTSGTCSSSCCQPSCCETSCCQPSCCQTSSCGTGCGIGGGI 91


>BC101150-1|AAI01151.1|  167|Homo sapiens keratin associated protein
           1-3 protein.
          Length = 167

 Score = 40.3 bits (90), Expect = 0.006
 Identities = 29/76 (38%), Positives = 33/76 (43%), Gaps = 5/76 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC---SC 424
           C    CS S T   + C  + C TSCC  S   CC    C   S   SG+  S C   SC
Sbjct: 9   CGYPSCSTSGTCGSSCCQPSCCETSCCQPS---CCQTSFCGFPSFSTSGTCSSSCCQPSC 65

Query: 425 C--ICCRLPIWSSTSS 466
           C   CC+ P    TSS
Sbjct: 66  CETSCCQ-PSCCQTSS 80



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 26/82 (31%), Positives = 30/82 (36%), Gaps = 4/82 (4%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASG--SLHSPCSCCIC 433
           CC  S     +   S  CG+SCC  S   CC    C   CC     G  S  +  +C   
Sbjct: 3   CCQTSFCGYPSCSTSGTCGSSCCQPS---CCETSCCQPSCCQTSFCGFPSFSTSGTCSSS 59

Query: 434 CRLPIWSSTSSTFPVWICTSVC 499
           C  P    TS   P    TS C
Sbjct: 60  CCQPSCCETSCCQPSCCQTSSC 81



 Score = 33.9 bits (74), Expect = 0.48
 Identities = 20/57 (35%), Positives = 25/57 (43%), Gaps = 7/57 (12%)
 Frame = +2

Query: 254 CNSICCSYSC--TLRC---TFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASGS 403
           C + CC  SC  T  C   +F  S  C +SCC  S   CC    C   CC   + G+
Sbjct: 30  CETSCCQPSCCQTSFCGFPSFSTSGTCSSSCCQPS---CCETSCCQPSCCQTSSCGT 83



 Score = 29.9 bits (64), Expect = 7.8
 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 4/44 (9%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYSC--TLRCT-FCC-SNRCGTSCCPSSGI 349
           PS      C+S CC  SC  T  C   CC ++ CGT C    GI
Sbjct: 48  PSFSTSGTCSSSCCQPSCCETSCCQPSCCQTSSCGTGCGIGGGI 91


>BC069161-1|AAH69161.1|  167|Homo sapiens keratin associated protein
           1-3 protein.
          Length = 167

 Score = 40.3 bits (90), Expect = 0.006
 Identities = 29/76 (38%), Positives = 33/76 (43%), Gaps = 5/76 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC---SC 424
           C    CS S T   + C  + C TSCC  S   CC    C   S   SG+  S C   SC
Sbjct: 9   CGYPSCSTSGTCGSSCCQPSCCETSCCQPS---CCQTSFCGFPSFSTSGTCSSSCCQPSC 65

Query: 425 C--ICCRLPIWSSTSS 466
           C   CC+ P    TSS
Sbjct: 66  CETSCCQ-PSCCQTSS 80



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 26/82 (31%), Positives = 30/82 (36%), Gaps = 4/82 (4%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASG--SLHSPCSCCIC 433
           CC  S     +   S  CG+SCC  S   CC    C   CC     G  S  +  +C   
Sbjct: 3   CCQTSFCGYPSCSTSGTCGSSCCQPS---CCETSCCQPSCCQTSFCGFPSFSTSGTCSSS 59

Query: 434 CRLPIWSSTSSTFPVWICTSVC 499
           C  P    TS   P    TS C
Sbjct: 60  CCQPSCCETSCCQPSCCQTSSC 81



 Score = 33.9 bits (74), Expect = 0.48
 Identities = 20/57 (35%), Positives = 25/57 (43%), Gaps = 7/57 (12%)
 Frame = +2

Query: 254 CNSICCSYSC--TLRC---TFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASGS 403
           C + CC  SC  T  C   +F  S  C +SCC  S   CC    C   CC   + G+
Sbjct: 30  CETSCCQPSCCQTSFCGFPSFSTSGTCSSSCCQPS---CCETSCCQPSCCQTSSCGT 83



 Score = 29.9 bits (64), Expect = 7.8
 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 4/44 (9%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYSC--TLRCT-FCC-SNRCGTSCCPSSGI 349
           PS      C+S CC  SC  T  C   CC ++ CGT C    GI
Sbjct: 48  PSFSTSGTCSSSCCQPSCCETSCCQPSCCQTSSCGTGCGIGGGI 91


>AJ406927-1|CAC27566.1|  167|Homo sapiens keratin associated protein
           1.3 protein.
          Length = 167

 Score = 40.3 bits (90), Expect = 0.006
 Identities = 29/76 (38%), Positives = 33/76 (43%), Gaps = 5/76 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC---SC 424
           C    CS S T   + C  + C TSCC  S   CC    C   S   SG+  S C   SC
Sbjct: 9   CGYPSCSTSGTCGSSCCQPSCCETSCCQPS---CCQTSFCGFPSFSTSGTCSSSCCQPSC 65

Query: 425 C--ICCRLPIWSSTSS 466
           C   CC+ P    TSS
Sbjct: 66  CETSCCQ-PSCCQTSS 80



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 26/82 (31%), Positives = 30/82 (36%), Gaps = 4/82 (4%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASG--SLHSPCSCCIC 433
           CC  S     +   S  CG+SCC  S   CC    C   CC     G  S  +  +C   
Sbjct: 3   CCQTSFCGYPSCSTSGTCGSSCCQPS---CCETSCCQPSCCQTSFCGFPSFSTSGTCSSS 59

Query: 434 CRLPIWSSTSSTFPVWICTSVC 499
           C  P    TS   P    TS C
Sbjct: 60  CCQPSCCETSCCQPSCCQTSSC 81



 Score = 33.9 bits (74), Expect = 0.48
 Identities = 20/57 (35%), Positives = 25/57 (43%), Gaps = 7/57 (12%)
 Frame = +2

Query: 254 CNSICCSYSC--TLRC---TFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASGS 403
           C + CC  SC  T  C   +F  S  C +SCC  S   CC    C   CC   + G+
Sbjct: 30  CETSCCQPSCCQTSFCGFPSFSTSGTCSSSCCQPS---CCETSCCQPSCCQTSSCGT 83



 Score = 29.9 bits (64), Expect = 7.8
 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 4/44 (9%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYSC--TLRCT-FCC-SNRCGTSCCPSSGI 349
           PS      C+S CC  SC  T  C   CC ++ CGT C    GI
Sbjct: 48  PSFSTSGTCSSSCCQPSCCETSCCQPSCCQTSSCGTGCGIGGGI 91


>AF010404-1|AAC51735.1| 4957|Homo sapiens ALR protein.
          Length = 4957

 Score = 40.3 bits (90), Expect = 0.006
 Identities = 32/115 (27%), Positives = 58/115 (50%), Gaps = 1/115 (0%)
 Frame = -1

Query: 525  ALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQG-ECREPLAGLEQHQHSMAKQHR 349
            ++   S ++Q+L+  H+G        MGS Q +QQ+Q  + ++ L   +Q Q    +Q +
Sbjct: 3289 SMAGLSHLQQSLMS-HSGQPKLSAQPMGSLQQLQQQQQLQQQQQLQQQQQQQLQQQQQLQ 3347

Query: 348  MPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHRGYGRSEGRCCYQRTQCPAGDIN 184
               L QQ+    L+QQ+ Q   QL +QQ +L +   + + +   Q+ Q   G +N
Sbjct: 3348 QQQLQQQQQQQQLQQQQQQ---QLQQQQQQLQQQQQQQQQQFQQQQQQQQMGLLN 3399



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 3/64 (4%)
 Frame = -1

Query: 441  SRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQ---EVPHLLEQQKVQRRVQL*E 271
            ++Q  QQ+Q + +  +AGL   Q S+      P L  Q    +  L +QQ++Q++ QL +
Sbjct: 3275 AQQQQQQQQHQQQGSMAGLSHLQQSLMSHSGQPKLSAQPMGSLQQLQQQQQLQQQQQLQQ 3334

Query: 270  QQME 259
            QQ +
Sbjct: 3335 QQQQ 3338


>AF010403-1|AAC51734.1| 5262|Homo sapiens ALR protein.
          Length = 5262

 Score = 40.3 bits (90), Expect = 0.006
 Identities = 32/115 (27%), Positives = 58/115 (50%), Gaps = 1/115 (0%)
 Frame = -1

Query: 525  ALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQG-ECREPLAGLEQHQHSMAKQHR 349
            ++   S ++Q+L+  H+G        MGS Q +QQ+Q  + ++ L   +Q Q    +Q +
Sbjct: 3594 SMAGLSHLQQSLMS-HSGQPKLSAQPMGSLQQLQQQQQLQQQQQLQQQQQQQLQQQQQLQ 3652

Query: 348  MPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHRGYGRSEGRCCYQRTQCPAGDIN 184
               L QQ+    L+QQ+ Q   QL +QQ +L +   + + +   Q+ Q   G +N
Sbjct: 3653 QQQLQQQQQQQQLQQQQQQ---QLQQQQQQLQQQQQQQQQQFQQQQQQQQMGLLN 3704



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 3/64 (4%)
 Frame = -1

Query: 441  SRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQ---EVPHLLEQQKVQRRVQL*E 271
            ++Q  QQ+Q + +  +AGL   Q S+      P L  Q    +  L +QQ++Q++ QL +
Sbjct: 3580 AQQQQQQQQHQQQGSMAGLSHLQQSLMSHSGQPKLSAQPMGSLQQLQQQQQLQQQQQLQQ 3639

Query: 270  QQME 259
            QQ +
Sbjct: 3640 QQQQ 3643


>AB209494-1|BAD92731.1| 2704|Homo sapiens myeloid/lymphoid or
            mixed-lineage leukemia 2 variant protein.
          Length = 2704

 Score = 40.3 bits (90), Expect = 0.006
 Identities = 32/115 (27%), Positives = 58/115 (50%), Gaps = 1/115 (0%)
 Frame = -1

Query: 525  ALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQG-ECREPLAGLEQHQHSMAKQHR 349
            ++   S ++Q+L+  H+G        MGS Q +QQ+Q  + ++ L   +Q Q    +Q +
Sbjct: 1036 SMAGLSHLQQSLMS-HSGQPKLSAQPMGSLQQLQQQQQLQQQQQLQQQQQQQLQQQQQLQ 1094

Query: 348  MPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHRGYGRSEGRCCYQRTQCPAGDIN 184
               L QQ+    L+QQ+ Q   QL +QQ +L +   + + +   Q+ Q   G +N
Sbjct: 1095 QQQLQQQQQQQQLQQQQQQ---QLQQQQQQLQQQQQQQQQQFQQQQQQQQMGLLN 1146



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 3/64 (4%)
 Frame = -1

Query: 441  SRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQ---EVPHLLEQQKVQRRVQL*E 271
            ++Q  QQ+Q + +  +AGL   Q S+      P L  Q    +  L +QQ++Q++ QL +
Sbjct: 1022 AQQQQQQQQHQQQGSMAGLSHLQQSLMSHSGQPKLSAQPMGSLQQLQQQQQLQQQQQLQQ 1081

Query: 270  QQME 259
            QQ +
Sbjct: 1082 QQQQ 1085


>BC127016-1|AAI27017.1|  259|Homo sapiens KRTAP10-8 protein protein.
          Length = 259

 Score = 39.1 bits (87), Expect = 0.013
 Identities = 28/91 (30%), Positives = 37/91 (40%), Gaps = 9/91 (9%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCC-SNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPC 418
           C  +CC   C+   + CC  + C ++CC  S     CC  I C   CC    SG+    C
Sbjct: 129 CKPVCCVSICSGASSPCCQQSSCQSACCTFSPCQQACCVPICCKPICCVPVCSGASSLCC 188

Query: 419 --SCC--ICCRLPIWSSTSSTFPVWICTSVC 499
             S C   CC       +SS     +C  VC
Sbjct: 189 QKSSCQPACCTTSCCRPSSSV--SLLCRPVC 217



 Score = 37.5 bits (83), Expect = 0.039
 Identities = 22/74 (29%), Positives = 29/74 (39%), Gaps = 3/74 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCS-NPASGSLHSPCSC 424
           C   CC   C    + CC   C  S C  +   CC    C   CC+ +P   +   P  C
Sbjct: 114 CQQACCVPVCCK--SNCCKPVCCVSICSGASSPCCQQSSCQSACCTFSPCQQACCVPICC 171

Query: 425 CICCRLPIWSSTSS 466
              C +P+ S  SS
Sbjct: 172 KPICCVPVCSGASS 185



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 26/87 (29%), Positives = 33/87 (37%), Gaps = 4/87 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCT----FCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS 421
           C S CC+ SC          C    C  S C S     C    C   S   +    SPC 
Sbjct: 56  CASSCCTPSCCAPAPCLALVCAPVSCEPSPCQSGCTDSCTPSCCQQSSCQPACCTSSPCQ 115

Query: 422 CCICCRLPIWSSTSSTFPVWICTSVCS 502
              CC +P+   ++   PV  C S+CS
Sbjct: 116 QA-CC-VPVCCKSNCCKPV-CCVSICS 139


>AK123603-1|BAC85658.1|  143|Homo sapiens protein ( Homo sapiens
           cDNA FLJ41609 fis, clone CTONG3001560. ).
          Length = 143

 Score = 39.1 bits (87), Expect = 0.013
 Identities = 22/87 (25%), Positives = 36/87 (41%), Gaps = 10/87 (11%)
 Frame = +2

Query: 269 CSYSCTLRCTFCCSNRCGTSCCPSSGILC-----CFAILCWC-CSNPASGSLHSPCSC-- 424
           C++ C + C   C+  C  SCC    +LC     C   +C C C       L + C+C  
Sbjct: 53  CAHMCLVPCVCVCAWACVFSCCVRVLVLCVCTHVCLVTVCACACFVCVHACLVTACACAC 112

Query: 425 --CICCRLPIWSSTSSTFPVWICTSVC 499
             C+C  +    + +   P  +C  +C
Sbjct: 113 FVCVCMCVVTMCACACVLPC-VCVHLC 138



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 17/65 (26%), Positives = 27/65 (41%), Gaps = 1/65 (1%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC- 427
           +C  +C    C   C F C + C  + C  +    CF  +C C     + +   PC C  
Sbjct: 82  VCTHVCLVTVCACAC-FVCVHACLVTACACA----CFVCVCMCVVTMCACACVLPCVCVH 136

Query: 428 ICCRL 442
           +C R+
Sbjct: 137 LCVRM 141


>AB076355-1|BAD01542.1|  259|Homo sapiens keratin associated protein
           protein.
          Length = 259

 Score = 39.1 bits (87), Expect = 0.013
 Identities = 28/91 (30%), Positives = 37/91 (40%), Gaps = 9/91 (9%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCC-SNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPC 418
           C  +CC   C+   + CC  + C ++CC  S     CC  I C   CC    SG+    C
Sbjct: 129 CKPVCCVSICSGASSPCCQQSSCQSACCTFSPCQQACCVPICCKPICCVPVCSGASSLCC 188

Query: 419 --SCC--ICCRLPIWSSTSSTFPVWICTSVC 499
             S C   CC       +SS     +C  VC
Sbjct: 189 QKSSCQPACCTTSCCRPSSSV--SLLCRPVC 217



 Score = 37.5 bits (83), Expect = 0.039
 Identities = 22/74 (29%), Positives = 29/74 (39%), Gaps = 3/74 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCS-NPASGSLHSPCSC 424
           C   CC   C    + CC   C  S C  +   CC    C   CC+ +P   +   P  C
Sbjct: 114 CQQACCVPVCCK--SNCCKPVCCVSICSGASSPCCQQSSCQSACCTFSPCQQACCVPICC 171

Query: 425 CICCRLPIWSSTSS 466
              C +P+ S  SS
Sbjct: 172 KPICCVPVCSGASS 185



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 26/87 (29%), Positives = 33/87 (37%), Gaps = 4/87 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCT----FCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS 421
           C S CC+ SC          C    C  S C S     C    C   S   +    SPC 
Sbjct: 56  CASSCCTPSCCAPAPCLALVCAPVSCEPSPCQSGCTDSCTPSCCQQSSCQPACCTSSPCQ 115

Query: 422 CCICCRLPIWSSTSSTFPVWICTSVCS 502
              CC +P+   ++   PV  C S+CS
Sbjct: 116 QA-CC-VPVCCKSNCCKPV-CCVSICS 139


>AB076348-1|BAD01535.1|  255|Homo sapiens keratin associated protein
           protein.
          Length = 255

 Score = 39.1 bits (87), Expect = 0.013
 Identities = 26/96 (27%), Positives = 37/96 (38%), Gaps = 12/96 (12%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI-------LCCFAILC--WCCSNPASGSL 406
           C  +CC   C    + C  + C  +CC SS         +CC A+ C   C  + +S   
Sbjct: 105 CKPVCCVPVCCGASSCCQQSSCQPACCASSSCQQSCRVPVCCKAVCCVPTCSESSSSCCQ 164

Query: 407 HSPCSCCICCRLPIWSSTSSTF---PVWICTSVCSI 505
            S C    C   P   S   +    PV  C S+C +
Sbjct: 165 QSSCQPACCTSSPCQQSCCVSVCCKPV-CCKSICCV 199



 Score = 37.9 bits (84), Expect = 0.030
 Identities = 24/60 (40%), Positives = 30/60 (50%), Gaps = 7/60 (11%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCC-SNRCGTSCCPSSGILCC-----FAILCW-CCSNPASGSLHS 412
           C SICC   C+   + CC  + C  +CC SS   CC      ++LC   CS PAS S  S
Sbjct: 193 CKSICCVPVCSGASSPCCQQSSCQPACCTSS---CCRPSSSVSLLCRPVCSRPASCSFSS 249



 Score = 36.7 bits (81), Expect = 0.068
 Identities = 26/94 (27%), Positives = 34/94 (36%), Gaps = 8/94 (8%)
 Frame = +2

Query: 242 P*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC- 418
           P P    +C   SC    + CC   C  S C S     C    C   S   +    SPC 
Sbjct: 39  PAPCLTLVCTPVSCV--SSPCCQAACEPSACQSGCTSSCTPSCCQQSSCQPACCTSSPCQ 96

Query: 419 -SCC--ICCR----LPIWSSTSSTFPVWICTSVC 499
            +CC  +CC+    +P+    SS      C   C
Sbjct: 97  QACCVPVCCKPVCCVPVCCGASSCCQQSSCQPAC 130



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 25/88 (28%), Positives = 33/88 (37%), Gaps = 5/88 (5%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCT-FCCSNRCGT-SCCPSSGILCCFAILCWCCSNPASGSLHSPCSC 424
           +C+S C +      C   CC   CGT SCC  +  L        C S+P   +   P +C
Sbjct: 8   ICSSACTNSWQVDDCPESCCELPCGTPSCCAPAPCLTLVCTPVSCVSSPCCQAACEPSAC 67

Query: 425 ---CICCRLPIWSSTSSTFPVWICTSVC 499
              C     P     SS  P    +S C
Sbjct: 68  QSGCTSSCTPSCCQQSSCQPACCTSSPC 95


>BC133035-1|AAI33036.1|  129|Homo sapiens keratin associated protein
           5-6 protein.
          Length = 129

 Score = 38.7 bits (86), Expect = 0.017
 Identities = 28/93 (30%), Positives = 34/93 (36%), Gaps = 10/93 (10%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGIL--CCFAI-----LCWCCSNPASGSLHS 412
           C S CC   C  +   CC   C  + C S G    CC +       C  C     G    
Sbjct: 24  CGSSCCVPICCCKPVCCCVPACSCTSCGSCGGSKGCCGSCGGSKGGCGSCGGSKGGCGSC 83

Query: 413 PCSCCICCRLPIWSST---SSTFPVWICTSVCS 502
            CS C CC+ P + S+   SS      C   CS
Sbjct: 84  GCSQCSCCK-PCYCSSGCGSSCCQSSCCKPCCS 115



 Score = 36.3 bits (80), Expect = 0.090
 Identities = 28/68 (41%), Positives = 31/68 (45%), Gaps = 3/68 (4%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC- 427
           C S  CS  SC   C   CS+ CG+SCC SS   CC      CCS           SCC 
Sbjct: 80  CGSCGCSQCSCCKPCY--CSSGCGSSCCQSS---CCKP----CCSQ---------ASCCV 121

Query: 428 -ICCRLPI 448
            ICC+  I
Sbjct: 122 PICCQCKI 129



 Score = 30.3 bits (65), Expect = 5.9
 Identities = 31/92 (33%), Positives = 35/92 (38%), Gaps = 17/92 (18%)
 Frame = +2

Query: 254 CNSICC---SYSCTLRCTFC-----CSNRCGTS---C--CPSS--GILCCFAILCWCCSN 388
           C  +CC   + SCT  C  C     C   CG S   C  C  S  G   C    C CC  
Sbjct: 35  CKPVCCCVPACSCT-SCGSCGGSKGCCGSCGGSKGGCGSCGGSKGGCGSCGCSQCSCC-K 92

Query: 389 PASGSLHSPCSCC--ICCRLPIWSSTSSTFPV 478
           P   S     SCC   CC+ P  S  S   P+
Sbjct: 93  PCYCSSGCGSSCCQSSCCK-PCCSQASCCVPI 123


>BC130399-1|AAI30400.1|  129|Homo sapiens keratin associated protein
           5-6 protein.
          Length = 129

 Score = 38.7 bits (86), Expect = 0.017
 Identities = 28/93 (30%), Positives = 34/93 (36%), Gaps = 10/93 (10%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGIL--CCFAI-----LCWCCSNPASGSLHS 412
           C S CC   C  +   CC   C  + C S G    CC +       C  C     G    
Sbjct: 24  CGSSCCVPICCCKPVCCCVPACSCTSCGSCGGSKGCCGSCGGSKGGCGSCGGSKGGCGSC 83

Query: 413 PCSCCICCRLPIWSST---SSTFPVWICTSVCS 502
            CS C CC+ P + S+   SS      C   CS
Sbjct: 84  GCSQCSCCK-PCYCSSGCGSSCCQSSCCKPCCS 115



 Score = 36.3 bits (80), Expect = 0.090
 Identities = 28/68 (41%), Positives = 31/68 (45%), Gaps = 3/68 (4%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC- 427
           C S  CS  SC   C   CS+ CG+SCC SS   CC      CCS           SCC 
Sbjct: 80  CGSCGCSQCSCCKPCY--CSSGCGSSCCQSS---CCKP----CCSQ---------ASCCV 121

Query: 428 -ICCRLPI 448
            ICC+  I
Sbjct: 122 PICCQCKI 129



 Score = 30.3 bits (65), Expect = 5.9
 Identities = 31/92 (33%), Positives = 35/92 (38%), Gaps = 17/92 (18%)
 Frame = +2

Query: 254 CNSICC---SYSCTLRCTFC-----CSNRCGTS---C--CPSS--GILCCFAILCWCCSN 388
           C  +CC   + SCT  C  C     C   CG S   C  C  S  G   C    C CC  
Sbjct: 35  CKPVCCCVPACSCT-SCGSCGGSKGCCGSCGGSKGGCGSCGGSKGGCGSCGCSQCSCC-K 92

Query: 389 PASGSLHSPCSCC--ICCRLPIWSSTSSTFPV 478
           P   S     SCC   CC+ P  S  S   P+
Sbjct: 93  PCYCSSGCGSSCCQSSCCK-PCCSQASCCVPI 123


>BC120950-1|AAI20951.1|  271|Homo sapiens keratin associated protein
           10-5 protein.
          Length = 271

 Score = 38.7 bits (86), Expect = 0.017
 Identities = 29/94 (30%), Positives = 35/94 (37%), Gaps = 8/94 (8%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCS-NRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHS 412
           P C + C    C   CT  C+ + C  +CC SS     CC  + C   CC    S    S
Sbjct: 50  PCCQAACEPSPCQSGCTSSCTPSCCQPACCASSPCQQACCVPVCCKPVCCLPTCSKDSSS 109

Query: 413 PC---SCCICCRLPIWSSTSSTFPVWICTSVCSI 505
            C   SC   C        S   PV  C  VC +
Sbjct: 110 CCQQSSCQPTCCASSSCQQSCCVPV-CCKPVCCV 142



 Score = 37.1 bits (82), Expect = 0.052
 Identities = 32/104 (30%), Positives = 45/104 (43%), Gaps = 20/104 (19%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS-NRCGTSCCPSSGI-------LCCFAILCW---CCSNPASG 400
           C  +CC  +C+   + CC  + C  +CC SS         +CC  + C+   CC    SG
Sbjct: 136 CKPVCCVPTCSEDSSSCCQHSSCQPTCCTSSPCQQSCYVPVCCKPV-CFKPICCVPVCSG 194

Query: 401 SLHSPC-------SCCI--CCRLPIWSSTSSTFPVWICTSVCSI 505
           +  S C       +CC   CCR P  SS+ S     IC   C +
Sbjct: 195 ASTSCCQQSSCQPACCTTSCCR-P--SSSVSLLCRPICRPACCV 235


>BC120949-1|AAI20950.1|  271|Homo sapiens keratin associated protein
           10-5 protein.
          Length = 271

 Score = 38.7 bits (86), Expect = 0.017
 Identities = 29/94 (30%), Positives = 35/94 (37%), Gaps = 8/94 (8%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCS-NRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHS 412
           P C + C    C   CT  C+ + C  +CC SS     CC  + C   CC    S    S
Sbjct: 50  PCCQAACEPSPCQSGCTSSCTPSCCQPACCASSPCQQACCVPVCCKPVCCLPTCSKDSSS 109

Query: 413 PC---SCCICCRLPIWSSTSSTFPVWICTSVCSI 505
            C   SC   C        S   PV  C  VC +
Sbjct: 110 CCQQSSCQPTCCASSSCQQSCCVPV-CCKPVCCV 142



 Score = 37.1 bits (82), Expect = 0.052
 Identities = 32/104 (30%), Positives = 45/104 (43%), Gaps = 20/104 (19%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS-NRCGTSCCPSSGI-------LCCFAILCW---CCSNPASG 400
           C  +CC  +C+   + CC  + C  +CC SS         +CC  + C+   CC    SG
Sbjct: 136 CKPVCCVPTCSEDSSSCCQHSSCQPTCCTSSPCQQSCYVPVCCKPV-CFKPICCVPVCSG 194

Query: 401 SLHSPC-------SCCI--CCRLPIWSSTSSTFPVWICTSVCSI 505
           +  S C       +CC   CCR P  SS+ S     IC   C +
Sbjct: 195 ASTSCCQQSSCQPACCTTSCCR-P--SSSVSLLCRPICRPACCV 235


>AB126075-1|BAD20202.1|  129|Homo sapiens keratin associated protein
           protein.
          Length = 129

 Score = 38.7 bits (86), Expect = 0.017
 Identities = 28/93 (30%), Positives = 34/93 (36%), Gaps = 10/93 (10%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGIL--CCFAI-----LCWCCSNPASGSLHS 412
           C S CC   C  +   CC   C  + C S G    CC +       C  C     G    
Sbjct: 24  CGSSCCVPICCCKPVCCCVPACSCTSCGSCGGSKGCCGSCGGSKGGCGSCGGSKGGCGSC 83

Query: 413 PCSCCICCRLPIWSST---SSTFPVWICTSVCS 502
            CS C CC+ P + S+   SS      C   CS
Sbjct: 84  GCSQCSCCK-PCYCSSGCGSSCCQSSCCKPCCS 115



 Score = 36.3 bits (80), Expect = 0.090
 Identities = 28/68 (41%), Positives = 31/68 (45%), Gaps = 3/68 (4%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC- 427
           C S  CS  SC   C   CS+ CG+SCC SS   CC      CCS           SCC 
Sbjct: 80  CGSCGCSQCSCCKPCY--CSSGCGSSCCQSS---CCKP----CCSQ---------ASCCV 121

Query: 428 -ICCRLPI 448
            ICC+  I
Sbjct: 122 PICCQCKI 129



 Score = 30.3 bits (65), Expect = 5.9
 Identities = 31/92 (33%), Positives = 35/92 (38%), Gaps = 17/92 (18%)
 Frame = +2

Query: 254 CNSICC---SYSCTLRCTFC-----CSNRCGTS---C--CPSS--GILCCFAILCWCCSN 388
           C  +CC   + SCT  C  C     C   CG S   C  C  S  G   C    C CC  
Sbjct: 35  CKPVCCCVPACSCT-SCGSCGGSKGCCGSCGGSKGGCGSCGGSKGGCGSCGCSQCSCC-K 92

Query: 389 PASGSLHSPCSCC--ICCRLPIWSSTSSTFPV 478
           P   S     SCC   CC+ P  S  S   P+
Sbjct: 93  PCYCSSGCGSSCCQSSCCK-PCCSQASCCVPI 123


>AB076364-1|BAD01551.1|  245|Homo sapiens keratin associated protein
           protein.
          Length = 245

 Score = 38.7 bits (86), Expect = 0.017
 Identities = 28/91 (30%), Positives = 36/91 (39%), Gaps = 9/91 (9%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCC-SNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPC 418
           C  +CC   C    + CC  + C  +CC SS     CC  + C   CC    SG+    C
Sbjct: 115 CKPVCCMPVCCGPSSSCCQQSSCQPACCISSPCQQSCCVPVCCKPICCVPVCSGASSLCC 174

Query: 419 --SCC--ICCRLPIWSSTSSTFPVWICTSVC 499
             S C   CC       +SS     +C  VC
Sbjct: 175 QQSSCQPACCTTSCCRPSSSV--SLLCRPVC 203



 Score = 33.1 bits (72), Expect = 0.84
 Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 7/66 (10%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNR------CGTSCC-PSSGILCCFAILCWCCSNPASGSLHS 412
           C  ICC   C+   + CC         C TSCC PSS +    ++LC     PA   +  
Sbjct: 157 CKPICCVPVCSGASSLCCQQSSCQPACCTTSCCRPSSSV----SLLCRPVCRPAR-RVPV 211

Query: 413 PCSCCI 430
           P SCC+
Sbjct: 212 P-SCCV 216



 Score = 31.1 bits (67), Expect = 3.4
 Identities = 26/90 (28%), Positives = 32/90 (35%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLH 409
           P   P P  + +C   S     + CC   C  S C S     C    C   S   +    
Sbjct: 40  PCCAPAPCLSLVCTPVSRV--SSPCCRVTCEPSPCQSGCTSSCTPSCCQQSSCQPACCTS 97

Query: 410 SPCSCCICCRLPIWSSTSSTFPVWICTSVC 499
           SPC    CC +P+   T    PV  C  VC
Sbjct: 98  SPCQQA-CC-VPVCCKTVCCKPV-CCMPVC 124



 Score = 30.7 bits (66), Expect = 4.5
 Identities = 26/92 (28%), Positives = 30/92 (32%), Gaps = 10/92 (10%)
 Frame = +2

Query: 254 CNSICC-SYSCTLRCTF--CCSNRCGTSCCPSSGILCCFAILCW-------CCSNPASGS 403
           C   CC S  C   C    CC   C    C  +  LCC    C        CC   +S S
Sbjct: 137 CQPACCISSPCQQSCCVPVCCKPICCVPVCSGASSLCCQQSSCQPACCTTSCCRPSSSVS 196

Query: 404 LHSPCSCCICCRLPIWSSTSSTFPVWICTSVC 499
           L     C    R+P+    S   P   C   C
Sbjct: 197 LLCRPVCRPARRVPV---PSCCVPTSSCQPSC 225


>AB076352-1|BAD01539.1|  271|Homo sapiens keratin associated protein
           protein.
          Length = 271

 Score = 38.7 bits (86), Expect = 0.017
 Identities = 29/94 (30%), Positives = 35/94 (37%), Gaps = 8/94 (8%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCS-NRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHS 412
           P C + C    C   CT  C+ + C  +CC SS     CC  + C   CC    S    S
Sbjct: 50  PCCQAACEPSPCQSGCTSSCTPSCCQPACCASSPCQQACCVPVCCKPVCCLPTCSKDSSS 109

Query: 413 PC---SCCICCRLPIWSSTSSTFPVWICTSVCSI 505
            C   SC   C        S   PV  C  VC +
Sbjct: 110 CCQQSSCQPTCCASSSCQQSCCVPV-CCKPVCCV 142



 Score = 37.1 bits (82), Expect = 0.052
 Identities = 32/104 (30%), Positives = 45/104 (43%), Gaps = 20/104 (19%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS-NRCGTSCCPSSGI-------LCCFAILCW---CCSNPASG 400
           C  +CC  +C+   + CC  + C  +CC SS         +CC  + C+   CC    SG
Sbjct: 136 CKPVCCVPTCSEDSSSCCQHSSCQPTCCTSSPCQQSCYVPVCCKPV-CFKPICCVPVCSG 194

Query: 401 SLHSPC-------SCCI--CCRLPIWSSTSSTFPVWICTSVCSI 505
           +  S C       +CC   CCR P  SS+ S     IC   C +
Sbjct: 195 ASTSCCQQSSCQPACCTTSCCR-P--SSSVSLLCRPICRPACCV 235


>AJ406935-1|CAC27574.1|   98|Homo sapiens keratin associated protein
           4.3 protein.
          Length = 98

 Score = 37.9 bits (84), Expect = 0.030
 Identities = 29/81 (35%), Positives = 35/81 (43%), Gaps = 11/81 (13%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCC------PSSGILCCFAILCW--CCSNPASGSLH 409
           C   CC  SC  R + C S+ C  SCC      PS  I  C+   C    C  PA   + 
Sbjct: 3   CRPSCCISSCC-RPSCCISSCCKPSCCQTTCCRPSCCISSCYRPQCCQPSCCRPAC-CIS 60

Query: 410 SPC--SCCI-CCRLPIWSSTS 463
           S C  SCC+  CR P    T+
Sbjct: 61  SCCHPSCCVSSCRCPFSCPTT 81



 Score = 36.3 bits (80), Expect = 0.090
 Identities = 25/84 (29%), Positives = 32/84 (38%), Gaps = 5/84 (5%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCW--CCSNPA 394
           RPS      C   CC  +C  R + C S+     CC  S     CC +  C   CC +  
Sbjct: 14  RPSCCISSCCKPSCCQTTCC-RPSCCISSCYRPQCCQPSCCRPACCISSCCHPSCCVSSC 72

Query: 395 SGSLHSPCSCC-ICCRLPIWSSTS 463
                 P +CC   C  PI   +S
Sbjct: 73  RCPFSCPTTCCRTTCFHPICCGSS 96


>AJ296168-1|CAC27563.1|  106|Homo sapiens keratin associated protein
           protein.
          Length = 106

 Score = 37.9 bits (84), Expect = 0.030
 Identities = 24/74 (32%), Positives = 29/74 (39%), Gaps = 4/74 (5%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILC--WCC--SNPA 394
           RPS      C S+CC  +C      CC + C +SCC      CC    C   CC  S   
Sbjct: 42  RPSCCRPQCCQSVCCQPTC------CCPSYCVSSCCRPQ---CCQTTRCRTTCCRPSCCV 92

Query: 395 SGSLHSPCSCCICC 436
           S      C   +CC
Sbjct: 93  SRCYRPHCGQSLCC 106



 Score = 34.7 bits (76), Expect = 0.28
 Identities = 24/73 (32%), Positives = 30/73 (41%), Gaps = 5/73 (6%)
 Frame = +2

Query: 227 RPSLLP*PLCNSICCSYSCTL-RC--TFCCSNRC--GTSCCPSSGILCCFAILCWCCSNP 391
           RPS      C + CC  SC    C    CC + C   T CCPS  +  C    C C +  
Sbjct: 22  RPSYCQTTCCRTTCCRPSCCRPSCCRPQCCQSVCCQPTCCCPSYCVSSCCRPQC-CQTTR 80

Query: 392 ASGSLHSPCSCCI 430
              +   P SCC+
Sbjct: 81  CRTTCCRP-SCCV 92



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 22/70 (31%), Positives = 29/70 (41%), Gaps = 8/70 (11%)
 Frame = +2

Query: 254 CNSICCSYSCTL----RCTFCCSNRCGTSCCPSSGILCCFAILC--WCCSNPASGSLHSP 415
           C S+C    C L    R ++C +  C T+CC  S   CC    C   CC +         
Sbjct: 6   CGSVCSDQGCGLENCCRPSYCQTTCCRTTCCRPS---CCRPSCCRPQCCQSVCCQPTCCC 62

Query: 416 CSCCI--CCR 439
            S C+  CCR
Sbjct: 63  PSYCVSSCCR 72


>BC101152-1|AAI01153.1|  177|Homo sapiens KRTAP1-3 protein protein.
          Length = 177

 Score = 37.5 bits (83), Expect = 0.039
 Identities = 28/86 (32%), Positives = 32/86 (37%), Gaps = 4/86 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASG--SLHSPCS 421
           C    CS S T   + C  + C TSCC  S   CC    C   CC     G  S  +  +
Sbjct: 9   CGYPSCSTSGTCGSSCCQPSCCETSCCQPS---CCETSCCQPSCCQTSFCGFPSFSTSGT 65

Query: 422 CCICCRLPIWSSTSSTFPVWICTSVC 499
           C   C  P    TS   P    TS C
Sbjct: 66  CSSSCCQPSCCETSCCQPSCCQTSSC 91



 Score = 33.9 bits (74), Expect = 0.48
 Identities = 20/57 (35%), Positives = 25/57 (43%), Gaps = 7/57 (12%)
 Frame = +2

Query: 254 CNSICCSYSC--TLRC---TFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASGS 403
           C + CC  SC  T  C   +F  S  C +SCC  S   CC    C   CC   + G+
Sbjct: 40  CETSCCQPSCCQTSFCGFPSFSTSGTCSSSCCQPS---CCETSCCQPSCCQTSSCGT 93



 Score = 30.7 bits (66), Expect = 4.5
 Identities = 28/82 (34%), Positives = 31/82 (37%), Gaps = 4/82 (4%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASGSLHSPCSCC--IC 433
           CC  S     +   S  CG+SCC  S   CC    C   CC      S   P SCC    
Sbjct: 3   CCQTSFCGYPSCSTSGTCGSSCCQPS---CCETSCCQPSCCET----SCCQP-SCCQTSF 54

Query: 434 CRLPIWSSTSSTFPVWICTSVC 499
           C  P + STS T     C   C
Sbjct: 55  CGFPSF-STSGTCSSSCCQPSC 75



 Score = 29.9 bits (64), Expect = 7.8
 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 4/44 (9%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYSC--TLRCT-FCC-SNRCGTSCCPSSGI 349
           PS      C+S CC  SC  T  C   CC ++ CGT C    GI
Sbjct: 58  PSFSTSGTCSSSCCQPSCCETSCCQPSCCQTSSCGTGCGIGGGI 101


>AB081338-1|BAC15619.1|  177|Homo sapiens keratin associated protein
           1.8 protein.
          Length = 177

 Score = 37.5 bits (83), Expect = 0.039
 Identities = 28/86 (32%), Positives = 32/86 (37%), Gaps = 4/86 (4%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASG--SLHSPCS 421
           C    CS S T   + C  + C TSCC  S   CC    C   CC     G  S  +  +
Sbjct: 9   CGYPSCSTSGTCGSSCCQPSCCETSCCQPS---CCETSCCQPSCCQTSFCGFPSFSTSGT 65

Query: 422 CCICCRLPIWSSTSSTFPVWICTSVC 499
           C   C  P    TS   P    TS C
Sbjct: 66  CSSSCCQPSCCETSCCQPSCCQTSSC 91



 Score = 33.9 bits (74), Expect = 0.48
 Identities = 20/57 (35%), Positives = 25/57 (43%), Gaps = 7/57 (12%)
 Frame = +2

Query: 254 CNSICCSYSC--TLRC---TFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASGS 403
           C + CC  SC  T  C   +F  S  C +SCC  S   CC    C   CC   + G+
Sbjct: 40  CETSCCQPSCCQTSFCGFPSFSTSGTCSSSCCQPS---CCETSCCQPSCCQTSSCGT 93



 Score = 30.7 bits (66), Expect = 4.5
 Identities = 28/82 (34%), Positives = 31/82 (37%), Gaps = 4/82 (4%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASGSLHSPCSCC--IC 433
           CC  S     +   S  CG+SCC  S   CC    C   CC      S   P SCC    
Sbjct: 3   CCQTSFCGYPSCSTSGTCGSSCCQPS---CCETSCCQPSCCET----SCCQP-SCCQTSF 54

Query: 434 CRLPIWSSTSSTFPVWICTSVC 499
           C  P + STS T     C   C
Sbjct: 55  CGFPSF-STSGTCSSSCCQPSC 75



 Score = 29.9 bits (64), Expect = 7.8
 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 4/44 (9%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYSC--TLRCT-FCC-SNRCGTSCCPSSGI 349
           PS      C+S CC  SC  T  C   CC ++ CGT C    GI
Sbjct: 58  PSFSTSGTCSSSCCQPSCCETSCCQPSCCQTSSCGTGCGIGGGI 101


>BC131613-1|AAI31614.1|  292|Homo sapiens keratin associated protein
           10-9 protein.
          Length = 292

 Score = 37.1 bits (82), Expect = 0.052
 Identities = 26/89 (29%), Positives = 33/89 (37%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPC- 418
           C  +CC   C    + C  +    +CC SS     CC  + C   CC+   S   +S C 
Sbjct: 105 CKPVCCVPVCCGASSCCQQSSYQPACCASSSCQPACCVPVCCKPVCCAPTCSEDSYSCCQ 164

Query: 419 --SCCICCRLPIWSSTSSTFPVWICTSVC 499
             SC   C        S   PV  C  VC
Sbjct: 165 QSSCQPACCTSSPCQQSCCVPV-CCKPVC 192



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 25/77 (32%), Positives = 32/77 (41%), Gaps = 13/77 (16%)
 Frame = +2

Query: 248 PLCNSICCSYS-C-TLRCTF-------CCSNRCGTSCCPSSGILCCFAILCWCCSNPASG 400
           P C + CC+ + C TL CT        CC   C  S C S     C    C   S   + 
Sbjct: 30  PCCATSCCAPAPCLTLVCTPVSRVSSPCCQVTCEPSPCQSGCTSSCTPSCCQQSSCQPAY 89

Query: 401 SLHSPC--SCC--ICCR 439
              SPC  +CC  +CC+
Sbjct: 90  CTSSPCQQACCVPVCCK 106



 Score = 31.1 bits (67), Expect = 3.4
 Identities = 24/82 (29%), Positives = 30/82 (36%), Gaps = 10/82 (12%)
 Frame = +2

Query: 254 CNSICCSYSCTLR--CT-FCCSNRCGTSCCPSSGILCCFAILCW-------CCSNPASGS 403
           C S  C  SC +   C   CC   C    C  +  LCC    C        CC   +S S
Sbjct: 173 CTSSPCQQSCCVPVCCKPVCCKPICCVPVCSGASSLCCQQSGCQPACCTTSCCRPSSSVS 232

Query: 404 LHSPCSCCICCRLPIWSSTSST 469
           L     C   C +P+ S  + T
Sbjct: 233 LLCRPVCRPACCVPVSSCCAPT 254


>AK022609-1|BAB14128.1|  307|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12547 fis, clone NT2RM4000634. ).
          Length = 307

 Score = 37.1 bits (82), Expect = 0.052
 Identities = 22/86 (25%), Positives = 32/86 (37%), Gaps = 3/86 (3%)
 Frame = +2

Query: 251 LCNSIC---CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS 421
           LC   C   C++ C   C + C+  C  +C      +C  A +C C        L     
Sbjct: 143 LCVCACVWGCTFVCVCACVWGCTFVCVCACVCGCTFVCVCACVCGCTF--VCVCLCVWVH 200

Query: 422 CCICCRLPIWSSTSSTFPVWICTSVC 499
            C+C  L +W        VW+   VC
Sbjct: 201 ICVCVCLCVWVHICVCACVWVHICVC 226



 Score = 35.9 bits (79), Expect = 0.12
 Identities = 31/88 (35%), Positives = 35/88 (39%), Gaps = 5/88 (5%)
 Frame = +2

Query: 251 LCNSI-CCSYSCTLRCTFCCSNRCGTSCCPSSGILC-CFAILCWCCSNPASGSLHSPCSC 424
           LC  +  C  +C   CTF C   C   C    G LC C A LC C        L   C C
Sbjct: 92  LCVGVHICVCACVCGCTFVCV--CACVC----GCLCVCGAHLCVCVCLCVGAHL---CVC 142

Query: 425 -CICCRLPIWSST--SSTFPVWICTSVC 499
            C+C    +W  T       VW CT VC
Sbjct: 143 LCVCA--CVWGCTFVCVCACVWGCTFVC 168


>AB076356-1|BAD01543.1|  292|Homo sapiens keratin associated protein
           protein.
          Length = 292

 Score = 37.1 bits (82), Expect = 0.052
 Identities = 26/89 (29%), Positives = 33/89 (37%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILC--WCCSNPASGSLHSPC- 418
           C  +CC   C    + C  +    +CC SS     CC  + C   CC+   S   +S C 
Sbjct: 105 CKPVCCVPVCCGASSCCQQSSYQPACCASSSCQPACCVPVCCKPVCCAPTCSEDSYSCCQ 164

Query: 419 --SCCICCRLPIWSSTSSTFPVWICTSVC 499
             SC   C        S   PV  C  VC
Sbjct: 165 QSSCQPACCTSSPCQQSCCVPV-CCKPVC 192



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 25/77 (32%), Positives = 32/77 (41%), Gaps = 13/77 (16%)
 Frame = +2

Query: 248 PLCNSICCSYS-C-TLRCTF-------CCSNRCGTSCCPSSGILCCFAILCWCCSNPASG 400
           P C + CC+ + C TL CT        CC   C  S C S     C    C   S   + 
Sbjct: 30  PCCATSCCAPAPCLTLVCTPVSRVSSPCCQVTCEPSPCQSGCTSSCTPSCCQQSSCQPAY 89

Query: 401 SLHSPC--SCC--ICCR 439
              SPC  +CC  +CC+
Sbjct: 90  CTSSPCQQACCVPVCCK 106



 Score = 31.1 bits (67), Expect = 3.4
 Identities = 24/82 (29%), Positives = 30/82 (36%), Gaps = 10/82 (12%)
 Frame = +2

Query: 254 CNSICCSYSCTLR--CT-FCCSNRCGTSCCPSSGILCCFAILCW-------CCSNPASGS 403
           C S  C  SC +   C   CC   C    C  +  LCC    C        CC   +S S
Sbjct: 173 CTSSPCQQSCCVPVCCKPVCCKPICCVPVCSGASSLCCQQSGCQPACCTTSCCRPSSSVS 232

Query: 404 LHSPCSCCICCRLPIWSSTSST 469
           L     C   C +P+ S  + T
Sbjct: 233 LLCRPVCRPACCVPVSSCCAPT 254


>BC069297-1|AAH69297.1|  105|Homo sapiens keratin associated protein
           17-1 protein.
          Length = 105

 Score = 36.3 bits (80), Expect = 0.090
 Identities = 23/71 (32%), Positives = 25/71 (35%), Gaps = 10/71 (14%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS--------NRCGTSCCPSSGILCCFAIL--CWCCSNPASGS 403
           C   CC   C   C  CC         + CG SCC SS   CC +    C  C     G 
Sbjct: 19  CEECCCQPGCCGCCGSCCGCGGSGCGGSGCGGSCCGSS---CCGSGCGGCGGCGGCGGGC 75

Query: 404 LHSPCSCCICC 436
             S C    CC
Sbjct: 76  CGSSCCGSSCC 86



 Score = 31.1 bits (67), Expect = 3.4
 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 2/59 (3%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC--ICC 436
           CC   C   CT      C   CC   G   C    C C  +   GS     SCC   CC
Sbjct: 3   CCPGDCFTCCTQ--EQNCCEECCCQPGCCGCCGSCCGCGGSGCGGS-GCGGSCCGSSCC 58


>BC069078-1|AAH69078.1|  105|Homo sapiens keratin associated protein
           17-1 protein.
          Length = 105

 Score = 36.3 bits (80), Expect = 0.090
 Identities = 23/71 (32%), Positives = 25/71 (35%), Gaps = 10/71 (14%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS--------NRCGTSCCPSSGILCCFAIL--CWCCSNPASGS 403
           C   CC   C   C  CC         + CG SCC SS   CC +    C  C     G 
Sbjct: 19  CEECCCQPGCCGCCGSCCGCGGSGCGGSGCGGSCCGSS---CCGSGCGGCGGCGGCGGGC 75

Query: 404 LHSPCSCCICC 436
             S C    CC
Sbjct: 76  CGSSCCGSSCC 86



 Score = 31.1 bits (67), Expect = 3.4
 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 2/59 (3%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC--ICC 436
           CC   C   CT      C   CC   G   C    C C  +   GS     SCC   CC
Sbjct: 3   CCPGDCFTCCTQ--EQNCCEECCCQPGCCGCCGSCCGCGGSGCGGS-GCGGSCCGSSCC 58


>AJ406952-1|CAC27591.1|  105|Homo sapiens keratin associated protein
           16.1 protein.
          Length = 105

 Score = 36.3 bits (80), Expect = 0.090
 Identities = 23/71 (32%), Positives = 25/71 (35%), Gaps = 10/71 (14%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS--------NRCGTSCCPSSGILCCFAIL--CWCCSNPASGS 403
           C   CC   C   C  CC         + CG SCC SS   CC +    C  C     G 
Sbjct: 19  CEECCCQPGCCGCCGSCCGCGGSGCGGSGCGGSCCGSS---CCGSGCGGCGGCGGCGGGC 75

Query: 404 LHSPCSCCICC 436
             S C    CC
Sbjct: 76  CGSSCCGSSCC 86



 Score = 31.1 bits (67), Expect = 3.4
 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 2/59 (3%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC--ICC 436
           CC   C   CT      C   CC   G   C    C C  +   GS     SCC   CC
Sbjct: 3   CCPGDCFTCCTQ--EQNCCEECCCQPGCCGCCGSCCGCGGSGCGGS-GCGGSCCGSSCC 58


>AB076350-1|BAD01537.1|  221|Homo sapiens keratin associated protein
           protein.
          Length = 221

 Score = 36.3 bits (80), Expect = 0.090
 Identities = 27/95 (28%), Positives = 36/95 (37%), Gaps = 8/95 (8%)
 Frame = +2

Query: 242 P*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC- 418
           P P    +C   SC    + CC   C  S C S     C    C   S   +    SPC 
Sbjct: 39  PAPCLTLVCTPVSCV--SSPCCQAACEPSPCQSGCTSSCTPSCCQQSSCQPACCTSSPCQ 96

Query: 419 -SCC--ICCR----LPIWSSTSSTFPVWICTSVCS 502
            +CC  +CC+    +P+        P+  C  VCS
Sbjct: 97  QACCVPVCCKPVCCVPVCCKPVCCKPI-CCVPVCS 130



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 26/70 (37%), Positives = 34/70 (48%), Gaps = 12/70 (17%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCC--SNR----CGTSCC-PSSGI-LCCFAIL--CWCCSNPASGS 403
           C  ICC   C+   + CC  S+R    C TSCC PSS + L C  +    +C   P+  +
Sbjct: 120 CKPICCVPVCSGASSSCCQQSSRQPACCTTSCCRPSSSVSLLCRPVCRSTYCVPIPSCCA 179

Query: 404 LHSPC--SCC 427
             S C  SCC
Sbjct: 180 PASTCQPSCC 189


>U80742-1|AAB91440.1|  652|Homo sapiens CAGH45 protein.
          Length = 652

 Score = 35.9 bits (79), Expect = 0.12
 Identities = 17/63 (26%), Positives = 36/63 (57%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + ++     +Q Q+ + +Q +  +L QQ+     +QQ+ Q++ Q  +QQ +
Sbjct: 530 QQQQQQQQQQQQQQQQQQQQQQYHIRQQQQQQILRQQQQQQQQQQQQQQQQQQQQQQQQQ 589

Query: 258 LHR 250
            H+
Sbjct: 590 QHQ 592


>D83783-1|BAA12112.1| 2124|Homo sapiens KIAA0192 protein.
          Length = 2124

 Score = 35.9 bits (79), Expect = 0.12
 Identities = 17/63 (26%), Positives = 36/63 (57%)
 Frame = -1

Query: 438  RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
            +Q  QQ+Q + ++     +Q Q+ + +Q +  +L QQ+     +QQ+ Q++ Q  +QQ +
Sbjct: 2002 QQQQQQQQQQQQQQQQQQQQQQYHIRQQQQQQILRQQQQQQQQQQQQQQQQQQQQQQQQQ 2061

Query: 258  LHR 250
             H+
Sbjct: 2062 QHQ 2064


>AL353779-1|CAI20975.1|  250|Homo sapiens chromosome 1 open reading
           frame 68 protein.
          Length = 250

 Score = 35.9 bits (79), Expect = 0.12
 Identities = 22/57 (38%), Positives = 25/57 (43%), Gaps = 1/57 (1%)
 Frame = +2

Query: 257 NSICCSYSCTLRCTFCCSNRCGTSC-CPSSGILCCFAILCWCCSNPASGSLHSPCSC 424
           +S CC  S +  C  C S  CG SC C SSG  CC  I+      PA       C C
Sbjct: 197 SSGCCENSGSSGC--CGSGGCGCSCGCGSSG-CCCLGIIPMRSRGPACCDHEDDCCC 250


>AF132033-1|AAD44162.1| 2023|Homo sapiens OPA-containing protein
            protein.
          Length = 2023

 Score = 35.9 bits (79), Expect = 0.12
 Identities = 17/63 (26%), Positives = 36/63 (57%)
 Frame = -1

Query: 438  RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
            +Q  QQ+Q + ++     +Q Q+ + +Q +  +L QQ+     +QQ+ Q++ Q  +QQ +
Sbjct: 1901 QQQQQQQQQQQQQQQQQQQQQQYHIRQQQQQQILRQQQQQQQQQQQQQQQQQQQQQQQQQ 1960

Query: 258  LHR 250
             H+
Sbjct: 1961 QHQ 1963


>AF117755-1|AAD22033.1| 2212|Homo sapiens thyroid hormone
            receptor-associated protein complex component TRAP230
            protein.
          Length = 2212

 Score = 35.9 bits (79), Expect = 0.12
 Identities = 17/63 (26%), Positives = 36/63 (57%)
 Frame = -1

Query: 438  RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
            +Q  QQ+Q + ++     +Q Q+ + +Q +  +L QQ+     +QQ+ Q++ Q  +QQ +
Sbjct: 2090 QQQQQQQQQQQQQQQQQQQQQQYHIRQQQQQQILRQQQQQQQQQQQQQQQQQQQQQQQQQ 2149

Query: 258  LHR 250
             H+
Sbjct: 2150 QHQ 2152


>AF071309-1|AAC83163.1| 2023|Homo sapiens OPA-containing protein
            protein.
          Length = 2023

 Score = 35.9 bits (79), Expect = 0.12
 Identities = 17/63 (26%), Positives = 36/63 (57%)
 Frame = -1

Query: 438  RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
            +Q  QQ+Q + ++     +Q Q+ + +Q +  +L QQ+     +QQ+ Q++ Q  +QQ +
Sbjct: 1901 QQQQQQQQQQQQQQQQQQQQQQYHIRQQQQQQILRQQQQQQQQQQQQQQQQQQQQQQQQQ 1960

Query: 258  LHR 250
             H+
Sbjct: 1961 QHQ 1963


>AB102668-1|BAC81137.1| 2027|Homo sapiens TNRC11 protein.
          Length = 2027

 Score = 35.9 bits (79), Expect = 0.12
 Identities = 17/63 (26%), Positives = 36/63 (57%)
 Frame = -1

Query: 438  RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
            +Q  QQ+Q + ++     +Q Q+ + +Q +  +L QQ+     +QQ+ Q++ Q  +QQ +
Sbjct: 1905 QQQQQQQQQQQQQQQQQQQQQQYHIRQQQQQQILRQQQQQQQQQQQQQQQQQQQQQQQQQ 1964

Query: 258  LHR 250
             H+
Sbjct: 1965 QHQ 1967


>AB065580-1|BAC05810.1|  346|Homo sapiens seven transmembrane helix
           receptor protein.
          Length = 346

 Score = 35.9 bits (79), Expect = 0.12
 Identities = 24/89 (26%), Positives = 36/89 (40%), Gaps = 7/89 (7%)
 Frame = +2

Query: 251 LCNSIC-----CSYSCTLRCT--FCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLH 409
           +C S+C     C Y C   C   +   + C       S  LC +  +C C S     S+ 
Sbjct: 77  VCVSVCVYVSVCMYLCVFLCVCVYVSVSVCLCVYLHISVYLCVYVCICVCVSVSLCVSVC 136

Query: 410 SPCSCCICCRLPIWSSTSSTFPVWICTSV 496
           +  S C+C R+ +  S      V +C SV
Sbjct: 137 ACLSLCVCIRVSVCLSLRVCVCVCLCVSV 165



 Score = 30.7 bits (66), Expect = 4.5
 Identities = 22/86 (25%), Positives = 34/86 (39%), Gaps = 7/86 (8%)
 Frame = +2

Query: 260 SICCS-YSCTLRCTFCCSNRCGTSC-----CPSSGILCCFAI-LCWCCSNPASGSLHSPC 418
           S+C   Y C   C   C   C + C     C S  +  C  + +C C S   S S+    
Sbjct: 14  SVCLYLYVCVCICVSVCVCICVSVCVCICVCVSVFVCVCICVCVCVCVSMCVSISVCVYL 73

Query: 419 SCCICCRLPIWSSTSSTFPVWICTSV 496
             C+C  + ++ S      V++C  V
Sbjct: 74  CLCVCVSVCVYVSVCMYLCVFLCVCV 99


>BC133677-1|AAI33678.1|  194|Homo sapiens KRTAP10-3 protein protein.
          Length = 194

 Score = 35.5 bits (78), Expect = 0.16
 Identities = 31/102 (30%), Positives = 40/102 (39%), Gaps = 17/102 (16%)
 Frame = +2

Query: 248 PLCNSICCSYS-C-TLRCTF-------CCSNRCGTSCCPSSGILCCFAILCWCCSNPASG 400
           P C   CC+ + C TL CT        CC   C  S C S     C    C   S   + 
Sbjct: 30  PCCAPSCCALAPCLTLVCTPVSCVSSPCCQAACEPSPCQSGCTSSCTPSCCQQSSCQPAC 89

Query: 401 SLHSPC--SCC--ICCR----LPIWSSTSSTFPVWICTSVCS 502
              SPC  +CC  +CC+    +P+        P+  C  VCS
Sbjct: 90  CTSSPCQQACCVPVCCKPVCCVPVCCKPVCCKPI-CCVPVCS 130



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 26/68 (38%), Positives = 32/68 (47%), Gaps = 13/68 (19%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCC--SNR----CGTSCC-PSSGI--LC----CFAILCWCCSNPA 394
           C  ICC   C+   + CC  S+R    C TSCC PSS +  LC    C ++LC     P 
Sbjct: 120 CKPICCVPVCSGASSSCCQQSSRQPACCTTSCCRPSSSVSLLCRPASCVSLLC----RPT 175

Query: 395 SGSLHSPC 418
              L S C
Sbjct: 176 CSRLSSAC 183



 Score = 31.1 bits (67), Expect = 3.4
 Identities = 27/75 (36%), Positives = 31/75 (41%), Gaps = 4/75 (5%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSG--ILCCFAILCWCCSNPASGS-LHSPCSC 424
           C  +CC   C   C   CS    +SCC  S     CC      CC   +S S L  P SC
Sbjct: 115 CKPVCCKPIC---CVPVCSG-ASSSCCQQSSRQPACCTTS---CCRPSSSVSLLCRPASC 167

Query: 425 -CICCRLPIWSSTSS 466
             + CR P  S  SS
Sbjct: 168 VSLLCR-PTCSRLSS 181


>BC127772-1|AAI27773.1|  863|Homo sapiens KIF5C protein protein.
          Length = 863

 Score = 35.5 bits (78), Expect = 0.16
 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 2/85 (2%)
 Frame = -1

Query: 498 QTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQ--E 325
           Q L+  H   +  + D+M   Q+M+Q++ +  E    L +    +  Q +M  +  Q  E
Sbjct: 536 QLLISQHEAKIKSLTDYM---QNMEQKRRQLEESQDSLSEELAKLRAQEKMHEVSFQDKE 592

Query: 324 VPHLLEQQKVQRRVQL*EQQMELHR 250
             HL   Q  +   +  EQQME HR
Sbjct: 593 KEHLTRLQDAEEMKKALEQQMESHR 617


>BC110287-1|AAI10288.1|  725|Homo sapiens KIF5C protein protein.
          Length = 725

 Score = 35.5 bits (78), Expect = 0.16
 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 2/85 (2%)
 Frame = -1

Query: 498 QTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQ--E 325
           Q L+  H   +  + D+M   Q+M+Q++ +  E    L +    +  Q +M  +  Q  E
Sbjct: 398 QLLISQHEAKIKSLTDYM---QNMEQKRRQLEESQDSLSEELAKLRAQEKMHEVSFQDKE 454

Query: 324 VPHLLEQQKVQRRVQL*EQQMELHR 250
             HL   Q  +   +  EQQME HR
Sbjct: 455 KEHLTRLQDAEEMKKALEQQMESHR 479


>AJ628243-1|CAF31636.1|   38|Homo sapiens keratin associated protein
           5-3 protein.
          Length = 38

 Score = 35.5 bits (78), Expect = 0.16
 Identities = 20/49 (40%), Positives = 24/49 (48%)
 Frame = +2

Query: 302 CCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCICCRLPI 448
           CCS+ CG+SCC SS   CC      CCS        S C   +CC+  I
Sbjct: 4   CCSSGCGSSCCQSS---CCNP----CCS-------QSSCCVPVCCQCKI 38


>AC108512-1|AAX82030.1|  684|Homo sapiens unknown protein.
          Length = 684

 Score = 35.5 bits (78), Expect = 0.16
 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 2/85 (2%)
 Frame = -1

Query: 498 QTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQ--E 325
           Q L+  H   +  + D+M   Q+M+Q++ +  E    L +    +  Q +M  +  Q  E
Sbjct: 357 QLLISQHEAKIKSLTDYM---QNMEQKRRQLEESQDSLSEELAKLRAQEKMHEVSFQDKE 413

Query: 324 VPHLLEQQKVQRRVQL*EQQMELHR 250
             HL   Q  +   +  EQQME HR
Sbjct: 414 KEHLTRLQDAEEMKKALEQQMESHR 438


>AB011103-1|BAA25457.2|  999|Homo sapiens KIAA0531 protein protein.
          Length = 999

 Score = 35.5 bits (78), Expect = 0.16
 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 2/85 (2%)
 Frame = -1

Query: 498 QTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQ--E 325
           Q L+  H   +  + D+M   Q+M+Q++ +  E    L +    +  Q +M  +  Q  E
Sbjct: 672 QLLISQHEAKIKSLTDYM---QNMEQKRRQLEESQDSLSEELAKLRAQEKMHEVSFQDKE 728

Query: 324 VPHLLEQQKVQRRVQL*EQQMELHR 250
             HL   Q  +   +  EQQME HR
Sbjct: 729 KEHLTRLQDAEEMKKALEQQMESHR 753


>Y08267-1|CAA69593.1|  238|Homo sapiens AAD10 protein.
          Length = 238

 Score = 35.1 bits (77), Expect = 0.21
 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 3/64 (4%)
 Frame = -1

Query: 441 SRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQ---EVPHLLEQQKVQRRVQL*E 271
           ++Q  QQ+Q + +  +AGL   Q S+      P L  Q    +  L +QQ++Q++ QL +
Sbjct: 167 AQQQQQQQQHQQQGSMAGLSHLQQSLMSHSGQPKLSAQPMGSLQQLQQQQQLQQQQQLQQ 226

Query: 270 QQME 259
           QQ +
Sbjct: 227 QQQQ 230


>AJ566387-1|CAD97467.1|  251|Homo sapiens keratin associated protein
           KAP10.10 protein.
          Length = 251

 Score = 34.7 bits (76), Expect = 0.28
 Identities = 25/83 (30%), Positives = 35/83 (42%), Gaps = 3/83 (3%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCC-PSSGILCCFAILCWCCSNPASGSLHSPCSCCI--CC 436
           CC  S + + T C S+ C  +CC P      C+  +C   S           +CC   CC
Sbjct: 126 CCQQS-SCQPTCCTSSPCQQACCVPVCSKSVCYVPVCSGASTSCCQQSSCQPACCTASCC 184

Query: 437 RLPIWSSTSSTFPVWICTSVCSI 505
           R P  SS+ S     +C S C +
Sbjct: 185 R-P--SSSVSLLCHPVCKSTCCV 204



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 1/61 (1%)
 Frame = +2

Query: 233 SLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW-CCSNPASGSLH 409
           SLL  P+C S CC     +      ++ C  SCC ++    C ++LC   CS PA  SL 
Sbjct: 191 SLLCHPVCKSTCC---VPVPSCGASASSCQPSCCRTAS---CVSLLCRPVCSRPACYSLC 244

Query: 410 S 412
           S
Sbjct: 245 S 245



 Score = 29.9 bits (64), Expect = 7.8
 Identities = 20/69 (28%), Positives = 24/69 (34%), Gaps = 4/69 (5%)
 Frame = +2

Query: 242 P*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC- 418
           P P    +C   SC    + CC   C  S C S     C        S        SPC 
Sbjct: 34  PAPSLTLVCTPVSCV--SSPCCQTACEPSACQSGYTSSCTTPCYQQSSCQPDCCTSSPCQ 91

Query: 419 -SCC--ICC 436
            +CC  +CC
Sbjct: 92  QACCVPVCC 100


>AB076358-1|BAD01545.1|  251|Homo sapiens keratin associated protein
           protein.
          Length = 251

 Score = 34.7 bits (76), Expect = 0.28
 Identities = 25/83 (30%), Positives = 35/83 (42%), Gaps = 3/83 (3%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCC-PSSGILCCFAILCWCCSNPASGSLHSPCSCCI--CC 436
           CC  S + + T C S+ C  +CC P      C+  +C   S           +CC   CC
Sbjct: 126 CCQQS-SCQPTCCTSSPCQQACCVPVCSKSVCYVPVCSGASTSCCQQSSCQPACCTASCC 184

Query: 437 RLPIWSSTSSTFPVWICTSVCSI 505
           R P  SS+ S     +C S C +
Sbjct: 185 R-P--SSSVSLLCHPVCKSTCCV 204



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 1/61 (1%)
 Frame = +2

Query: 233 SLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW-CCSNPASGSLH 409
           SLL  P+C S CC     +      ++ C  SCC ++    C ++LC   CS PA  SL 
Sbjct: 191 SLLCHPVCKSTCC---VPVPSCGASASSCQPSCCRTAS---CVSLLCRPVCSRPACYSLC 244

Query: 410 S 412
           S
Sbjct: 245 S 245



 Score = 29.9 bits (64), Expect = 7.8
 Identities = 20/69 (28%), Positives = 24/69 (34%), Gaps = 4/69 (5%)
 Frame = +2

Query: 242 P*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC- 418
           P P    +C   SC    + CC   C  S C S     C        S        SPC 
Sbjct: 34  PAPSLTLVCTPVSCV--SSPCCQTACEPSACQSGYTSSCTTPCYQQSSCQPDCCTSSPCQ 91

Query: 419 -SCC--ICC 436
            +CC  +CC
Sbjct: 92  QACCVPVCC 100


>X63337-1|CAA44937.1|  177|Homo sapiens high sulfur keratin protein.
          Length = 177

 Score = 34.3 bits (75), Expect = 0.36
 Identities = 28/89 (31%), Positives = 35/89 (39%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCW--CCSNPASG--SLHS 412
           C +  C + SC+   T C S+ C  SCC +S     CC    C   CC     G  S  +
Sbjct: 4   CQTSFCGFPSCSTSGT-CGSSCCQPSCCETSSCQPRCCETSCCQPSCCQTSFCGFPSFST 62

Query: 413 PCSCCICCRLPIWSSTSSTFPVWICTSVC 499
             +C   C  P    TS   P    TS C
Sbjct: 63  GGTCDSSCCQPSCCETSCCQPSCYQTSSC 91



 Score = 33.9 bits (74), Expect = 0.48
 Identities = 19/49 (38%), Positives = 21/49 (42%), Gaps = 3/49 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS-NRCGTSCCPSS--GILCCFAILCWCCSNP 391
           C   CC  SCT     CC  +    SCC  S  G  CC  + C  CS P
Sbjct: 129 CLPPCCVVSCTPPS--CCQLHHAEASCCRPSYCGQSCCRPVCCCYCSEP 175


>BC105071-1|AAI05072.1|  177|Homo sapiens keratin associated protein
           1-1 protein.
          Length = 177

 Score = 34.3 bits (75), Expect = 0.36
 Identities = 28/89 (31%), Positives = 35/89 (39%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCW--CCSNPASG--SLHS 412
           C +  C + SC+   T C S+ C  SCC +S     CC    C   CC     G  S  +
Sbjct: 4   CQTSFCGFPSCSTSGT-CGSSCCQPSCCETSSCQPRCCETSCCQPSCCQTSFCGFPSFST 62

Query: 413 PCSCCICCRLPIWSSTSSTFPVWICTSVC 499
             +C   C  P    TS   P    TS C
Sbjct: 63  GGTCDSSCCQPSCCETSCCQPSCYQTSSC 91



 Score = 33.9 bits (74), Expect = 0.48
 Identities = 19/49 (38%), Positives = 21/49 (42%), Gaps = 3/49 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS-NRCGTSCCPSS--GILCCFAILCWCCSNP 391
           C   CC  SCT     CC  +    SCC  S  G  CC  + C  CS P
Sbjct: 129 CLPPCCVVSCTPPS--CCQLHHAEASCCRPSYCGQSCCRPVCCCYCSEP 175


>BC105069-1|AAI05070.1|  177|Homo sapiens keratin associated protein
           1-1 protein.
          Length = 177

 Score = 34.3 bits (75), Expect = 0.36
 Identities = 28/89 (31%), Positives = 35/89 (39%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCW--CCSNPASG--SLHS 412
           C +  C + SC+   T C S+ C  SCC +S     CC    C   CC     G  S  +
Sbjct: 4   CQTSFCGFPSCSTSGT-CGSSCCQPSCCETSSCQPRCCETSCCQPSCCQTSFCGFPSFST 62

Query: 413 PCSCCICCRLPIWSSTSSTFPVWICTSVC 499
             +C   C  P    TS   P    TS C
Sbjct: 63  GGTCDSSCCQPSCCETSCCQPSCYQTSSC 91



 Score = 33.9 bits (74), Expect = 0.48
 Identities = 19/49 (38%), Positives = 21/49 (42%), Gaps = 3/49 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS-NRCGTSCCPSS--GILCCFAILCWCCSNP 391
           C   CC  SCT     CC  +    SCC  S  G  CC  + C  CS P
Sbjct: 129 CLPPCCVVSCTPPS--CCQLHHAEASCCRPSYCGQSCCRPVCCCYCSEP 175


>BC101555-1|AAI01556.1|  174|Homo sapiens keratin associated protein
           1.5 protein.
          Length = 174

 Score = 34.3 bits (75), Expect = 0.36
 Identities = 26/82 (31%), Positives = 30/82 (36%), Gaps = 4/82 (4%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASG--SLHSPCSCCIC 433
           CC  S     +F  S  CG+SCC  S   CC    C    C     G  S  +  +C   
Sbjct: 3   CCQTSFCGYPSFSISGTCGSSCCQPS---CCETSCCQPRSCQTSFCGFPSFSTSGTCSSS 59

Query: 434 CRLPIWSSTSSTFPVWICTSVC 499
           C  P    TS   P    TS C
Sbjct: 60  CCQPSCCETSCCQPSCCETSCC 81



 Score = 33.1 bits (72), Expect = 0.84
 Identities = 20/49 (40%), Positives = 22/49 (44%), Gaps = 1/49 (2%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYSCTLRCTFCCS-NRCGTSCCPSSGILCCFAILC 373
           PS      C+S CC  SC    T CC  + C TSCC  S   CC    C
Sbjct: 48  PSFSTSGTCSSSCCQPSCCE--TSCCQPSCCETSCCQPS---CCQISSC 91



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 28/89 (31%), Positives = 33/89 (37%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCWCCSNPASGSLHSPC--- 418
           C +  C Y        C S+ C  SCC +S      C    C   S   SG+  S C   
Sbjct: 4   CQTSFCGYPSFSISGTCGSSCCQPSCCETSCCQPRSCQTSFCGFPSFSTSGTCSSSCCQP 63

Query: 419 SCC--ICCRLPIWSSTSSTFPVWICTSVC 499
           SCC   CC+ P    TS   P     S C
Sbjct: 64  SCCETSCCQ-PSCCETSCCQPSCCQISSC 91


>BC093841-1|AAH93841.1|  174|Homo sapiens keratin associated protein
           1-5 protein.
          Length = 174

 Score = 34.3 bits (75), Expect = 0.36
 Identities = 26/82 (31%), Positives = 30/82 (36%), Gaps = 4/82 (4%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASG--SLHSPCSCCIC 433
           CC  S     +F  S  CG+SCC  S   CC    C    C     G  S  +  +C   
Sbjct: 3   CCQTSFCGYPSFSISGTCGSSCCQPS---CCETSCCQPRSCQTSFCGFPSFSTSGTCSSS 59

Query: 434 CRLPIWSSTSSTFPVWICTSVC 499
           C  P    TS   P    TS C
Sbjct: 60  CCQPSCCETSCCQPSCCETSCC 81



 Score = 33.1 bits (72), Expect = 0.84
 Identities = 20/49 (40%), Positives = 22/49 (44%), Gaps = 1/49 (2%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYSCTLRCTFCCS-NRCGTSCCPSSGILCCFAILC 373
           PS      C+S CC  SC    T CC  + C TSCC  S   CC    C
Sbjct: 48  PSFSTSGTCSSSCCQPSCCE--TSCCQPSCCETSCCQPS---CCQISSC 91



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 28/89 (31%), Positives = 33/89 (37%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCWCCSNPASGSLHSPC--- 418
           C +  C Y        C S+ C  SCC +S      C    C   S   SG+  S C   
Sbjct: 4   CQTSFCGYPSFSISGTCGSSCCQPSCCETSCCQPRSCQTSFCGFPSFSTSGTCSSSCCQP 63

Query: 419 SCC--ICCRLPIWSSTSSTFPVWICTSVC 499
           SCC   CC+ P    TS   P     S C
Sbjct: 64  SCCETSCCQ-PSCCETSCCQPSCCQISSC 91


>BC069533-1|AAH69533.1|  174|Homo sapiens keratin associated protein
           1-5 protein.
          Length = 174

 Score = 34.3 bits (75), Expect = 0.36
 Identities = 26/82 (31%), Positives = 30/82 (36%), Gaps = 4/82 (4%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASG--SLHSPCSCCIC 433
           CC  S     +F  S  CG+SCC  S   CC    C    C     G  S  +  +C   
Sbjct: 3   CCQTSFCGYPSFSISGTCGSSCCQPS---CCETSCCQPRSCQTSFCGFPSFSTSGTCSSS 59

Query: 434 CRLPIWSSTSSTFPVWICTSVC 499
           C  P    TS   P    TS C
Sbjct: 60  CCQPSCCETSCCQPSCCETSCC 81



 Score = 33.1 bits (72), Expect = 0.84
 Identities = 20/49 (40%), Positives = 22/49 (44%), Gaps = 1/49 (2%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYSCTLRCTFCCS-NRCGTSCCPSSGILCCFAILC 373
           PS      C+S CC  SC    T CC  + C TSCC  S   CC    C
Sbjct: 48  PSFSTSGTCSSSCCQPSCCE--TSCCQPSCCETSCCQPS---CCQISSC 91



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 28/89 (31%), Positives = 33/89 (37%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCWCCSNPASGSLHSPC--- 418
           C +  C Y        C S+ C  SCC +S      C    C   S   SG+  S C   
Sbjct: 4   CQTSFCGYPSFSISGTCGSSCCQPSCCETSCCQPRSCQTSFCGFPSFSTSGTCSSSCCQP 63

Query: 419 SCC--ICCRLPIWSSTSSTFPVWICTSVC 499
           SCC   CC+ P    TS   P     S C
Sbjct: 64  SCCETSCCQ-PSCCETSCCQPSCCQISSC 91


>AL353779-5|CAI20979.1|  118|Homo sapiens late cornified envelope 1F
           protein.
          Length = 118

 Score = 34.3 bits (75), Expect = 0.36
 Identities = 22/73 (30%), Positives = 29/73 (39%), Gaps = 3/73 (4%)
 Frame = +2

Query: 221 QHRPSLLP*PLCNSICCSYSCTLRCTFCCSNRCG--TSCCPSSGILCCFAILCWCCSNPA 394
           Q +    P P C   C     T +C   C  +C   +SCC  S   CC +    CCS+  
Sbjct: 5   QSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGCCSSGG 64

Query: 395 SGSLHS-PCSCCI 430
            G   S    CC+
Sbjct: 65  GGCCSSGGGGCCL 77


>AL139247-6|CAI21684.1|  110|Homo sapiens late cornified envelope 2B
           protein.
          Length = 110

 Score = 34.3 bits (75), Expect = 0.36
 Identities = 21/76 (27%), Positives = 29/76 (38%), Gaps = 1/76 (1%)
 Frame = +2

Query: 221 QHRPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASG 400
           Q++    P P C   C    C  +C   C  +C   C P+    CC  I   CC   + G
Sbjct: 5   QNQQQCQPPPKCPPKCTP-KCPPKCPPKCLPQCPAPCSPAVSS-CCGPISGGCCGPSSGG 62

Query: 401 SLHSPC-SCCICCRLP 445
             +S    CC+    P
Sbjct: 63  CCNSGAGGCCLSHHRP 78


>AJ406928-1|CAC27567.1|  174|Homo sapiens keratin associated protein
           1.5 protein.
          Length = 174

 Score = 34.3 bits (75), Expect = 0.36
 Identities = 26/82 (31%), Positives = 30/82 (36%), Gaps = 4/82 (4%)
 Frame = +2

Query: 266 CCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASG--SLHSPCSCCIC 433
           CC  S     +F  S  CG+SCC  S   CC    C    C     G  S  +  +C   
Sbjct: 3   CCQTSFCGYPSFSISGTCGSSCCQPS---CCETSCCQPRSCQTSFCGFPSFSTSGTCSSS 59

Query: 434 CRLPIWSSTSSTFPVWICTSVC 499
           C  P    TS   P    TS C
Sbjct: 60  CCQPSCCETSCCQPSCCETSCC 81



 Score = 33.1 bits (72), Expect = 0.84
 Identities = 20/49 (40%), Positives = 22/49 (44%), Gaps = 1/49 (2%)
 Frame = +2

Query: 230 PSLLP*PLCNSICCSYSCTLRCTFCCS-NRCGTSCCPSSGILCCFAILC 373
           PS      C+S CC  SC    T CC  + C TSCC  S   CC    C
Sbjct: 48  PSFSTSGTCSSSCCQPSCCE--TSCCQPSCCETSCCQPS---CCQISSC 91



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 28/89 (31%), Positives = 33/89 (37%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCWCCSNPASGSLHSPC--- 418
           C +  C Y        C S+ C  SCC +S      C    C   S   SG+  S C   
Sbjct: 4   CQTSFCGYPSFSISGTCGSSCCQPSCCETSCCQPRSCQTSFCGFPSFSTSGTCSSSCCQP 63

Query: 419 SCC--ICCRLPIWSSTSSTFPVWICTSVC 499
           SCC   CC+ P    TS   P     S C
Sbjct: 64  SCCETSCCQ-PSCCETSCCQPSCCQISSC 91


>AJ406926-1|CAC27565.1|  177|Homo sapiens keratin associated protein
           1.1 protein.
          Length = 177

 Score = 34.3 bits (75), Expect = 0.36
 Identities = 28/89 (31%), Positives = 35/89 (39%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCW--CCSNPASG--SLHS 412
           C +  C + SC+   T C S+ C  SCC +S     CC    C   CC     G  S  +
Sbjct: 4   CQTSFCGFPSCSTSGT-CGSSCCQPSCCETSSCQPRCCETSCCQPSCCQTSFCGFPSFST 62

Query: 413 PCSCCICCRLPIWSSTSSTFPVWICTSVC 499
             +C   C  P    TS   P    TS C
Sbjct: 63  GGTCDSSCCQPSCCETSCCQPSCYQTSSC 91



 Score = 33.9 bits (74), Expect = 0.48
 Identities = 19/49 (38%), Positives = 21/49 (42%), Gaps = 3/49 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS-NRCGTSCCPSS--GILCCFAILCWCCSNP 391
           C   CC  SCT     CC  +    SCC  S  G  CC  + C  CS P
Sbjct: 129 CLPPCCVVSCTPPS--CCQLHHAEASCCRPSYCGQSCCRPVCCCYCSEP 175


>AF005080-1|AAB83960.1|  110|Homo sapiens skin-specific protein
           protein.
          Length = 110

 Score = 34.3 bits (75), Expect = 0.36
 Identities = 21/76 (27%), Positives = 29/76 (38%), Gaps = 1/76 (1%)
 Frame = +2

Query: 221 QHRPSLLP*PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASG 400
           Q++    P P C   C    C  +C   C  +C   C P+    CC  I   CC   + G
Sbjct: 5   QNQQQCQPPPKCPPKCTP-KCPPKCPPKCLPQCPAPCSPAVSS-CCGPISGGCCGPSSGG 62

Query: 401 SLHSPC-SCCICCRLP 445
             +S    CC+    P
Sbjct: 63  CCNSGAGGCCLSHHRP 78


>AB052934-1|BAB61026.1|  177|Homo sapiens keratin associated protein
           1.1A protein.
          Length = 177

 Score = 34.3 bits (75), Expect = 0.36
 Identities = 28/89 (31%), Positives = 35/89 (39%), Gaps = 7/89 (7%)
 Frame = +2

Query: 254 CNSICCSY-SCTLRCTFCCSNRCGTSCCPSSGI--LCCFAILCW--CCSNPASG--SLHS 412
           C +  C + SC+   T C S+ C  SCC +S     CC    C   CC     G  S  +
Sbjct: 4   CQTSFCGFPSCSTSGT-CGSSCCQPSCCETSSCQPRCCETSCCQPSCCQTSFCGFPSFST 62

Query: 413 PCSCCICCRLPIWSSTSSTFPVWICTSVC 499
             +C   C  P    TS   P    TS C
Sbjct: 63  GGTCDSSCCQPSCCETSCCQPSCYQTSSC 91



 Score = 33.9 bits (74), Expect = 0.48
 Identities = 19/49 (38%), Positives = 21/49 (42%), Gaps = 3/49 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS-NRCGTSCCPSS--GILCCFAILCWCCSNP 391
           C   CC  SCT     CC  +    SCC  S  G  CC  + C  CS P
Sbjct: 129 CLPPCCVVSCTPPS--CCQLHHAEASCCRPSYCGQSCCRPVCCCYCSEP 175


>AB055057-1|BAB61031.1|   85|Homo sapiens keratin associated protein
           1.7 protein.
          Length = 85

 Score = 33.9 bits (74), Expect = 0.48
 Identities = 19/49 (38%), Positives = 21/49 (42%), Gaps = 3/49 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS-NRCGTSCCPSS--GILCCFAILCWCCSNP 391
           C   CC  SCT     CC  +    SCC  S  G  CC  + C  CS P
Sbjct: 37  CLPPCCVVSCTPPS--CCQLHHAEASCCRPSYCGQSCCRPVCCCYCSEP 83


>AB052868-1|BAB61024.1|  131|Homo sapiens keratin associated protein
           1.6 protein.
          Length = 131

 Score = 33.9 bits (74), Expect = 0.48
 Identities = 19/49 (38%), Positives = 21/49 (42%), Gaps = 3/49 (6%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCS-NRCGTSCCPSS--GILCCFAILCWCCSNP 391
           C   CC  SCT     CC  +    SCC  S  G  CC  + C  CS P
Sbjct: 83  CLPPCCVVSCTPPS--CCQLHHAEASCCRPSYCGQSCCRPVCCCYCSEP 129


>AL139247-5|CAI21683.1|  110|Homo sapiens late cornified envelope 2C
           protein.
          Length = 110

 Score = 33.5 bits (73), Expect = 0.64
 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 2/51 (3%)
 Frame = +2

Query: 281 CTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS--CC 427
           C  +CT  C  +C   C P      CF  +  CC  P+SGS   P S  CC
Sbjct: 16  CPPKCTPKCPPKCPPKCPPQCP-APCFPAVSSCC-GPSSGSCCGPSSGGCC 64



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 21/66 (31%), Positives = 26/66 (39%), Gaps = 6/66 (9%)
 Frame = +2

Query: 221 QHRPSLLP*PLCNSIC---CSYSCTLRCTFCCSNRCG---TSCCPSSGILCCFAILCWCC 382
           Q++    P P C   C   C   C  +C   C   C    +SCC  S   CC      CC
Sbjct: 5   QNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCFPAVSSCCGPSSGSCCGPSSGGCC 64

Query: 383 SNPASG 400
           S+ A G
Sbjct: 65  SSGAGG 70


>X89961-1|CAD56487.1|  116|Homo sapiens mitochondrial capsule
           selenoprotein protein.
          Length = 116

 Score = 33.1 bits (72), Expect = 0.84
 Identities = 20/69 (28%), Positives = 26/69 (37%), Gaps = 7/69 (10%)
 Frame = +2

Query: 257 NSICC----SYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSC 424
           +S CC    +  C  +   CC ++ G  CCP     CC      CC    +        C
Sbjct: 7   HSKCCPAKGNQCCPPQQNQCCQSK-GNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKAPC 65

Query: 425 CI---CCRL 442
           CI   CC L
Sbjct: 66  CIQARCCGL 74


>X89960-1|CAA62000.1|  116|Homo sapiens mitochondrial capsule
           selenoprotein protein.
          Length = 116

 Score = 33.1 bits (72), Expect = 0.84
 Identities = 20/69 (28%), Positives = 26/69 (37%), Gaps = 7/69 (10%)
 Frame = +2

Query: 257 NSICC----SYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSC 424
           +S CC    +  C  +   CC ++ G  CCP     CC      CC    +        C
Sbjct: 7   HSKCCPAKGNQCCPPQQNQCCQSK-GNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKAPC 65

Query: 425 CI---CCRL 442
           CI   CC L
Sbjct: 66  CIQARCCGL 74


>X63338-1|CAA44938.1|  175|Homo sapiens high sulfur keratin protein.
          Length = 175

 Score = 32.7 bits (71), Expect = 1.1
 Identities = 27/85 (31%), Positives = 30/85 (35%), Gaps = 3/85 (3%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASGSLHSP-CSC 424
           C    CS S T   + C  + C TSCC  S   CC    C   CC       L S     
Sbjct: 9   CGYPSCSTSGTCGSSCCQPSCCETSCCQPS---CCETSCCQPSCCQTSFCDFLASQLVDL 65

Query: 425 CICCRLPIWSSTSSTFPVWICTSVC 499
            + C  P    TS   P    TS C
Sbjct: 66  QLSCCQPSCCETSCCQPSCCQTSSC 90


>U63332-1|AAB05810.1|   46|Homo sapiens super cysteine rich protein
           protein.
          Length = 46

 Score = 32.7 bits (71), Expect = 1.1
 Identities = 14/41 (34%), Positives = 14/41 (34%)
 Frame = +2

Query: 320 GTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCICCRL 442
           G   CP     CC    C CC           C CC CC L
Sbjct: 1   GCELCPDRSRCCCCCCCCCCC---CCCCCCCCCCCCFCCCL 38



 Score = 31.1 bits (67), Expect = 3.4
 Identities = 12/31 (38%), Positives = 13/31 (41%)
 Frame = +2

Query: 290 RCTFCCSNRCGTSCCPSSGILCCFAILCWCC 382
           RC  CC   C   CC      CC    C+CC
Sbjct: 10  RCCCCCCCCCCCCCC----CCCCCCCCCFCC 36


>U07807-1|AAA20232.1|   62|Homo sapiens metallothionein IV protein.
          Length = 62

 Score = 32.7 bits (71), Expect = 1.1
 Identities = 19/60 (31%), Positives = 22/60 (36%), Gaps = 1/60 (1%)
 Frame = +2

Query: 251 LCNSIC-CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           +   IC C  +C  +CT C    C  SCCP     CC      C            CSCC
Sbjct: 9   MSGGICMCGDNC--KCTTCNCKTCRKSCCP-----CCPPGCAKCARGCICKGGSDKCSCC 61


>K01383-1|AAA59586.1|   61|Homo sapiens MT1A protein.
          Length = 61

 Score = 32.7 bits (71), Expect = 1.1
 Identities = 18/56 (32%), Positives = 20/56 (35%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           S  C+ SC  +C  C  N C  SCC      CC      C            CSCC
Sbjct: 12  SCTCTGSC--KCKECKCNSCKKSCCS-----CCPMSCAKCAQGCICKGASEKCSCC 60


>BC130605-1|AAI30606.1|  110|Homo sapiens late cornified envelope 2D
           protein.
          Length = 110

 Score = 32.7 bits (71), Expect = 1.1
 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 2/51 (3%)
 Frame = +2

Query: 281 CTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS--CC 427
           C  +CT  C  +C   C P     C  A+   CC  P+SGS   P S  CC
Sbjct: 16  CPPKCTPKCPPKCPPKCPPQCPAPCSPAVSS-CC-GPSSGSCCGPSSGGCC 64



 Score = 31.9 bits (69), Expect = 1.9
 Identities = 20/66 (30%), Positives = 25/66 (37%), Gaps = 6/66 (9%)
 Frame = +2

Query: 221 QHRPSLLP*PLCNSIC---CSYSCTLRCTFCCSNRCG---TSCCPSSGILCCFAILCWCC 382
           Q++    P P C   C   C   C  +C   C   C    +SCC  S   CC      CC
Sbjct: 5   QNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCSPAVSSCCGPSSGSCCGPSSGGCC 64

Query: 383 SNPASG 400
           S+   G
Sbjct: 65  SSGGGG 70



 Score = 30.3 bits (65), Expect = 5.9
 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 3/48 (6%)
 Frame = +2

Query: 248 PLCNSIC---CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCC 382
           P C   C   C   C+   + CC    G+ C PSSG  CC +    CC
Sbjct: 26  PKCPPKCPPQCPAPCSPAVSSCCGPSSGSCCGPSSG-GCCSSGGGGCC 72


>BC130603-1|AAI30604.1|  110|Homo sapiens late cornified envelope 2D
           protein.
          Length = 110

 Score = 32.7 bits (71), Expect = 1.1
 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 2/51 (3%)
 Frame = +2

Query: 281 CTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS--CC 427
           C  +CT  C  +C   C P     C  A+   CC  P+SGS   P S  CC
Sbjct: 16  CPPKCTPKCPPKCPPKCPPQCPAPCSPAVSS-CC-GPSSGSCCGPSSGGCC 64



 Score = 31.9 bits (69), Expect = 1.9
 Identities = 20/66 (30%), Positives = 25/66 (37%), Gaps = 6/66 (9%)
 Frame = +2

Query: 221 QHRPSLLP*PLCNSIC---CSYSCTLRCTFCCSNRCG---TSCCPSSGILCCFAILCWCC 382
           Q++    P P C   C   C   C  +C   C   C    +SCC  S   CC      CC
Sbjct: 5   QNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCSPAVSSCCGPSSGSCCGPSSGGCC 64

Query: 383 SNPASG 400
           S+   G
Sbjct: 65  SSGGGG 70



 Score = 30.3 bits (65), Expect = 5.9
 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 3/48 (6%)
 Frame = +2

Query: 248 PLCNSIC---CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCC 382
           P C   C   C   C+   + CC    G+ C PSSG  CC +    CC
Sbjct: 26  PKCPPKCPPQCPAPCSPAVSSCCGPSSGSCCGPSSG-GCCSSGGGGCC 72


>BC113448-1|AAI13449.1|   99|Homo sapiens late cornified envelope 4A
           protein.
          Length = 99

 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 1/40 (2%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCC-SNRCGTSCCPSSGILCCFA 364
           P C S C S SC    + CC S+  G  CC S G  CC +
Sbjct: 23  PKCPSKCAS-SCPPPISSCCGSSSGGCGCCSSEGGGCCLS 61


>BC113446-1|AAI13447.1|   99|Homo sapiens late cornified envelope 4A
           protein.
          Length = 99

 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 1/40 (2%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCC-SNRCGTSCCPSSGILCCFA 364
           P C S C S SC    + CC S+  G  CC S G  CC +
Sbjct: 23  PKCPSKCAS-SCPPPISSCCGSSSGGCGCCSSEGGGCCLS 61


>BC113444-1|AAI13445.1|   62|Homo sapiens metallothionein 4 protein.
          Length = 62

 Score = 32.7 bits (71), Expect = 1.1
 Identities = 19/60 (31%), Positives = 22/60 (36%), Gaps = 1/60 (1%)
 Frame = +2

Query: 251 LCNSIC-CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           +   IC C  +C  +CT C    C  SCCP     CC      C            CSCC
Sbjct: 9   MSGGICMCGDNC--KCTTCNCKTCRKSCCP-----CCPPGCAKCARGCICKGGSDKCSCC 61


>BC113442-1|AAI13443.1|   62|Homo sapiens metallothionein 4 protein.
          Length = 62

 Score = 32.7 bits (71), Expect = 1.1
 Identities = 19/60 (31%), Positives = 22/60 (36%), Gaps = 1/60 (1%)
 Frame = +2

Query: 251 LCNSIC-CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           +   IC C  +C  +CT C    C  SCCP     CC      C            CSCC
Sbjct: 9   MSGGICMCGDNC--KCTTCNCKTCRKSCCP-----CCPPGCAKCARGCICKGGSDKCSCC 61


>BC029475-1|AAH29475.1|   61|Homo sapiens metallothionein 1A
           protein.
          Length = 61

 Score = 32.7 bits (71), Expect = 1.1
 Identities = 18/56 (32%), Positives = 20/56 (35%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           S  C+ SC  +C  C  N C  SCC      CC      C            CSCC
Sbjct: 12  SCTCTGSC--KCKECKCNSCKKSCCS-----CCPMSCAKCAQGCICKGASEKCSCC 60


>AL163280-3|CAB90447.1|  315|Homo sapiens IGSF5 protein.
          Length = 315

 Score = 32.7 bits (71), Expect = 1.1
 Identities = 12/29 (41%), Positives = 13/29 (44%)
 Frame = +2

Query: 353 CCFAILCWCCSNPASGSLHSPCSCCICCR 439
           C   I C CC     G  +  C CC CCR
Sbjct: 247 CTLTIRCCCCRRRCCGC-NCCCRCCFCCR 274



 Score = 32.3 bits (70), Expect = 1.5
 Identities = 10/23 (43%), Positives = 12/23 (52%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCG 322
           C   CC  +C  RC FCC  + G
Sbjct: 256 CRRRCCGCNCCCRCCFCCRRKRG 278


>AL139247-8|CAI21686.1|   99|Homo sapiens late cornified envelope 4A
           protein.
          Length = 99

 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 1/40 (2%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCC-SNRCGTSCCPSSGILCCFA 364
           P C S C S SC    + CC S+  G  CC S G  CC +
Sbjct: 23  PKCPSKCAS-SCPPPISSCCGSSSGGCGCCSSEGGGCCLS 61


>AL139247-4|CAI21682.1|  110|Homo sapiens late cornified envelope 2D
           protein.
          Length = 110

 Score = 32.7 bits (71), Expect = 1.1
 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 2/51 (3%)
 Frame = +2

Query: 281 CTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCS--CC 427
           C  +CT  C  +C   C P     C  A+   CC  P+SGS   P S  CC
Sbjct: 16  CPPKCTPKCPPKCPPKCPPQCPAPCSPAVSS-CC-GPSSGSCCGPSSGGCC 64



 Score = 31.9 bits (69), Expect = 1.9
 Identities = 20/66 (30%), Positives = 25/66 (37%), Gaps = 6/66 (9%)
 Frame = +2

Query: 221 QHRPSLLP*PLCNSIC---CSYSCTLRCTFCCSNRCG---TSCCPSSGILCCFAILCWCC 382
           Q++    P P C   C   C   C  +C   C   C    +SCC  S   CC      CC
Sbjct: 5   QNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCSPAVSSCCGPSSGSCCGPSSGGCC 64

Query: 383 SNPASG 400
           S+   G
Sbjct: 65  SSGGGG 70



 Score = 30.3 bits (65), Expect = 5.9
 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 3/48 (6%)
 Frame = +2

Query: 248 PLCNSIC---CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCC 382
           P C   C   C   C+   + CC    G+ C PSSG  CC +    CC
Sbjct: 26  PKCPPKCPPQCPAPCSPAVSSCCGPSSGSCCGPSSG-GCCSSGGGGCC 72


>AF005081-1|AAB83961.1|  112|Homo sapiens skin-specific protein
           protein.
          Length = 112

 Score = 32.7 bits (71), Expect = 1.1
 Identities = 20/47 (42%), Positives = 24/47 (51%), Gaps = 1/47 (2%)
 Frame = +2

Query: 257 NSICCSYSCTLRCTFCCSNRCGTSC-CPSSGILCCFAILCWCCSNPA 394
           +S CC  S +  C  C S  CG SC C SSG  CC  I+     +PA
Sbjct: 67  SSGCCENSGSSGC--CGSGGCGCSCGCGSSG-CCCLGIIPMKSRSPA 110


>U80736-1|AAB91435.1|  331|Homo sapiens CAGF9 protein.
          Length = 331

 Score = 32.3 bits (70), Expect = 1.5
 Identities = 18/70 (25%), Positives = 35/70 (50%)
 Frame = -1

Query: 462 EVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRV 283
           +V   + ++QH  Q Q + ++    ++Q Q    +QH+M     Q++   ++QQ  Q  +
Sbjct: 186 QVSPSVQTQQHQMQLQQQQQQQQQQMQQMQQQQLQQHQM----HQQIQQQMQQQHFQHHM 241

Query: 282 QL*EQQMELH 253
           Q   QQ + H
Sbjct: 242 QQHLQQQQQH 251



 Score = 31.1 bits (67), Expect = 3.4
 Identities = 18/62 (29%), Positives = 31/62 (50%)
 Frame = -1

Query: 435 QHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMEL 256
           Q MQQ+Q +  +    ++Q       QH M    QQ+  HL +Q   Q+  Q  +Q+++L
Sbjct: 212 QQMQQQQLQQHQMHQQIQQQMQQQHFQHHMQQHLQQQQQHLQQQINQQQLQQQLQQRLQL 271

Query: 255 HR 250
            +
Sbjct: 272 QQ 273


>BC028377-1|AAH28377.1|  544|Homo sapiens zinc finger protein 502
           protein.
          Length = 544

 Score = 32.3 bits (70), Expect = 1.5
 Identities = 27/108 (25%), Positives = 48/108 (44%), Gaps = 4/108 (3%)
 Frame = -1

Query: 606 FEPKLYFIHQYKLLSTNKSFVLSLCRKALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHM 427
           F    + IH  ++ +  K ++ S C  +    S++ Q   +IHTG           + H 
Sbjct: 276 FNQNTHLIHHQRIHTGEKPYICSECGSSFRKHSNLTQHQ-RIHTGE----------KPHK 324

Query: 426 QQEQGECREPLAGLEQHQ--HSMAKQHRMPLLGQQ--EVPHLLEQQKV 295
             E G+  +  A L QHQ  HS  K ++    G+   + P L++ Q++
Sbjct: 325 CDECGKTFQTKANLSQHQRIHSGEKPYKCKECGKAFCQSPSLIKHQRI 372


>AK128797-1|BAC87611.1|  201|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45585 fis, clone BRTHA3013882. ).
          Length = 201

 Score = 32.3 bits (70), Expect = 1.5
 Identities = 22/84 (26%), Positives = 28/84 (33%), Gaps = 1/84 (1%)
 Frame = +2

Query: 251 LCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSC-C 427
           +C  +C    C   C   C + C   C      +C F  LC C            C C C
Sbjct: 58  VCLCVCLVSVCLCVCLCVCVSVCLCVCLHLCVCVCGFVCLCLCV-----------CVCLC 106

Query: 428 ICCRLPIWSSTSSTFPVWICTSVC 499
           +C  L +         V  C SVC
Sbjct: 107 VCVCLHLCVCVGLCVSVCFCVSVC 130



 Score = 31.5 bits (68), Expect = 2.6
 Identities = 25/92 (27%), Positives = 33/92 (35%), Gaps = 9/92 (9%)
 Frame = +2

Query: 251 LCNSIC---CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLH-SPC 418
           +C S+C   C + C   C F C   C   C      +C    LC C     S     S C
Sbjct: 75  VCVSVCLCVCLHLCVCVCGFVCLCLCVCVCL----CVCVCLHLCVCVGLCVSVCFCVSVC 130

Query: 419 SC-----CICCRLPIWSSTSSTFPVWICTSVC 499
            C     CIC  + +W        V +C  +C
Sbjct: 131 VCLCVCVCICVFVCVWVCVCLCVCVCLCVCLC 162


>M13903-1|AAA59186.1|  585|Homo sapiens involucrin protein.
          Length = 585

 Score = 31.9 bits (69), Expect = 1.9
 Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 2/73 (2%)
 Frame = -1

Query: 474 GNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQE--VPHLLEQQ 301
           G +  + +  G  +H++Q+QG+   P   + Q ++   ++ ++ L  QQE  V H LE+Q
Sbjct: 428 GQLKHLEEQEGQLKHLEQQQGQLEVPEQQVGQPKNLEQEEKQLELPEQQEGQVKH-LEKQ 486

Query: 300 KVQRRVQL*EQQM 262
           + Q  ++L EQQ+
Sbjct: 487 EAQ--LELPEQQV 497


>CR457218-1|CAG33499.1|   99|Homo sapiens NICE-1 protein.
          Length = 99

 Score = 31.9 bits (69), Expect = 1.9
 Identities = 15/44 (34%), Positives = 17/44 (38%)
 Frame = +2

Query: 302 CCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           CC +  G  CC  SG  CC +    CC  P          CC C
Sbjct: 39  CCGS--GRGCCGDSG--CCGSSSTSCCCFPRRRRRQRSSGCCCC 78


>BT006844-1|AAP35490.1|  438|Homo sapiens granulin protein.
          Length = 438

 Score = 31.9 bits (69), Expect = 1.9
 Identities = 20/60 (33%), Positives = 26/60 (43%)
 Frame = +2

Query: 278 SCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCICCRLPIWSS 457
           SC    T C  NR G +CCP    +CC A    CC  PA     +  + C+    P W +
Sbjct: 371 SCPSSDTCCRDNRQGWACCPYRQGVCC-ADRRHCC--PAGFRCAARGTKCLRREAPRWDA 427


>BC119710-1|AAI19711.1|   99|Homo sapiens cysteine-rich C-terminal 1
           protein.
          Length = 99

 Score = 31.9 bits (69), Expect = 1.9
 Identities = 15/44 (34%), Positives = 17/44 (38%)
 Frame = +2

Query: 302 CCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           CC +  G  CC  SG  CC +    CC  P          CC C
Sbjct: 39  CCGS--GRGCCGDSG--CCGSSSTSCCCFPRRRRRQRSSGCCCC 78


>BC101149-1|AAI01150.1|  128|Homo sapiens keratin associated protein
           2-4 protein.
          Length = 128

 Score = 31.9 bits (69), Expect = 1.9
 Identities = 23/72 (31%), Positives = 30/72 (41%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           P    +CC   C+L+   CC      +CCPSS         CW  +     S+ SPC C 
Sbjct: 57  PCRRPVCCD-PCSLQ-EGCCRP---ITCCPSSCTAVVCRPCCWATTCCQPVSVQSPC-CR 110

Query: 428 ICCRLPIWSSTS 463
             C  P   ST+
Sbjct: 111 PPCGQPTPCSTT 122


>BC101148-1|AAI01149.1|  128|Homo sapiens keratin associated protein
           2-4 protein.
          Length = 128

 Score = 31.9 bits (69), Expect = 1.9
 Identities = 23/72 (31%), Positives = 30/72 (41%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           P    +CC   C+L+   CC      +CCPSS         CW  +     S+ SPC C 
Sbjct: 57  PCRRPVCCD-PCSLQ-EGCCRP---ITCCPSSCTAVVCRPCCWATTCCQPVSVQSPC-CR 110

Query: 428 ICCRLPIWSSTS 463
             C  P   ST+
Sbjct: 111 PPCGQPTPCSTT 122


>BC101147-1|AAI01148.1|  128|Homo sapiens keratin associated protein
           2-4 protein.
          Length = 128

 Score = 31.9 bits (69), Expect = 1.9
 Identities = 23/72 (31%), Positives = 30/72 (41%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           P    +CC   C+L+   CC      +CCPSS         CW  +     S+ SPC C 
Sbjct: 57  PCRRPVCCD-PCSLQ-EGCCRP---ITCCPSSCTAVVCRPCCWATTCCQPVSVQSPC-CR 110

Query: 428 ICCRLPIWSSTS 463
             C  P   ST+
Sbjct: 111 PPCGQPTPCSTT 122


>BC063625-1|AAH63625.1|  128|Homo sapiens KRTAP2-4 protein protein.
          Length = 128

 Score = 31.9 bits (69), Expect = 1.9
 Identities = 23/72 (31%), Positives = 30/72 (41%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           P    +CC   C+L+   CC      +CCPSS         CW  +     S+ SPC C 
Sbjct: 57  PCRRPVCCD-PCSLQ-EGCCRP---ITCCPSSCTAVVCRPCCWATTCCQPVSVQSPC-CR 110

Query: 428 ICCRLPIWSSTS 463
             C  P   ST+
Sbjct: 111 PPCGQPTPCSTT 122


>BC046391-1|AAH46391.1|  585|Homo sapiens involucrin protein.
          Length = 585

 Score = 31.9 bits (69), Expect = 1.9
 Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 2/73 (2%)
 Frame = -1

Query: 474 GNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQE--VPHLLEQQ 301
           G +  + +  G  +H++Q+QG+   P   + Q ++   ++ ++ L  QQE  V H LE+Q
Sbjct: 428 GQLKHLEEQEGQLKHLEQQQGQLEVPEQQVGQPKNLEQEEKQLELPEQQEGQVKH-LEKQ 486

Query: 300 KVQRRVQL*EQQM 262
           + Q  ++L EQQ+
Sbjct: 487 EAQ--LELPEQQV 497


>BC020757-1|AAH20757.1|   62|Homo sapiens MT1G protein protein.
          Length = 62

 Score = 31.9 bits (69), Expect = 1.9
 Identities = 16/60 (26%), Positives = 19/60 (31%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           P C+      SCT   + C    C  + C  S   CC      C            CSCC
Sbjct: 3   PNCSCAAAGVSCTCASS-CKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCC 61


>BC016744-1|AAH16744.1|  116|Homo sapiens sperm
           mitochondria-associated cysteine-rich protein protein.
          Length = 116

 Score = 31.9 bits (69), Expect = 1.9
 Identities = 20/69 (28%), Positives = 26/69 (37%), Gaps = 7/69 (10%)
 Frame = +2

Query: 257 NSICC----SYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSC 424
           +S CC    +  C  +   CC ++ G  CCP     CC      CC    +        C
Sbjct: 7   HSKCCPAKGNQCCPPQQNQCCQSK-GNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPC 65

Query: 425 CI---CCRL 442
           CI   CC L
Sbjct: 66  CIQARCCGL 74


>BC014593-1|AAH14593.1|  116|Homo sapiens sperm
           mitochondria-associated cysteine-rich protein protein.
          Length = 116

 Score = 31.9 bits (69), Expect = 1.9
 Identities = 20/69 (28%), Positives = 26/69 (37%), Gaps = 7/69 (10%)
 Frame = +2

Query: 257 NSICC----SYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSC 424
           +S CC    +  C  +   CC ++ G  CCP     CC      CC    +        C
Sbjct: 7   HSKCCPAKGNQCCPPQQNQCCQSK-GNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPC 65

Query: 425 CI---CCRL 442
           CI   CC L
Sbjct: 66  CIQARCCGL 74


>BC000324-1|AAH00324.1|  438|Homo sapiens granulin protein.
          Length = 438

 Score = 31.9 bits (69), Expect = 1.9
 Identities = 20/60 (33%), Positives = 26/60 (43%)
 Frame = +2

Query: 278 SCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCICCRLPIWSS 457
           SC    T C  NR G +CCP    +CC A    CC  PA     +  + C+    P W +
Sbjct: 371 SCPSSDTCCRDNRQGWACCPYRQGVCC-ADRRHCC--PAGFRCAARGTKCLRREAPRWDA 427


>AL162596-4|CAI19553.1|  585|Homo sapiens involucrin protein.
          Length = 585

 Score = 31.9 bits (69), Expect = 1.9
 Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 2/73 (2%)
 Frame = -1

Query: 474 GNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQE--VPHLLEQQ 301
           G +  + +  G  +H++Q+QG+   P   + Q ++   ++ ++ L  QQE  V H LE+Q
Sbjct: 428 GQLKHLEEQEGQLKHLEQQQGQLEVPEQQVGQPKNLEQEEKQLELPEQQEGQVKH-LEKQ 486

Query: 300 KVQRRVQL*EQQM 262
           + Q  ++L EQQ+
Sbjct: 487 EAQ--LELPEQQV 497


>AL162596-3|CAI19552.1|  116|Homo sapiens sperm
           mitochondria-associated cysteine-rich protein protein.
          Length = 116

 Score = 31.9 bits (69), Expect = 1.9
 Identities = 20/69 (28%), Positives = 26/69 (37%), Gaps = 7/69 (10%)
 Frame = +2

Query: 257 NSICC----SYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSC 424
           +S CC    +  C  +   CC ++ G  CCP     CC      CC    +        C
Sbjct: 7   HSKCCPAKGNQCCPPQQNQCCQSK-GNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPC 65

Query: 425 CI---CCRL 442
           CI   CC L
Sbjct: 66  CIQARCCGL 74


>AL135842-4|CAI23351.1|   99|Homo sapiens cysteine-rich C-terminal 1
           protein.
          Length = 99

 Score = 31.9 bits (69), Expect = 1.9
 Identities = 15/44 (34%), Positives = 17/44 (38%)
 Frame = +2

Query: 302 CCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           CC +  G  CC  SG  CC +    CC  P          CC C
Sbjct: 39  CCGS--GRGCCGDSG--CCGSSSTSCCCFPRRRRRQRSSGCCCC 78


>AJ406930-1|CAC27569.1|  128|Homo sapiens keratin associated protein
           2.4 protein.
          Length = 128

 Score = 31.9 bits (69), Expect = 1.9
 Identities = 23/72 (31%), Positives = 30/72 (41%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           P    +CC   C+L+   CC      +CCPSS         CW  +     S+ SPC C 
Sbjct: 57  PCRRPVCCD-PCSLQ-EGCCRP---ITCCPSSCTAVVCRPCCWATTCCQPVSVQSPC-CR 110

Query: 428 ICCRLPIWSSTS 463
             C  P   ST+
Sbjct: 111 PPCGQPTPCSTT 122


>AJ302536-1|CAC27564.1|   85|Homo sapiens keratin associated protein
           KAP2.2 protein.
          Length = 85

 Score = 31.9 bits (69), Expect = 1.9
 Identities = 23/72 (31%), Positives = 30/72 (41%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           P    +CC   C+L+   CC      +CCPSS         CW  +     S+ SPC C 
Sbjct: 14  PCRRPVCCD-PCSLQ-EGCCRP---ITCCPSSCTAVVCRPCCWATTCCQPVSVQSPC-CR 67

Query: 428 ICCRLPIWSSTS 463
             C  P   ST+
Sbjct: 68  PPCGQPTPCSTT 79


>AJ296345-1|CAC24555.1|   96|Homo sapiens keratin associated protein
           protein.
          Length = 96

 Score = 31.9 bits (69), Expect = 1.9
 Identities = 23/72 (31%), Positives = 30/72 (41%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           P    +CC   C+L+   CC      +CCPSS         CW  +     S+ SPC C 
Sbjct: 25  PCRRPVCCD-PCSLQ-EGCCRP---ITCCPSSCTAVVCRPCCWATTCCQPVSVQSPC-CR 78

Query: 428 ICCRLPIWSSTS 463
             C  P   ST+
Sbjct: 79  PPCGQPTPCSTT 90


>AJ243662-1|CAB65093.1|   99|Homo sapiens NICE-1 protein protein.
          Length = 99

 Score = 31.9 bits (69), Expect = 1.9
 Identities = 15/44 (34%), Positives = 17/44 (38%)
 Frame = +2

Query: 302 CCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           CC +  G  CC  SG  CC +    CC  P          CC C
Sbjct: 39  CCGS--GRGCCGDSG--CCGSSSTSCCCFPRRRRRQRSSGCCCC 78


>AF384996-1|AAK62360.1|  111|Homo sapiens MUSP1 protein.
          Length = 111

 Score = 31.9 bits (69), Expect = 1.9
 Identities = 19/76 (25%), Positives = 32/76 (42%), Gaps = 5/76 (6%)
 Frame = +2

Query: 371 CWCCSNPASGSLHSPCSCCI-----CCRLPIWSSTSSTFPVWICTSVCSIDEKEHKAFLQ 535
           CW CS P+     +PC   +        L +W S+      W   ++C     E + + Q
Sbjct: 13  CWLCSKPSVLVHIAPCPGLLRVGHLSLLLTVWLSSPLQAWGWCDAAICQTRAPESQRYNQ 72

Query: 536 RLKTKDLLVDKSLYWW 583
           R K K+    + LY++
Sbjct: 73  RQKNKNHEQSRCLYYF 88


>AB081339-1|BAC15620.1|  141|Homo sapiens keratin associated protein
           1.9 protein.
          Length = 141

 Score = 31.9 bits (69), Expect = 1.9
 Identities = 18/52 (34%), Positives = 22/52 (42%), Gaps = 2/52 (3%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCW--CCSNPASGS 403
           C    CS S T   + C  + C TSCC  S   CC    C   CC   + G+
Sbjct: 9   CGYPSCSTSGTCGSSCCQPSCCETSCCQPS---CCETSCCQPSCCQTSSCGT 57


>L21998-1|AAB95295.1| 5179|Homo sapiens mucin protein.
          Length = 5179

 Score = 31.5 bits (68), Expect = 2.6
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 3/51 (5%)
 Frame = -1

Query: 228 RCCYQ-RTQCPAGDINLCSVWRNVLRYSLSVSHVGW--SNQRSSGYCWNSC 85
           R C Q R +CP GD  +CS    V  +S   SH G    N R++  C  +C
Sbjct: 248 RACQQDRCRCPGGDTCVCS---TVAEFSRQCSHAGGRPGNWRTATLCPKTC 295


>AF348997-1|AAO32957.1|   61|Homo sapiens MTE protein.
          Length = 61

 Score = 31.5 bits (68), Expect = 2.6
 Identities = 16/54 (29%), Positives = 20/54 (37%), Gaps = 1/54 (1%)
 Frame = +2

Query: 269 CSYSCTLRCTFCCSNR-CGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           CS S +  CT    +R C  + C +S   CC      C            CSCC
Sbjct: 7   CSTSSSCTCTTSSKSRECKCTSCKTSCCSCCPVGCAKCAQGCVCKGTSDKCSCC 60


>X60077-1|CAC16148.1|   91|Homo sapiens 22 Kruppel-related zinc
           finger protein protein.
          Length = 91

 Score = 31.1 bits (67), Expect = 3.4
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 4/56 (7%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQ--HSMAKQHRMPLLGQQ--EVPHLLEQQKV 295
           H G R +  +E G+     +GL QH+  H++ K H   L G+      HL+  Q++
Sbjct: 2   HTGERPYQCKECGKSFNQSSGLSQHRKIHTLKKPHECDLCGKAFCHRSHLIRHQRI 57


>CR456615-1|CAG30501.1|  446|Homo sapiens ZNF70 protein.
          Length = 446

 Score = 31.1 bits (67), Expect = 3.4
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 4/56 (7%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQ--HSMAKQHRMPLLGQQ--EVPHLLEQQKV 295
           H G R +  +E G+     +GL QH+  H++ K H   L G+      HL+  Q++
Sbjct: 246 HTGERPYQCKECGKSFNQSSGLSQHRKIHTLKKPHECDLCGKAFCHRSHLIRHQRI 301


>BC040161-1|AAH40161.1|  446|Homo sapiens zinc finger protein 70
           protein.
          Length = 446

 Score = 31.1 bits (67), Expect = 3.4
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 4/56 (7%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQ--HSMAKQHRMPLLGQQ--EVPHLLEQQKV 295
           H G R +  +E G+     +GL QH+  H++ K H   L G+      HL+  Q++
Sbjct: 246 HTGERPYQCKECGKSFNQSSGLSQHRKIHTLKKPHECDLCGKAFCHRSHLIRHQRI 301


>AB050771-1|BAB83033.1|  446|Homo sapiens zinc finger protein N27C7
           protein.
          Length = 446

 Score = 31.1 bits (67), Expect = 3.4
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 4/56 (7%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQ--HSMAKQHRMPLLGQQ--EVPHLLEQQKV 295
           H G R +  +E G+     +GL QH+  H++ K H   L G+      HL+  Q++
Sbjct: 246 HTGERPYQCKECGKSFNQSSGLSQHRKIHTLKKPHECDLCGKAFCHRSHLIRHQRI 301


>X97261-1|CAA65916.1|   61|Homo sapiens Metallothionein 1R protein.
          Length = 61

 Score = 30.7 bits (66), Expect = 4.5
 Identities = 15/53 (28%), Positives = 18/53 (33%)
 Frame = +2

Query: 269 CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           CS + + +C  C    C  SCC      CC      C            CSCC
Sbjct: 13  CSCASSCKCKECKCTSCKKSCCS-----CCPMGCAKCAQGCVCKGASEKCSCC 60


>AY196485-1|AAP33842.1|  246|Homo sapiens I-mfa domain-containing
           protein protein.
          Length = 246

 Score = 30.7 bits (66), Expect = 4.5
 Identities = 15/52 (28%), Positives = 20/52 (38%), Gaps = 1/52 (1%)
 Frame = +2

Query: 266 CCSYSCTLRCTFC-CSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC 418
           CC + C L C FC     C      +S  +C     C CC +      + PC
Sbjct: 166 CCVH-CILACLFCEFLTLCNIVLGQASCGICTSEACCCCCGDEMGDDCNCPC 216


>AY077636-1|AAL76084.1|   61|Homo sapiens zinc-induced
           metallothionein 2A/1A hybrid protein.
          Length = 61

 Score = 30.7 bits (66), Expect = 4.5
 Identities = 17/57 (29%), Positives = 20/57 (35%)
 Frame = +2

Query: 257 NSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           +S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 11  DSCTCAGSC--KCKECKCTSCKKSCCS-----CCPMSCAKCAQGCICKGASEKCSCC 60


>AF054589-2|AAF36998.1|  246|Homo sapiens HIC protein isoform p32
           protein.
          Length = 246

 Score = 30.7 bits (66), Expect = 4.5
 Identities = 15/52 (28%), Positives = 20/52 (38%), Gaps = 1/52 (1%)
 Frame = +2

Query: 266 CCSYSCTLRCTFC-CSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC 418
           CC + C L C FC     C      +S  +C     C CC +      + PC
Sbjct: 166 CCVH-CILACLFCEFLTLCNIVLGQASCGICTSEACCCCCGDEMGDDCNCPC 216


>AF054589-1|AAF36999.1|  355|Homo sapiens HIC protein isoform p40
           protein.
          Length = 355

 Score = 30.7 bits (66), Expect = 4.5
 Identities = 15/52 (28%), Positives = 20/52 (38%), Gaps = 1/52 (1%)
 Frame = +2

Query: 266 CCSYSCTLRCTFC-CSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPC 418
           CC + C L C FC     C      +S  +C     C CC +      + PC
Sbjct: 275 CCVH-CILACLFCEFLTLCNIVLGQASCGICTSEACCCCCGDEMGDDCNCPC 325


>X97260-1|CAA65915.1|   61|Homo sapiens Metallothionein 2 protein.
          Length = 61

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 17/57 (29%), Positives = 20/57 (35%)
 Frame = +2

Query: 257 NSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           +S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 11  DSCTCAGSC--KCKECKCTSCKKSCCS-----CCPVGCAKCAQGCICKGASDKCSCC 60


>X76717-1|CAA54136.1|   61|Homo sapiens MT-1l protein protein.
          Length = 61

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 17/56 (30%), Positives = 19/56 (33%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 12  SCACAGSC--KCKECKCTSCKKSCCS-----CCPVGCAKCAQGCICKGTSDKCSCC 60


>X65607-1|CAA46557.1|   61|Homo sapiens metallothionein IX protein.
          Length = 61

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 17/56 (30%), Positives = 19/56 (33%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 12  SCACAGSC--KCKECKCTSCKKSCCS-----CCPVGCAKCAQGCICKGTSDKCSCC 60


>V00594-1|CAA23841.1|   61|Homo sapiens protein ( Human mRNA for
           metallothionein from cadmium-treated cells. ).
          Length = 61

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 17/57 (29%), Positives = 20/57 (35%)
 Frame = +2

Query: 257 NSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           +S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 11  DSCTCAGSC--KCKECKCTSCKKSCCS-----CCPVGCAKCAQGCICKGASDKCSCC 60


>S52379-1|AAB24908.1|   61|Homo sapiens metallothionein-II protein.
          Length = 61

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 17/57 (29%), Positives = 20/57 (35%)
 Frame = +2

Query: 257 NSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           +S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 11  DSCTCAGSC--KCKECKCTSCKKSCCS-----CCPVGCAKCAQGCICKGASDKCSCC 60


>M10942-1|AAA59587.1|   61|Homo sapiens MT1E protein.
          Length = 61

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 17/56 (30%), Positives = 19/56 (33%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 12  SCTCAGSC--KCKECKCTSCKKSCCS-----CCPVGCAKCAQGCVCKGASEKCSCC 60


>L46720-1|AAB00855.1|  863|Homo sapiens autotaxin-t protein.
          Length = 863

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 14/45 (31%), Positives = 18/45 (40%), Gaps = 2/45 (4%)
 Frame = +2

Query: 305 CSNRCG--TSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCIC 433
           C N C   TSCC     LC      W C+    G + +  + C C
Sbjct: 76  CDNLCKSYTSCCHDFDELCLKTARAWECTKDRCGEVRNEENACHC 120


>J03910-1|AAA59873.1|   61|Homo sapiens metallothionein-IG protein.
          Length = 61

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 14/55 (25%), Positives = 19/55 (34%)
 Frame = +2

Query: 263 ICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           + C+ + + +C  C    C  SCC      CC      C            CSCC
Sbjct: 11  VSCTCASSCKCKECKCTSCKKSCCS-----CCPVGCAKCAQGCICKGASEKCSCC 60


>J00271-1|AAA59583.1|   61|Homo sapiens metallothionein II protein.
          Length = 61

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 17/57 (29%), Positives = 20/57 (35%)
 Frame = +2

Query: 257 NSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           +S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 11  DSCTCAGSC--KCKECKCTSCKKSCCS-----CCPVGCAKCAQGCICKGASDKCSCC 60


>DQ370420-1|ABC79300.1|   61|Homo sapiens metallothionein 2A
           protein.
          Length = 61

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 17/57 (29%), Positives = 20/57 (35%)
 Frame = +2

Query: 257 NSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           +S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 11  DSCTCAGSC--KCKECKCTSCKKSCCS-----CCPVGCAKCAQGCICKGASDKCSCC 60


>CR456537-1|CAG30423.1|  674|Homo sapiens PCQAP protein.
          Length = 674

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 24/97 (24%), Positives = 45/97 (46%)
 Frame = -1

Query: 543 LSLCRKALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSM 364
           LSL  + +  F  I     Q      L+ L  +  +Q  QQ+Q + ++  A  +Q Q   
Sbjct: 56  LSLVARLIIHFRDIHNKKSQASVSAQLQ-LQQVALQQQQQQQQFQQQQQAALQQQQQQQQ 114

Query: 363 AKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELH 253
             Q +   + QQ    + +QQ++Q++ Q  +  ++LH
Sbjct: 115 QFQAQQSAMQQQFQAVVQQQQQLQQQQQQ-QHLIKLH 150


>BT007315-1|AAP35979.1|   61|Homo sapiens metallothionein 2A
           protein.
          Length = 61

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 17/57 (29%), Positives = 20/57 (35%)
 Frame = +2

Query: 257 NSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           +S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 11  DSCTCAGSC--KCKECKCTSCKKSCCS-----CCPVGCAKCAQGCICKGASDKCSCC 60


>BC131609-1|AAI31610.1|   61|Homo sapiens metallothionein 1E
           protein.
          Length = 61

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 17/56 (30%), Positives = 19/56 (33%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 12  SCTCAGSC--KCKECKCTSCKKSCCS-----CCPVGCAKCAQGCVCKGASEKCSCC 60


>BC070289-1|AAH70289.1|   61|Homo sapiens MT2A protein protein.
          Length = 61

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 17/57 (29%), Positives = 20/57 (35%)
 Frame = +2

Query: 257 NSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           +S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 11  DSCTCAGSC--KCKECKCTSCKKSCCS-----CCPVGCAKCAQGCICKGASDKCSCC 60


>BC062734-1|AAH62734.1|   61|Homo sapiens metallothionein 1E
           protein.
          Length = 61

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 17/56 (30%), Positives = 19/56 (33%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 12  SCTCAGSC--KCKECKCTSCKKSCCS-----CCPVGCAKCAQGCVCKGASEKCSCC 60


>BC032338-1|AAH32338.1|   61|Homo sapiens metallothionein 1X
           protein.
          Length = 61

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 17/56 (30%), Positives = 19/56 (33%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 12  SCACAGSC--KCKECKCTSCKKSCCS-----CCPVGCAKCAQGCICKGTSDKCSCC 60


>BC013985-1|AAH13985.1|  748|Homo sapiens PC2 (positive cofactor 2,
           multiprotein complex) glutamine/Q-rich-associated pro
           protein.
          Length = 748

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 16/63 (25%), Positives = 34/63 (53%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + +   + ++Q   ++ +Q +     QQ+  HL++    Q + Q+ +QQ +
Sbjct: 179 QQQQQQQQQQFQAQQSAMQQQFQAVVQQQQQLQQQQQQQQHLIKLHH-QNQQQIQQQQQQ 237

Query: 258 LHR 250
           L R
Sbjct: 238 LQR 240


>BC009699-1|AAH09699.1|   61|Homo sapiens metallothionein 1E
           protein.
          Length = 61

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 17/56 (30%), Positives = 19/56 (33%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 12  SCTCAGSC--KCKECKCTSCKKSCCS-----CCPVGCAKCAQGCVCKGASEKCSCC 60


>BC007034-1|AAH07034.1|   61|Homo sapiens MT2A protein protein.
          Length = 61

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 17/57 (29%), Positives = 20/57 (35%)
 Frame = +2

Query: 257 NSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           +S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 11  DSCTCAGSC--KCKECKCTSCKKSCCS-----CCPVGCAKCAQGCICKGASDKCSCC 60


>BC003078-1|AAH03078.1|  767|Homo sapiens PCQAP protein protein.
          Length = 767

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 16/63 (25%), Positives = 34/63 (53%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + +   + ++Q   ++ +Q +     QQ+  HL++    Q + Q+ +QQ +
Sbjct: 198 QQQQQQQQQQFQAQQSAMQQQFQAVVQQQQQLQQQQQQQQHLIKLHH-QNQQQIQQQQQQ 256

Query: 258 LHR 250
           L R
Sbjct: 257 LQR 259


>AY028617-1|AAK26162.1|   61|Homo sapiens metallothionein 1S
           protein.
          Length = 61

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 17/56 (30%), Positives = 19/56 (33%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 12  SCTCTGSC--KCKECKCTSCKKSCCS-----CCPMSCAKCAQGCICKGASEKCSCC 60


>AL135842-3|CAI23350.1|  118|Homo sapiens late cornified envelope 5A
           protein.
          Length = 118

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 16/60 (26%), Positives = 23/60 (38%), Gaps = 1/60 (1%)
 Frame = +2

Query: 269 CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSP-CSCCICCRLP 445
           C+  C  +CT  C  +C   C P     C   +   CC + + G   S    CC+    P
Sbjct: 16  CTPKCPPKCTPKCPPKCPPKCPPQCSAPCPPPVSS-CCGSSSGGCCSSEGGGCCLSHHRP 74


>AK090465-1|BAC03446.1|  811|Homo sapiens FLJ00386 protein protein.
          Length = 811

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 16/63 (25%), Positives = 34/63 (53%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + +   + ++Q   ++ +Q +     QQ+  HL++    Q + Q+ +QQ +
Sbjct: 202 QQQQQQQQQQFQAQQSAMQQQFQAVVQQQQQLQQQQQQQQHLIKLHH-QNQQQIQQQQQQ 260

Query: 258 LHR 250
           L R
Sbjct: 261 LQR 263


>AF348996-1|AAO32956.2|   61|Homo sapiens MTD protein.
          Length = 61

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 17/56 (30%), Positives = 19/56 (33%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 12  SCTCAGSC--KCKECKCTSCKKSCCS-----CCPVGCAKCAQGCVCKGASEKCSCC 60


>AF348995-1|AAO32955.1|   61|Homo sapiens MTC protein.
          Length = 61

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 17/56 (30%), Positives = 19/56 (33%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 12  SCTCTGSC--KCKECKCTSCKKSCCS-----CCPMSCAKCAQGCICKGASEKCSCC 60


>AF328769-1|AAK58423.1|  746|Homo sapiens
           PC2-glutamine-rich-associated protein protein.
          Length = 746

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 16/63 (25%), Positives = 34/63 (53%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + +   + ++Q   ++ +Q +     QQ+  HL++    Q + Q+ +QQ +
Sbjct: 179 QQQQQQQQQQFQAQQSAMQQQFQAVVQQQQQLQQQQQQQQHLIKLHH-QNQQQIQQQQQQ 237

Query: 258 LHR 250
           L R
Sbjct: 238 LQR 240


>AF078844-1|AAF23355.1|  122|Homo sapiens hqp0376 protein protein.
          Length = 122

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 18/69 (26%), Positives = 24/69 (34%), Gaps = 3/69 (4%)
 Frame = +2

Query: 230 PSLLP*PLCN---SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASG 400
           P L   P C+    + C+ + + +C  C    C  SCC      CC      C       
Sbjct: 58  PRLAMDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCS-----CCPVGCSKCAQGCVCK 112

Query: 401 SLHSPCSCC 427
                CSCC
Sbjct: 113 GASEKCSCC 121


>AF056191-1|AAC12944.1|  579|Homo sapiens TPA inducible protein
           protein.
          Length = 579

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 16/63 (25%), Positives = 34/63 (53%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + +   + ++Q   ++ +Q +     QQ+  HL++    Q + Q+ +QQ +
Sbjct: 153 QQQQQQQQQQFQAQQSAMQQQFQAVVQQQQQLQQQQQQQQHLIKLHH-QNQQQIQQQQQQ 211

Query: 258 LHR 250
           L R
Sbjct: 212 LQR 214


>AB075861-1|BAB85567.1|  863|Homo sapiens KIAA1981 protein protein.
          Length = 863

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 21/64 (32%), Positives = 33/64 (51%)
 Frame = -1

Query: 429 MQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHR 250
           ++QE+G   + + GLEQH+    +Q   P   +    H+LE+Q VQ   QL  ++ E   
Sbjct: 320 LRQERGRLLQKIRGLEQHKEQ--RQQESP---EASSLHILERQ-VQELQQLLVERQEEKE 373

Query: 249 GYGR 238
             GR
Sbjct: 374 SLGR 377


>X64834-1|CAA46046.1|   61|Homo sapiens metallothionein Ih protein.
          Length = 61

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 17/56 (30%), Positives = 19/56 (33%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 12  SCACAGSC--KCKKCKCTSCKKSCCS-----CCPLGCAKCAQGCICKGASEKCSCC 60


>X64177-1|CAA45516.1|   61|Homo sapiens metallothionein protein.
          Length = 61

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 17/56 (30%), Positives = 19/56 (33%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 12  SCACAGSC--KCKKCKCTSCKKSCCS-----CCPLGCAKCAQGCICKGASEKCSCC 60


>X14894-1|CAA33025.1|  255|Homo sapiens protein ( Human mRNA for
           myogenic factor Myf-5. ).
          Length = 255

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 1/64 (1%)
 Frame = +2

Query: 380 CSNPASGSLHSPCSCCIC-CRLPIWSSTSSTFPVWICTSVCSIDEKEHKAFLQRLKTKDL 556
           CS P S +  S CS  +  C  P+WS  SSTF    C  V ++   + K  L  L     
Sbjct: 153 CSEPTSPT--SNCSDGMPECNSPVWSRKSSTFDSIYCPDVSNVYATD-KNSLSSLDCLSN 209

Query: 557 LVDK 568
           +VD+
Sbjct: 210 IVDR 213


>M13003-1|AAA36213.1|   61|Homo sapiens protein ( Human
           metallothionein (MT)I-F gene, complete cds. ).
          Length = 61

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 17/56 (30%), Positives = 19/56 (33%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 12  SCTCAGSC--KCKECKCTSCKKSCCS-----CCPVGCSKCAQGCVCKGASEKCSCC 60


>M10943-1|AAA59588.1|   61|Homo sapiens MT1F protein.
          Length = 61

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 17/56 (30%), Positives = 19/56 (33%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 12  SCTCAGSC--KCKECKCTSCKKSCCS-----CCPVGCSKCAQGCVCKGASEKCSCC 60


>BX538201-1|CAD98066.1|  675|Homo sapiens hypothetical protein
           protein.
          Length = 675

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 14/54 (25%), Positives = 29/54 (53%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQR 289
           H   +Q  Q +Q + ++      Q QHS+ +Q +   + QQ++  + +QQ+ Q+
Sbjct: 101 HALQQQFHQLQQHQLQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQ 154


>BT019399-1|AAV38206.1|  255|Homo sapiens myogenic factor 5 protein.
          Length = 255

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 1/64 (1%)
 Frame = +2

Query: 380 CSNPASGSLHSPCSCCIC-CRLPIWSSTSSTFPVWICTSVCSIDEKEHKAFLQRLKTKDL 556
           CS P S +  S CS  +  C  P+WS  SSTF    C  V ++   + K  L  L     
Sbjct: 153 CSEPTSPT--SNCSDGMPECNSPVWSRKSSTFDSIYCPDVSNVYATD-KNSLSSLDCLSN 209

Query: 557 LVDK 568
           +VD+
Sbjct: 210 IVDR 213


>BT007171-1|AAP35835.1|   61|Homo sapiens metallothionein 1H
           protein.
          Length = 61

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 17/56 (30%), Positives = 19/56 (33%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 12  SCACAGSC--KCKKCKCTSCKKSCCS-----CCPLGCAKCAQGCICKGASEKCSCC 60


>BC133032-1|AAI33033.1|   61|Homo sapiens metallothionein 1
           pseudogene 2 protein.
          Length = 61

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 17/56 (30%), Positives = 19/56 (33%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 12  SYACAGSC--KCKKCKCTSCKKSCCS-----CCPLGCAKCAQGCIRKGASEKCSCC 60


>BC133030-1|AAI33031.1|   61|Homo sapiens metallothionein 1
           pseudogene 2 protein.
          Length = 61

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 17/56 (30%), Positives = 19/56 (33%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 12  SYACAGSC--KCKKCKCTSCKKSCCS-----CCPLGCAKCAQGCIRKGASEKCSCC 60


>BC119707-1|AAI19708.1|  106|Homo sapiens late cornified envelope 2A
           protein.
          Length = 106

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 19/63 (30%), Positives = 25/63 (39%), Gaps = 3/63 (4%)
 Frame = +2

Query: 221 QHRPSLLP*PLCNSIC---CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNP 391
           Q++    P P C   C   C   C  +C   C     +SCC  S   CC +    CCS+ 
Sbjct: 5   QNQQQCQPPPKCPPKCPPKCPPKCRPQCPAPCPPPV-SSCCGPSSGGCCGSSSGGCCSSG 63

Query: 392 ASG 400
             G
Sbjct: 64  GGG 66


>BC069373-1|AAH69373.1|  255|Homo sapiens myogenic factor 5 protein.
          Length = 255

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 1/64 (1%)
 Frame = +2

Query: 380 CSNPASGSLHSPCSCCIC-CRLPIWSSTSSTFPVWICTSVCSIDEKEHKAFLQRLKTKDL 556
           CS P S +  S CS  +  C  P+WS  SSTF    C  V ++   + K  L  L     
Sbjct: 153 CSEPTSPT--SNCSDGMPECNSPVWSRKSSTFDSIYCPDVSNVYATD-KNSLSSLDCLSN 209

Query: 557 LVDK 568
           +VD+
Sbjct: 210 IVDR 213


>BC059780-1|AAH59780.1|   61|Homo sapiens metallothionein 1H
           protein.
          Length = 61

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 17/56 (30%), Positives = 19/56 (33%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 12  SCACAGSC--KCKKCKCTSCKKSCCS-----CCPLGCAKCAQGCICKGASEKCSCC 60


>BC033781-1|AAH33781.1|  757|Homo sapiens PAXIP1 protein protein.
          Length = 757

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 14/54 (25%), Positives = 29/54 (53%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQR 289
           H   +Q  Q +Q + ++      Q QHS+ +Q +   + QQ++  + +QQ+ Q+
Sbjct: 183 HALQQQFHQLQQHQLQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQ 236


>BC029453-1|AAH29453.1|   61|Homo sapiens metallothionein 1F
           protein.
          Length = 61

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 17/56 (30%), Positives = 19/56 (33%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 12  SCTCAGSC--KCKECKCTSCKKSCCS-----CCPVGCSKCAQGCVCKGASEKCSCC 60


>BC008408-1|AAH08408.1|   61|Homo sapiens metallothionein 1H
           protein.
          Length = 61

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 17/56 (30%), Positives = 19/56 (33%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 12  SCACAGSC--KCKKCKCTSCKKSCCS-----CCPLGCAKCAQGCICKGASEKCSCC 60


>AL353779-6|CAI20980.1|  118|Homo sapiens late cornified envelope 1E
           protein.
          Length = 118

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 18/54 (33%), Positives = 23/54 (42%), Gaps = 3/54 (5%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRC---TFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASG 400
           P C +  C   C  +C   + CCS   G  CC SS    C +    CCS+   G
Sbjct: 22  PKCPTPKCPPKCPPKCPPVSSCCSVSSG-GCCGSSSGGSCGSSSGGCCSSGGGG 74


>AL139247-7|CAI21685.1|  106|Homo sapiens late cornified envelope 2A
           protein.
          Length = 106

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 19/63 (30%), Positives = 25/63 (39%), Gaps = 3/63 (4%)
 Frame = +2

Query: 221 QHRPSLLP*PLCNSIC---CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNP 391
           Q++    P P C   C   C   C  +C   C     +SCC  S   CC +    CCS+ 
Sbjct: 5   QNQQQCQPPPKCPPKCPPKCPPKCRPQCPAPCPPPV-SSCCGPSSGGCCGSSSGGCCSSG 63

Query: 392 ASG 400
             G
Sbjct: 64  GGG 66


>AK123600-1|BAC85657.1| 1035|Homo sapiens  mRNA.  protein.
          Length = 1035

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 14/54 (25%), Positives = 29/54 (53%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQR 289
           H   +Q  Q +Q + ++      Q QHS+ +Q +   + QQ++  + +QQ+ Q+
Sbjct: 461 HALQQQFHQLQQHQLQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQ 514


>AK123044-1|BAC85523.1|  548|Homo sapiens PTIP mRNA.  protein.
          Length = 548

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 14/54 (25%), Positives = 29/54 (53%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQR 289
           H   +Q  Q +Q + ++      Q QHS+ +Q +   + QQ++  + +QQ+ Q+
Sbjct: 404 HALQQQFHQLQQHQLQQQQLAQLQQQHSLLQQQQQQQIQQQQLQRMHQQQQQQQ 457


>AF333388-1|AAK18278.1|   61|Homo sapiens metallothionein 1H-like
           protein protein.
          Length = 61

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 17/56 (30%), Positives = 19/56 (33%)
 Frame = +2

Query: 260 SICCSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           S  C+ SC  +C  C    C  SCC      CC      C            CSCC
Sbjct: 12  SYACAGSC--KCKKCKCTSCKKSCCS-----CCPLGCAKCAQGCIRKGASEKCSCC 60


>AB058676-1|BAB47409.1| 1140|Homo sapiens MEGF10 protein (KIAA1780)
           protein.
          Length = 1140

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 12/35 (34%), Positives = 16/35 (45%)
 Frame = +2

Query: 254 CNSICCSYSCTLRCTFCCSNRCGTSCCPSSGILCC 358
           C+S+C        C+  C  + G SC P  GI  C
Sbjct: 568 CDSVCAEGRWGPNCSLPCYCKNGASCSPDDGICEC 602


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 72,911,174
Number of Sequences: 237096
Number of extensions: 1564372
Number of successful extensions: 9881
Number of sequences better than 10.0: 236
Number of HSP's better than 10.0 without gapping: 6297
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8265
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6916500330
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).