SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0027
         (611 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF219939-1|AAF43006.1|  931|Homo sapiens diacylglycerol kinase i...    32   1.8  
AF061936-1|AAC62010.1| 1065|Homo sapiens diacylglycerol kinase i...    32   1.8  
AB209167-1|BAD92404.1|  871|Homo sapiens diacylglycerol kinase, ...    32   1.8  

>AF219939-1|AAF43006.1|  931|Homo sapiens diacylglycerol kinase iota
           protein.
          Length = 931

 Score = 31.9 bits (69), Expect = 1.8
 Identities = 18/49 (36%), Positives = 23/49 (46%)
 Frame = +3

Query: 102 RRNCLVNKDILYFRCIFFLYFCNKRCL*TSTRGGARYPIRPIVSRITIH 248
           RR C V K +++  CI  L   N RC  T   GG+R P    V    +H
Sbjct: 73  RRKCAVCKIVVHTACIEQLEKINFRCKPTFREGGSRSPRENFVRHHWVH 121


>AF061936-1|AAC62010.1| 1065|Homo sapiens diacylglycerol kinase iota
           protein.
          Length = 1065

 Score = 31.9 bits (69), Expect = 1.8
 Identities = 18/49 (36%), Positives = 23/49 (46%)
 Frame = +3

Query: 102 RRNCLVNKDILYFRCIFFLYFCNKRCL*TSTRGGARYPIRPIVSRITIH 248
           RR C V K +++  CI  L   N RC  T   GG+R P    V    +H
Sbjct: 207 RRKCAVCKIVVHTACIEQLEKINFRCKPTFREGGSRSPRENFVRHHWVH 255


>AB209167-1|BAD92404.1|  871|Homo sapiens diacylglycerol kinase,
           iota variant protein.
          Length = 871

 Score = 31.9 bits (69), Expect = 1.8
 Identities = 18/49 (36%), Positives = 23/49 (46%)
 Frame = +3

Query: 102 RRNCLVNKDILYFRCIFFLYFCNKRCL*TSTRGGARYPIRPIVSRITIH 248
           RR C V K +++  CI  L   N RC  T   GG+R P    V    +H
Sbjct: 44  RRKCAVCKIVVHTACIEQLEKINFRCKPTFREGGSRSPRENFVRHHWVH 92


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 91,042,804
Number of Sequences: 237096
Number of extensions: 1957563
Number of successful extensions: 10965
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 10857
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10965
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6522878360
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).