SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0026
         (630 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X04098-1|CAA27723.1|  375|Homo sapiens gamma-actin protein.           193   4e-49
X00351-1|CAA25099.1|  375|Homo sapiens protein ( Human mRNA for ...   193   4e-49
M19283-1|AAA51579.1|  375|Homo sapiens ACTG1 protein.                 193   4e-49
M10277-1|AAA51567.1|  375|Homo sapiens protein ( Human cytoplasm...   193   4e-49
DQ471327-1|ABF01018.1|  375|Homo sapiens PS1TP5-binding protein ...   193   4e-49
BT019856-1|AAV38659.1|  375|Homo sapiens actin, gamma 1 protein.      193   4e-49
BC053572-1|AAH53572.1|  375|Homo sapiens actin, gamma 1 protein.      193   4e-49
BC018774-1|AAH18774.1|  375|Homo sapiens ACTG1 protein protein.       193   4e-49
BC017450-1|AAH17450.1|  363|Homo sapiens Unknown (protein for IM...   193   4e-49
BC015779-1|AAH15779.1|  375|Homo sapiens ACTG1 protein protein.       193   4e-49
BC015695-1|AAH15695.1|  375|Homo sapiens actin, gamma 1 protein.      193   4e-49
BC015005-1|AAH15005.1|  375|Homo sapiens ACTG1 protein protein.       193   4e-49
BC014861-1|AAH14861.1|  375|Homo sapiens actin, beta protein.         193   4e-49
BC013380-1|AAH13380.1|  375|Homo sapiens actin, beta protein.         193   4e-49
BC012050-1|AAH12050.1|  375|Homo sapiens actin, gamma 1 protein.      193   4e-49
BC010999-1|AAH10999.1|  375|Homo sapiens actin, gamma 1 protein.      193   4e-49
BC009848-1|AAH09848.1|  375|Homo sapiens actin, gamma 1 protein.      193   4e-49
BC008633-1|AAH08633.1|  368|Homo sapiens actin, beta protein.         193   4e-49
BC007442-1|AAH07442.1|  375|Homo sapiens actin, gamma 1 protein.      193   4e-49
BC004251-1|AAH04251.1|  375|Homo sapiens actin, beta protein.         193   4e-49
BC002409-1|AAH02409.1|  375|Homo sapiens actin, beta protein.         193   4e-49
BC001920-1|AAH01920.1|  375|Homo sapiens ACTG1 protein protein.       193   4e-49
BC001301-1|AAH01301.1|  375|Homo sapiens actin, beta protein.         193   4e-49
BC000292-1|AAH00292.1|  375|Homo sapiens actin, gamma 1 protein.      193   4e-49
AY582799-1|AAS79319.1|  375|Homo sapiens actin, beta protein.         193   4e-49
AK223055-1|BAD96775.1|  375|Homo sapiens beta actin variant prot...   193   4e-49
AK223032-1|BAD96752.1|  375|Homo sapiens beta actin variant prot...   193   4e-49
AK222925-1|BAD96645.1|  375|Homo sapiens beta actin variant prot...   193   4e-49
AC006483-1|AAP22343.1|  375|Homo sapiens unknown protein.             193   4e-49
X63432-1|CAA45026.1|  375|Homo sapiens mutant beta-actin  (beta'...   192   9e-49
BC016045-1|AAH16045.1|  375|Homo sapiens actin, beta protein.         191   2e-48
BC012854-1|AAH12854.1|  360|Homo sapiens ACTB protein protein.        190   3e-48
M20543-1|AAA60296.1|  377|Homo sapiens ACTA1 protein.                 188   1e-47
J00073-1|AAB59619.1|  377|Homo sapiens alpha-cardiac actin protein.   188   1e-47
J00068-1|AAB59376.1|  377|Homo sapiens ACTA1 protein.                 188   1e-47
CR541796-1|CAG46595.1|  377|Homo sapiens ACTA1 protein.               188   1e-47
CR541795-1|CAG46594.1|  377|Homo sapiens ACTC protein.                188   1e-47
CR536516-1|CAG38754.1|  377|Homo sapiens ACTA1 protein.               188   1e-47
BC012597-1|AAH12597.1|  377|Homo sapiens actin, alpha 1, skeleta...   188   1e-47
BC009978-1|AAH09978.1|  377|Homo sapiens actin, alpha, cardiac m...   188   1e-47
AL160004-6|CAI19050.1|  377|Homo sapiens actin, alpha 1, skeleta...   188   1e-47
AF182035-1|AAF02694.1|  377|Homo sapiens skeletal muscle alpha-a...   188   1e-47
X16940-1|CAA34814.1|  376|Homo sapiens protein ( Human mRNA for ...   187   3e-47
X13839-1|CAA32064.1|  377|Homo sapiens protein ( Human mRNA for ...   187   3e-47
K01747-1|AAA51586.1|  330|Homo sapiens ACTA2 protein.                 187   3e-47
J05192-1|AAA51577.1|  377|Homo sapiens ACTA3 protein.                 187   3e-47
D00654-1|BAA00546.1|  376|Homo sapiens enteric smooth muscle gam...   187   3e-47
CR541794-1|CAG46593.1|  376|Homo sapiens ACTG2 protein.               187   3e-47
CR536518-1|CAG38756.1|  377|Homo sapiens ACTA2 protein.               187   3e-47
BC094877-1|AAH94877.1|  376|Homo sapiens ACTG2 protein protein.       187   3e-47
BC093052-1|AAH93052.1|  377|Homo sapiens actin, alpha 2, smooth ...   187   3e-47
BC017554-1|AAH17554.1|  377|Homo sapiens actin, alpha 2, smooth ...   187   3e-47
BC012617-1|AAH12617.1|  376|Homo sapiens actin, gamma 2, smooth ...   187   3e-47
AY692464-1|AAW29811.1|  377|Homo sapiens growth-inhibiting gene ...   187   3e-47
AL157394-6|CAI13864.1|  377|Homo sapiens actin, alpha 2, smooth ...   187   3e-47
AC073046-2|AAX88909.1|  376|Homo sapiens unknown protein.             187   3e-47
CR536515-1|CAG38753.1|  376|Homo sapiens ACTG2 protein.               186   6e-47
EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin prot...   183   4e-46
AY280960-1|AAP37280.1|  254|Homo sapiens actin alpha 1 skeletal ...   183   5e-46
AL157394-7|CAI13865.1|  151|Homo sapiens actin, alpha 2, smooth ...   181   2e-45
EF095209-1|ABL01513.1|  121|Homo sapiens beta-actin protein.          159   1e-38
AY970420-1|AAX82229.1|  103|Homo sapiens actin-like protein prot...   144   2e-34
AY970501-1|AAX82307.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970498-1|AAX82304.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970497-1|AAX82303.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970495-1|AAX82301.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970494-1|AAX82300.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970493-1|AAX82299.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970491-1|AAX82297.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970489-1|AAX82295.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970488-1|AAX82294.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970487-1|AAX82293.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970486-1|AAX82292.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970478-1|AAX82284.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970477-1|AAX82283.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970476-1|AAX82282.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970474-1|AAX82280.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970473-1|AAX82279.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970472-1|AAX82278.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970471-1|AAX82277.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970470-1|AAX82276.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970469-1|AAX82275.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970468-1|AAX82274.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970443-1|AAX82252.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970441-1|AAX82250.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970419-1|AAX82228.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970418-1|AAX82227.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970417-1|AAX82226.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970416-1|AAX82225.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970415-1|AAX82224.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970414-1|AAX82223.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970413-1|AAX82222.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970412-1|AAX82221.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970411-1|AAX82220.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970410-1|AAX82219.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970409-1|AAX82218.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970408-1|AAX82217.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970406-1|AAX82215.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970405-1|AAX82214.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970404-1|AAX82213.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970403-1|AAX82212.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970402-1|AAX82211.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970383-1|AAX82192.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970382-1|AAX82191.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970381-1|AAX82190.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970380-1|AAX82189.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970377-1|AAX82186.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970376-1|AAX82185.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970375-1|AAX82184.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970372-1|AAX82182.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970371-1|AAX82181.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970370-1|AAX82180.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970369-1|AAX82179.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970368-1|AAX82178.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970366-1|AAX82176.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970364-1|AAX82174.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970363-1|AAX82173.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970421-1|AAX82230.1|  103|Homo sapiens actin-like protein prot...   143   4e-34
AY970492-1|AAX82298.1|  103|Homo sapiens actin-like protein prot...   142   7e-34
AY970490-1|AAX82296.1|  103|Homo sapiens actin-like protein prot...   142   9e-34
AY970444-1|AAX82253.1|  103|Homo sapiens actin-like protein prot...   142   9e-34
AY970367-1|AAX82177.1|  103|Homo sapiens actin-like protein prot...   142   9e-34
AY970500-1|AAX82306.1|  103|Homo sapiens actin-like protein prot...   142   1e-33
AY970442-1|AAX82251.1|  103|Homo sapiens actin-like protein prot...   142   1e-33
AY970390-1|AAX82199.1|  103|Homo sapiens actin-like protein prot...   142   1e-33
AY970374-1|AAX82183.1|  103|Homo sapiens actin-like protein prot...   141   2e-33
AY970485-1|AAX82291.1|  103|Homo sapiens actin-like protein prot...   141   2e-33
AY970365-1|AAX82175.1|  103|Homo sapiens actin-like protein prot...   141   2e-33
AY970496-1|AAX82302.1|  103|Homo sapiens actin-like protein prot...   140   3e-33
AY970385-1|AAX82194.1|  103|Homo sapiens actin-like protein prot...   139   6e-33
AY970378-1|AAX82187.1|  103|Homo sapiens actin-like protein prot...   139   9e-33
AY970479-1|AAX82285.1|  103|Homo sapiens actin-like protein prot...   138   1e-32
AY970502-1|AAX82308.1|  103|Homo sapiens actin-like protein prot...   138   1e-32
AY970499-1|AAX82305.1|  103|Homo sapiens actin-like protein prot...   138   1e-32
AY970480-1|AAX82286.1|  103|Homo sapiens actin-like protein prot...   138   1e-32
AY970475-1|AAX82281.1|  103|Homo sapiens actin-like protein prot...   138   1e-32
AY970464-1|AAX82271.1|  103|Homo sapiens actin-like protein prot...   138   1e-32
AY970460-1|AAX82267.1|  103|Homo sapiens actin-like protein prot...   138   1e-32
AY970457-1|AAX82264.1|  103|Homo sapiens actin-like protein prot...   138   1e-32
AY970431-1|AAX82240.1|  103|Homo sapiens actin-like protein prot...   138   1e-32
AY970430-1|AAX82239.1|  103|Homo sapiens actin-like protein prot...   138   1e-32
AY970428-1|AAX82237.1|  103|Homo sapiens actin-like protein prot...   138   1e-32
AY970389-1|AAX82198.1|  103|Homo sapiens actin-like protein prot...   138   1e-32
AY970386-1|AAX82195.1|  103|Homo sapiens actin-like protein prot...   138   1e-32
AY970483-1|AAX82289.1|  103|Homo sapiens actin-like protein prot...   138   2e-32
AY970446-1|AAX82255.1|  103|Homo sapiens actin-like protein prot...   138   2e-32
AY970440-1|AAX82249.1|  103|Homo sapiens actin-like protein prot...   138   2e-32
AY970439-1|AAX82248.1|  103|Homo sapiens actin-like protein prot...   138   2e-32
AY970424-1|AAX82233.1|  103|Homo sapiens actin-like protein prot...   137   3e-32
AY970407-1|AAX82216.1|  103|Homo sapiens actin-like protein prot...   137   3e-32
AY970458-1|AAX82265.1|  103|Homo sapiens actin-like protein prot...   136   5e-32
AY970456-1|AAX82263.1|  103|Homo sapiens actin-like protein prot...   136   5e-32
AY970429-1|AAX82238.1|  103|Homo sapiens actin-like protein prot...   136   5e-32
AY970388-1|AAX82197.1|  103|Homo sapiens actin-like protein prot...   136   5e-32
AY970387-1|AAX82196.1|  103|Homo sapiens actin-like protein prot...   136   5e-32
AY970463-1|AAX82270.1|  103|Homo sapiens actin-like protein prot...   136   6e-32
AY970432-1|AAX82241.1|  103|Homo sapiens actin-like protein prot...   136   6e-32
AY970392-1|AAX82201.1|  103|Homo sapiens actin-like protein prot...   136   6e-32
AY970391-1|AAX82200.1|  103|Homo sapiens actin-like protein prot...   136   8e-32
AY970384-1|AAX82193.1|  103|Homo sapiens actin-like protein prot...   136   8e-32
AY970462-1|AAX82269.1|  103|Homo sapiens actin-like protein prot...   135   1e-31
AY970451-1|AAX82259.1|  103|Homo sapiens actin-like protein prot...   135   1e-31
AY970454-1|AAX82261.1|  103|Homo sapiens actin-like protein prot...   135   1e-31
AY970455-1|AAX82262.1|  103|Homo sapiens actin-like protein prot...   134   2e-31
AY970426-1|AAX82235.1|  103|Homo sapiens actin-like protein prot...   134   2e-31
AY970452-1|AAX82260.1|  103|Homo sapiens actin-like protein prot...   133   4e-31
AY970433-1|AAX82242.1|  103|Homo sapiens actin-like protein prot...   132   7e-31
AY970461-1|AAX82268.1|  103|Homo sapiens actin-like protein prot...   132   1e-30
X82208-1|CAA57692.1|  329|Homo sapiens beta-centractin protein.       130   3e-30
X82207-1|CAA57691.1|  376|Homo sapiens beta-centracetin protein.      130   3e-30
BC010090-1|AAH10090.1|  376|Homo sapiens ARP1 actin-related prot...   130   3e-30
BC006372-1|AAH06372.1|  376|Homo sapiens ARP1 actin-related prot...   130   3e-30
BC004374-1|AAH04374.1|  376|Homo sapiens ARP1 actin-related prot...   130   3e-30
AC017099-2|AAY24280.1|  376|Homo sapiens unknown protein.             130   3e-30
AY970427-1|AAX82236.1|  103|Homo sapiens actin-like protein prot...   130   4e-30
AY970398-1|AAX82207.1|  103|Homo sapiens actin-like protein prot...   130   4e-30
Z14978-1|CAA78701.1|  376|Homo sapiens actin-related protein pro...   129   9e-30
X82206-1|CAA57690.1|  376|Homo sapiens alpha-centractin protein.      129   9e-30
BC026016-1|AAH26016.1|  376|Homo sapiens ARP1 actin-related prot...   129   9e-30
BC000693-1|AAH00693.1|  376|Homo sapiens ARP1 actin-related prot...   129   9e-30
AY970447-1|AAX82256.1|  103|Homo sapiens actin-like protein prot...   129   9e-30
AL121928-12|CAC08404.1|  376|Homo sapiens ARP1 actin-related pro...   129   9e-30
AL160004-4|CAI19051.1|  287|Homo sapiens actin, alpha 1, skeleta...   128   2e-29
AY970425-1|AAX82234.1|  103|Homo sapiens actin-like protein prot...   127   3e-29
AY970481-1|AAX82287.1|  103|Homo sapiens actin-like protein prot...   126   5e-29
AY970459-1|AAX82266.1|  103|Homo sapiens actin-like protein prot...   126   5e-29
AY970400-1|AAX82209.1|  103|Homo sapiens actin-like protein prot...   126   5e-29
AY129015-1|AAM98758.1|  109|Homo sapiens unknown protein.             126   9e-29
AY970467-1|AAX82273.1|  103|Homo sapiens actin-like protein prot...   125   1e-28
AY970448-1|AAX82257.1|  103|Homo sapiens actin-like protein prot...   125   1e-28
AY970401-1|AAX82210.1|  103|Homo sapiens actin-like protein prot...   125   1e-28
AY970422-1|AAX82231.1|  103|Homo sapiens actin-like protein prot...   124   2e-28
AY970423-1|AAX82232.1|  103|Homo sapiens actin-like protein prot...   123   5e-28
AY970379-1|AAX82188.1|  103|Homo sapiens actin-like protein prot...   123   5e-28
AY970445-1|AAX82254.1|  103|Homo sapiens actin-like protein prot...   122   8e-28
AY970396-1|AAX82205.1|  103|Homo sapiens actin-like protein prot...   122   1e-27
AY970484-1|AAX82290.1|  103|Homo sapiens actin-like protein prot...   120   4e-27
AL160004-5|CAI19052.1|  342|Homo sapiens actin, alpha 1, skeleta...   120   4e-27
AY970395-1|AAX82204.1|  103|Homo sapiens actin-like protein prot...   118   1e-26
AY970438-1|AAX82247.1|  103|Homo sapiens actin-like protein prot...   116   7e-26
AY970465-1|AAX82272.1|  103|Homo sapiens actin-like protein prot...   116   9e-26
AY970437-1|AAX82246.1|  103|Homo sapiens actin-like protein prot...   114   3e-25
AY970397-1|AAX82206.1|  103|Homo sapiens actin-like protein prot...   112   9e-25
AY970503-1|AAX82309.1|  103|Homo sapiens actin-like protein prot...   112   1e-24
AY970394-1|AAX82203.1|  103|Homo sapiens actin-like protein prot...   111   1e-24
AY970436-1|AAX82245.1|  103|Homo sapiens actin-like protein prot...   111   2e-24
AY970434-1|AAX82243.1|  103|Homo sapiens actin-like protein prot...   111   2e-24
Z74696-1|CAI42428.1|  376|Homo sapiens actin-related protein T1 ...   111   3e-24
BC014597-1|AAH14597.1|  376|Homo sapiens actin-related protein T...   111   3e-24
AF440739-1|AAM00432.1|  376|Homo sapiens actin-related protein T...   111   3e-24
AY970450-1|AAX82258.1|  102|Homo sapiens actin-like protein prot...   110   5e-24
BC029499-1|AAH29499.1|  376|Homo sapiens actin-related protein T...   109   1e-23
AY970393-1|AAX82202.1|  103|Homo sapiens actin-like protein prot...   109   1e-23
AL356984-1|CAH72587.1|  377|Homo sapiens actin-related protein M...   109   1e-23
AK058153-1|BAB71690.1|  328|Homo sapiens protein ( Homo sapiens ...   109   1e-23
AF440740-1|AAM00433.1|  377|Homo sapiens actin-related protein T...   109   1e-23
AB057364-1|BAB85862.1|  377|Homo sapiens actin-related protein h...   109   1e-23
AY970482-1|AAX82288.1|  103|Homo sapiens actin-like protein prot...   108   1e-23
BC036253-1|AAH36253.1|  339|Homo sapiens ACTR2 protein protein.       108   2e-23
AF006082-1|AAB64187.1|  394|Homo sapiens Arp2 protein.                108   2e-23
AY970435-1|AAX82244.1|  103|Homo sapiens actin-like protein prot...   107   2e-23
BC014546-1|AAH14546.1|  394|Homo sapiens ARP2 actin-related prot...   105   2e-22
AK055346-1|BAB70906.1|  372|Homo sapiens protein ( Homo sapiens ...   105   2e-22
AB049117-1|BAB39481.1|  372|Homo sapiens actin related protein p...   105   2e-22
BC014610-1|AAH14610.1|  435|Homo sapiens actin-like 7A protein.       103   5e-22
AL359692-4|CAI40571.1|  435|Homo sapiens actin-like 7A protein.       103   5e-22
AF113526-1|AAD44109.1|  435|Homo sapiens actin-like-7-alpha prot...   103   5e-22
AB284520-1|BAF41971.1|  435|Homo sapiens human t-actin 2 protein.     103   5e-22
BC007289-1|AAH07289.1|  372|Homo sapiens actin related protein M...    99   6e-21
BC033789-1|AAH33789.1|  415|Homo sapiens actin-like 7B protein.        99   1e-20
AL359692-3|CAI40570.1|  415|Homo sapiens actin-like 7B protein.        99   1e-20
AF113527-1|AAD44110.1|  415|Homo sapiens actin-like-7-beta protein.    99   1e-20
AB284521-1|BAF41972.1|  415|Homo sapiens t-actin 1 protein.            99   1e-20
BC045752-1|AAH45752.1|  416|Homo sapiens hypothetical protein MG...    97   3e-20
BC024028-1|AAH24028.1|  416|Homo sapiens hypothetical protein MG...    97   3e-20
AY970399-1|AAX82208.1|   97|Homo sapiens actin-like protein prot...    97   5e-20
BC044590-1|AAH44590.1|  418|Homo sapiens ARP3 actin-related prot...    94   3e-19
AF127773-1|AAD51904.1|  418|Homo sapiens unknown protein.              94   3e-19
AF006083-1|AAB64188.1|  418|Homo sapiens Arp3 protein.                 94   3e-19
AC110769-1|AAX93226.1|  418|Homo sapiens unknown protein.              94   3e-19
AB209353-1|BAD92590.1|  369|Homo sapiens ARP3 actin-related prot...    94   3e-19
BC015207-1|AAH15207.1|  348|Homo sapiens ARP3 actin-related prot...    94   4e-19
BC008682-1|AAH08682.1|  418|Homo sapiens ARP3 actin-related prot...    94   4e-19
AF086920-1|AAP97150.1|  402|Homo sapiens actin related protein A...    94   4e-19
AF023453-1|AAC98904.1|  418|Homo sapiens actin-related protein 3...    94   4e-19
BC020944-1|AAH20944.1|  426|Homo sapiens actin-like 6B protein.        84   3e-16
AF053356-5|AAC78795.1|  475|Homo sapiens actin like gene protein.      84   3e-16
AF041475-1|AAD54678.1|  426|Homo sapiens BAF53b protein.               84   3e-16
AC099394-1|AAP21874.1|  426|Homo sapiens unknown protein.              84   3e-16
AB015906-1|BAA74576.1|  426|Homo sapiens actin-related protein h...    84   3e-16
BC036371-1|AAH36371.1|  429|Homo sapiens actin-like 6A protein.        84   5e-16
BC001391-1|AAH01391.1|  429|Homo sapiens actin-like 6A protein.        84   5e-16
BC000949-1|AAH00949.1|  387|Homo sapiens actin-like 6A protein.        84   5e-16
AK223212-1|BAD96932.1|  429|Homo sapiens actin-like 6A isoform 1...    84   5e-16
AF041474-1|AAC94991.1|  429|Homo sapiens BAF53a protein.               84   5e-16
AB061315-1|BAB87848.1|  387|Homo sapiens hArpNbeta-s protein.          84   5e-16
AB060168-1|BAB87844.1|  387|Homo sapiens hArpNbeta-s protein.          84   5e-16
AB015907-1|BAA74577.1|  429|Homo sapiens actin-related protein h...    84   5e-16
BC113036-1|AAI13037.1|  103|Homo sapiens ACTB protein protein.         83   6e-16
CR533529-1|CAG38560.1|  429|Homo sapiens BAF53A protein.               83   8e-16
BC023548-1|AAH23548.1|  263|Homo sapiens ACTG1 protein protein.        78   2e-14
BC028909-1|AAH28909.1|  366|Homo sapiens actin-like 8 protein.         76   9e-14
AL136529-1|CAC15940.1|  366|Homo sapiens actin-like 8 protein.         76   9e-14
AK057339-1|BAB71434.1|  366|Homo sapiens protein ( Homo sapiens ...    76   9e-14
BC038402-1|AAH38402.1|  607|Homo sapiens ARP5 actin-related prot...    47   6e-05
AY211911-1|AAO65164.1|  280|Homo sapiens sarcoma antigen NY-SAR-...    47   6e-05
AL133519-2|CAD37358.1|  607|Homo sapiens ARP5 actin-related prot...    47   6e-05
AK022847-1|BAB14270.1|  607|Homo sapiens protein ( Homo sapiens ...    47   6e-05
U20582-1|AAA62476.1|  302|Homo sapiens protein ( Human actin-lik...    44   6e-04
M16247-1|AAA51580.1|  232|Homo sapiens ACTG1 protein.                  42   0.001
BC004223-1|AAH04223.2|   32|Homo sapiens ACTG1 protein protein.        41   0.003
BC015107-1|AAH15107.1|  396|Homo sapiens ARP6 actin-related prot...    40   0.007
AK222959-1|BAD96679.1|  396|Homo sapiens ARP6 actin-related prot...    40   0.007
AK023495-1|BAB14588.1|  396|Homo sapiens protein ( Homo sapiens ...    40   0.007
AF212251-1|AAK14934.1|  396|Homo sapiens CDA12 protein.                40   0.007
AB038229-1|BAB20762.1|  396|Homo sapiens hARPX protein.                40   0.007
BC011997-1|AAH11997.1|  417|Homo sapiens actin-related protein 1...    39   0.017
BC005208-1|AAH05208.1|  339|Homo sapiens Unknown (protein for IM...    39   0.017
AK222702-1|BAD96422.1|  417|Homo sapiens uncharacterized hypotha...    39   0.017
AK222624-1|BAD96344.1|  417|Homo sapiens uncharacterized hypotha...    39   0.017
AK022534-1|BAB14083.1|  417|Homo sapiens protein ( Homo sapiens ...    39   0.017
AK000544-1|BAA91243.1|  417|Homo sapiens protein ( Homo sapiens ...    39   0.017
AF220190-1|AAF67655.1|  417|Homo sapiens uncharacterized hypotha...    39   0.017
BC020234-1|AAH20234.1|  195|Homo sapiens Unknown (protein for MG...    38   0.022
AB039791-1|BAB21501.1|  210|Homo sapiens actin-related protein A...    38   0.039
K00790-1|AAA51578.1|   17|Homo sapiens ACTB protein.                   34   0.36 
AB209174-1|BAD92411.1|  282|Homo sapiens actin-related protein 3...    33   0.83 
BC065199-1|AAH65199.1|  453|Homo sapiens family with sequence si...    32   1.5  
BC037572-1|AAH37572.1|  453|Homo sapiens family with sequence si...    32   1.5  
AF123073-1|AAK01477.1|  453|Homo sapiens C/EBP-induced protein p...    32   1.5  
BC146794-1|AAI46795.1| 1919|Homo sapiens discs, large homolog 5 ...    31   2.5  
BC073996-1|AAH73996.1|  845|Homo sapiens DLG5 protein protein.         31   2.5  
AL450306-3|CAI17324.2| 1919|Homo sapiens discs, large homolog 5 ...    31   2.5  
AL450306-2|CAI17323.1|  880|Homo sapiens discs, large homolog 5 ...    31   2.5  
AL391421-2|CAI12104.2| 1919|Homo sapiens discs, large homolog 5 ...    31   2.5  
AL391421-1|CAI12103.1|  880|Homo sapiens discs, large homolog 5 ...    31   2.5  
AF352034-1|AAL83938.1| 1809|Homo sapiens DLG5 protein.                 31   2.5  
AF352033-1|AAL83937.1| 1809|Homo sapiens DLG5 protein.                 31   2.5  
AB091676-1|BAC65420.1| 1764|Homo sapiens discs large protein lp-...    31   2.5  
AB011155-1|BAA25509.2| 1952|Homo sapiens KIAA0583 protein protein.     31   2.5  
BC104209-1|AAI04210.1|  195|Homo sapiens LOC147650 protein protein.    31   4.5  
BC104208-1|AAI04209.1|  211|Homo sapiens LOC147650 protein protein.    31   4.5  
AK093503-1|BAC04187.1|  637|Homo sapiens protein ( Homo sapiens ...    31   4.5  
AB089940-1|BAD02449.1|  998|Homo sapiens N-acetylgalactosaminylt...    31   4.5  

>X04098-1|CAA27723.1|  375|Homo sapiens gamma-actin protein.
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  127 bits (306), Expect = 4e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>X00351-1|CAA25099.1|  375|Homo sapiens protein ( Human mRNA for
           beta-actin. ).
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  126 bits (305), Expect = 5e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>M19283-1|AAA51579.1|  375|Homo sapiens ACTG1 protein.
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  127 bits (306), Expect = 4e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>M10277-1|AAA51567.1|  375|Homo sapiens protein ( Human cytoplasmic
           beta-actin gene, complete cds. ).
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  126 bits (305), Expect = 5e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>DQ471327-1|ABF01018.1|  375|Homo sapiens PS1TP5-binding protein 1
           protein.
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  126 bits (305), Expect = 5e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BT019856-1|AAV38659.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  127 bits (306), Expect = 4e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC053572-1|AAH53572.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  127 bits (306), Expect = 4e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC018774-1|AAH18774.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  127 bits (306), Expect = 4e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC017450-1|AAH17450.1|  363|Homo sapiens Unknown (protein for
           IMAGE:3538275) protein.
          Length = 363

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 49  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 108

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 109 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 160



 Score = 96.7 bits (230), Expect = 6e-20
 Identities = 44/44 (100%), Positives = 44/44 (100%)
 Frame = +1

Query: 124 KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 6   KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 49


>BC015779-1|AAH15779.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  127 bits (306), Expect = 4e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC015695-1|AAH15695.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  127 bits (306), Expect = 4e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC015005-1|AAH15005.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  127 bits (306), Expect = 4e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC014861-1|AAH14861.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  126 bits (305), Expect = 5e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC013380-1|AAH13380.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  126 bits (305), Expect = 5e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC012050-1|AAH12050.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  127 bits (306), Expect = 4e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC010999-1|AAH10999.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  127 bits (306), Expect = 4e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC009848-1|AAH09848.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  127 bits (306), Expect = 4e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC008633-1|AAH08633.1|  368|Homo sapiens actin, beta protein.
          Length = 368

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 54  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 113

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 114 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 165



 Score =  118 bits (284), Expect = 2e-26
 Identities = 54/54 (100%), Positives = 54/54 (100%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 1   LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 54


>BC007442-1|AAH07442.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  127 bits (306), Expect = 4e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC004251-1|AAH04251.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  126 bits (305), Expect = 5e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC002409-1|AAH02409.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  126 bits (305), Expect = 5e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC001920-1|AAH01920.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  127 bits (306), Expect = 4e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC001301-1|AAH01301.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  126 bits (305), Expect = 5e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC000292-1|AAH00292.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  127 bits (306), Expect = 4e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>AY582799-1|AAS79319.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  126 bits (305), Expect = 5e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>AK223055-1|BAD96775.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  126 bits (305), Expect = 5e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>AK223032-1|BAD96752.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  126 bits (305), Expect = 5e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>AK222925-1|BAD96645.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  126 bits (305), Expect = 5e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>AC006483-1|AAP22343.1|  375|Homo sapiens unknown protein.
          Length = 375

 Score =  193 bits (471), Expect = 4e-49
 Identities = 92/112 (82%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  126 bits (305), Expect = 5e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>X63432-1|CAA45026.1|  375|Homo sapiens mutant beta-actin
           (beta'-actin) protein.
          Length = 375

 Score =  192 bits (468), Expect = 9e-49
 Identities = 91/112 (81%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQA+LSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAMLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  126 bits (305), Expect = 5e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC016045-1|AAH16045.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  191 bits (466), Expect = 2e-48
 Identities = 91/112 (81%), Positives = 94/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRV PEEHPVLLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVPPEEHPVLLTEAPLNPKANREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 172



 Score =  126 bits (305), Expect = 5e-29
 Identities = 57/60 (95%), Positives = 60/60 (100%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>BC012854-1|AAH12854.1|  360|Homo sapiens ACTB protein protein.
          Length = 360

 Score =  190 bits (464), Expect = 3e-48
 Identities = 91/112 (81%), Positives = 94/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN EKMT
Sbjct: 46  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANLEKMT 105

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 106 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALP 157



 Score =  102 bits (244), Expect = 1e-21
 Identities = 46/46 (100%), Positives = 46/46 (100%)
 Frame = +1

Query: 118 MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 46


>M20543-1|AAA60296.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  188 bits (459), Expect = 1e-47
 Identities = 89/112 (79%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 123 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 174



 Score =  120 bits (289), Expect = 4e-27
 Identities = 57/63 (90%), Positives = 58/63 (92%), Gaps = 1/63 (1%)
 Frame = +1

Query: 70  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 247 QSK 255
           QSK
Sbjct: 61  QSK 63


>J00073-1|AAB59619.1|  377|Homo sapiens alpha-cardiac actin protein.
          Length = 377

 Score =  188 bits (459), Expect = 1e-47
 Identities = 89/112 (79%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 123 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 174



 Score =  120 bits (289), Expect = 4e-27
 Identities = 57/63 (90%), Positives = 58/63 (92%), Gaps = 1/63 (1%)
 Frame = +1

Query: 70  MCD-EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           MCD EE  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 247 QSK 255
           QSK
Sbjct: 61  QSK 63


>J00068-1|AAB59376.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  188 bits (459), Expect = 1e-47
 Identities = 89/112 (79%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 123 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 174



 Score =  120 bits (289), Expect = 4e-27
 Identities = 57/63 (90%), Positives = 58/63 (92%), Gaps = 1/63 (1%)
 Frame = +1

Query: 70  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 247 QSK 255
           QSK
Sbjct: 61  QSK 63


>CR541796-1|CAG46595.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  188 bits (459), Expect = 1e-47
 Identities = 89/112 (79%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 123 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 174



 Score =  120 bits (289), Expect = 4e-27
 Identities = 57/63 (90%), Positives = 58/63 (92%), Gaps = 1/63 (1%)
 Frame = +1

Query: 70  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 247 QSK 255
           QSK
Sbjct: 61  QSK 63


>CR541795-1|CAG46594.1|  377|Homo sapiens ACTC protein.
          Length = 377

 Score =  188 bits (459), Expect = 1e-47
 Identities = 89/112 (79%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 123 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 174



 Score =  120 bits (289), Expect = 4e-27
 Identities = 57/63 (90%), Positives = 58/63 (92%), Gaps = 1/63 (1%)
 Frame = +1

Query: 70  MCD-EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           MCD EE  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 247 QSK 255
           QSK
Sbjct: 61  QSK 63


>CR536516-1|CAG38754.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  188 bits (459), Expect = 1e-47
 Identities = 89/112 (79%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 123 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 174



 Score =  120 bits (289), Expect = 4e-27
 Identities = 57/63 (90%), Positives = 58/63 (92%), Gaps = 1/63 (1%)
 Frame = +1

Query: 70  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 247 QSK 255
           QSK
Sbjct: 61  QSK 63


>BC012597-1|AAH12597.1|  377|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 377

 Score =  188 bits (459), Expect = 1e-47
 Identities = 89/112 (79%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 123 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 174



 Score =  120 bits (289), Expect = 4e-27
 Identities = 57/63 (90%), Positives = 58/63 (92%), Gaps = 1/63 (1%)
 Frame = +1

Query: 70  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 247 QSK 255
           QSK
Sbjct: 61  QSK 63


>BC009978-1|AAH09978.1|  377|Homo sapiens actin, alpha, cardiac
           muscle 1 protein.
          Length = 377

 Score =  188 bits (459), Expect = 1e-47
 Identities = 89/112 (79%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 123 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 174



 Score =  120 bits (289), Expect = 4e-27
 Identities = 57/63 (90%), Positives = 58/63 (92%), Gaps = 1/63 (1%)
 Frame = +1

Query: 70  MCD-EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           MCD EE  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 247 QSK 255
           QSK
Sbjct: 61  QSK 63


>AL160004-6|CAI19050.1|  377|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 377

 Score =  188 bits (459), Expect = 1e-47
 Identities = 89/112 (79%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 123 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 174



 Score =  120 bits (289), Expect = 4e-27
 Identities = 57/63 (90%), Positives = 58/63 (92%), Gaps = 1/63 (1%)
 Frame = +1

Query: 70  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 247 QSK 255
           QSK
Sbjct: 61  QSK 63


>AF182035-1|AAF02694.1|  377|Homo sapiens skeletal muscle
           alpha-actin precursor protein.
          Length = 377

 Score =  188 bits (459), Expect = 1e-47
 Identities = 89/112 (79%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 123 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 174



 Score =  120 bits (289), Expect = 4e-27
 Identities = 57/63 (90%), Positives = 58/63 (92%), Gaps = 1/63 (1%)
 Frame = +1

Query: 70  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 247 QSK 255
           QSK
Sbjct: 61  QSK 63


>X16940-1|CAA34814.1|  376|Homo sapiens protein ( Human mRNA for
           enteric smooth muscle gamma-actin. ).
          Length = 376

 Score =  187 bits (455), Expect = 3e-47
 Identities = 88/112 (78%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 122 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 173



 Score =  127 bits (306), Expect = 4e-29
 Identities = 57/62 (91%), Positives = 59/62 (95%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>X13839-1|CAA32064.1|  377|Homo sapiens protein ( Human mRNA for
           vascular smooth muscle alpha-actin. ).
          Length = 377

 Score =  187 bits (455), Expect = 3e-47
 Identities = 88/112 (78%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 123 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 174



 Score =  122 bits (293), Expect = 1e-27
 Identities = 57/63 (90%), Positives = 60/63 (95%), Gaps = 1/63 (1%)
 Frame = +1

Query: 70  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 247 QSK 255
           QSK
Sbjct: 61  QSK 63


>K01747-1|AAA51586.1|  330|Homo sapiens ACTA2 protein.
          Length = 330

 Score =  187 bits (455), Expect = 3e-47
 Identities = 88/112 (78%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 123 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 174



 Score =  119 bits (286), Expect = 1e-26
 Identities = 56/63 (88%), Positives = 59/63 (93%), Gaps = 1/63 (1%)
 Frame = +1

Query: 70  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG EA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGHEA 60

Query: 247 QSK 255
           QSK
Sbjct: 61  QSK 63


>J05192-1|AAA51577.1|  377|Homo sapiens ACTA3 protein.
          Length = 377

 Score =  187 bits (455), Expect = 3e-47
 Identities = 88/112 (78%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 123 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 174



 Score =  122 bits (293), Expect = 1e-27
 Identities = 57/63 (90%), Positives = 60/63 (95%), Gaps = 1/63 (1%)
 Frame = +1

Query: 70  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 247 QSK 255
           QSK
Sbjct: 61  QSK 63


>D00654-1|BAA00546.1|  376|Homo sapiens enteric smooth muscle
           gamma-actin protein.
          Length = 376

 Score =  187 bits (455), Expect = 3e-47
 Identities = 88/112 (78%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 122 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 173



 Score =  127 bits (306), Expect = 4e-29
 Identities = 57/62 (91%), Positives = 59/62 (95%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>CR541794-1|CAG46593.1|  376|Homo sapiens ACTG2 protein.
          Length = 376

 Score =  187 bits (455), Expect = 3e-47
 Identities = 88/112 (78%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 122 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 173



 Score =  127 bits (306), Expect = 4e-29
 Identities = 57/62 (91%), Positives = 59/62 (95%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>CR536518-1|CAG38756.1|  377|Homo sapiens ACTA2 protein.
          Length = 377

 Score =  187 bits (455), Expect = 3e-47
 Identities = 88/112 (78%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 123 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 174



 Score =  122 bits (293), Expect = 1e-27
 Identities = 57/63 (90%), Positives = 60/63 (95%), Gaps = 1/63 (1%)
 Frame = +1

Query: 70  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 247 QSK 255
           QSK
Sbjct: 61  QSK 63


>BC094877-1|AAH94877.1|  376|Homo sapiens ACTG2 protein protein.
          Length = 376

 Score =  187 bits (455), Expect = 3e-47
 Identities = 88/112 (78%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 122 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 173



 Score =  127 bits (306), Expect = 4e-29
 Identities = 57/62 (91%), Positives = 59/62 (95%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>BC093052-1|AAH93052.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  187 bits (455), Expect = 3e-47
 Identities = 88/112 (78%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 123 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 174



 Score =  122 bits (293), Expect = 1e-27
 Identities = 57/63 (90%), Positives = 60/63 (95%), Gaps = 1/63 (1%)
 Frame = +1

Query: 70  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 247 QSK 255
           QSK
Sbjct: 61  QSK 63


>BC017554-1|AAH17554.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  187 bits (455), Expect = 3e-47
 Identities = 88/112 (78%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 123 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 174



 Score =  122 bits (293), Expect = 1e-27
 Identities = 57/63 (90%), Positives = 60/63 (95%), Gaps = 1/63 (1%)
 Frame = +1

Query: 70  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 247 QSK 255
           QSK
Sbjct: 61  QSK 63


>BC012617-1|AAH12617.1|  376|Homo sapiens actin, gamma 2, smooth
           muscle, enteric protein.
          Length = 376

 Score =  187 bits (455), Expect = 3e-47
 Identities = 88/112 (78%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 122 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 173



 Score =  127 bits (306), Expect = 4e-29
 Identities = 57/62 (91%), Positives = 59/62 (95%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>AY692464-1|AAW29811.1|  377|Homo sapiens growth-inhibiting gene 46
           protein.
          Length = 377

 Score =  187 bits (455), Expect = 3e-47
 Identities = 88/112 (78%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 123 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 174



 Score =  122 bits (293), Expect = 1e-27
 Identities = 57/63 (90%), Positives = 60/63 (95%), Gaps = 1/63 (1%)
 Frame = +1

Query: 70  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 247 QSK 255
           QSK
Sbjct: 61  QSK 63


>AL157394-6|CAI13864.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  187 bits (455), Expect = 3e-47
 Identities = 88/112 (78%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 123 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 174



 Score =  122 bits (293), Expect = 1e-27
 Identities = 57/63 (90%), Positives = 60/63 (95%), Gaps = 1/63 (1%)
 Frame = +1

Query: 70  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 247 QSK 255
           QSK
Sbjct: 61  QSK 63


>AC073046-2|AAX88909.1|  376|Homo sapiens unknown protein.
          Length = 376

 Score =  187 bits (455), Expect = 3e-47
 Identities = 88/112 (78%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 122 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 173



 Score =  127 bits (306), Expect = 4e-29
 Identities = 57/62 (91%), Positives = 59/62 (95%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>CR536515-1|CAG38753.1|  376|Homo sapiens ACTG2 protein.
          Length = 376

 Score =  186 bits (453), Expect = 6e-47
 Identities = 88/112 (78%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 122 QIMFETFNFPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 173



 Score =  127 bits (306), Expect = 4e-29
 Identities = 57/62 (91%), Positives = 59/62 (95%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin protein.
          Length = 1075

 Score =  183 bits (446), Expect = 4e-46
 Identities = 87/112 (77%), Positives = 92/112 (82%)
 Frame = +3

Query: 252  QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
            +RGILTLKYP+EHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPKANREKMT
Sbjct: 761  KRGILTLKYPMEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEATLNPKANREKMT 820

Query: 432  QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            QIMFETFNTPAMYVAIQAVLSLY SG        S    +   P  +G ALP
Sbjct: 821  QIMFETFNTPAMYVAIQAVLSLYTSGRTTGIVMDSGDGVTHTVPIYEGNALP 872



 Score =  108 bits (260), Expect = 1e-23
 Identities = 49/60 (81%), Positives = 54/60 (90%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           D++ A LV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPR QG+M GM QK+SYVG EAQSK
Sbjct: 702 DDDTAVLVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRQQGMMGGMHQKESYVGKEAQSK 761


>AY280960-1|AAP37280.1|  254|Homo sapiens actin alpha 1 skeletal
           muscle protein protein.
          Length = 254

 Score =  183 bits (445), Expect = 5e-46
 Identities = 82/86 (95%), Positives = 84/86 (97%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASG 509
           QIMFETFN PAMYVAIQAVLSLYASG
Sbjct: 123 QIMFETFNVPAMYVAIQAVLSLYASG 148



 Score =  120 bits (289), Expect = 4e-27
 Identities = 57/63 (90%), Positives = 58/63 (92%), Gaps = 1/63 (1%)
 Frame = +1

Query: 70  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 247 QSK 255
           QSK
Sbjct: 61  QSK 63


>AL157394-7|CAI13865.1|  151|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 151

 Score =  181 bits (441), Expect = 2e-45
 Identities = 81/86 (94%), Positives = 84/86 (97%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMT
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMT 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASG 509
           QIMFETFN PAMYVAIQAVLSLYASG
Sbjct: 123 QIMFETFNVPAMYVAIQAVLSLYASG 148



 Score =  122 bits (293), Expect = 1e-27
 Identities = 57/63 (90%), Positives = 60/63 (95%), Gaps = 1/63 (1%)
 Frame = +1

Query: 70  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 247 QSK 255
           QSK
Sbjct: 61  QSK 63


>EF095209-1|ABL01513.1|  121|Homo sapiens beta-actin protein.
          Length = 121

 Score =  159 bits (385), Expect = 1e-38
 Identities = 70/71 (98%), Positives = 71/71 (100%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 51  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 110

Query: 432 QIMFETFNTPA 464
           QIMFETFNTPA
Sbjct: 111 QIMFETFNTPA 121



 Score =  113 bits (272), Expect = 5e-25
 Identities = 51/51 (100%), Positives = 51/51 (100%)
 Frame = +1

Query: 103 DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 1   DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 51


>AY970420-1|AAX82229.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (350), Expect = 2e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGCTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970501-1|AAX82307.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970498-1|AAX82304.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970497-1|AAX82303.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970495-1|AAX82301.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970494-1|AAX82300.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970493-1|AAX82299.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970491-1|AAX82297.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970489-1|AAX82295.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970488-1|AAX82294.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970487-1|AAX82293.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970486-1|AAX82292.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970478-1|AAX82284.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970477-1|AAX82283.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970476-1|AAX82282.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970474-1|AAX82280.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970473-1|AAX82279.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970472-1|AAX82278.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970471-1|AAX82277.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970470-1|AAX82276.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970469-1|AAX82275.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970468-1|AAX82274.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970443-1|AAX82252.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970441-1|AAX82250.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970419-1|AAX82228.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970418-1|AAX82227.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970417-1|AAX82226.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970416-1|AAX82225.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970415-1|AAX82224.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970414-1|AAX82223.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970413-1|AAX82222.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970412-1|AAX82221.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970411-1|AAX82220.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970410-1|AAX82219.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970409-1|AAX82218.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970408-1|AAX82217.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970406-1|AAX82215.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970405-1|AAX82214.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970404-1|AAX82213.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970403-1|AAX82212.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970402-1|AAX82211.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970383-1|AAX82192.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970382-1|AAX82191.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970381-1|AAX82190.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970380-1|AAX82189.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970377-1|AAX82186.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970376-1|AAX82185.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970375-1|AAX82184.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970372-1|AAX82182.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970371-1|AAX82181.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970370-1|AAX82180.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970369-1|AAX82179.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970368-1|AAX82178.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970366-1|AAX82176.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970364-1|AAX82174.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970363-1|AAX82173.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 70/89 (78%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970421-1|AAX82230.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  143 bits (347), Expect = 4e-34
 Identities = 69/89 (77%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970492-1|AAX82298.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  142 bits (345), Expect = 7e-34
 Identities = 69/89 (77%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLT+APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTQAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970490-1|AAX82296.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  142 bits (344), Expect = 9e-34
 Identities = 69/89 (77%), Positives = 71/89 (79%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRV PEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVTPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970444-1|AAX82253.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  142 bits (344), Expect = 9e-34
 Identities = 69/89 (77%), Positives = 72/89 (80%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYN+LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNKLRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970367-1|AAX82177.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  142 bits (344), Expect = 9e-34
 Identities = 70/89 (78%), Positives = 71/89 (79%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIW HTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWRHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  KGYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYKGYALP 89


>AY970500-1|AAX82306.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  142 bits (343), Expect = 1e-33
 Identities = 69/89 (77%), Positives = 71/89 (79%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ MFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQTMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970442-1|AAX82251.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  142 bits (343), Expect = 1e-33
 Identities = 69/89 (77%), Positives = 71/89 (79%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN EKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANHEKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970390-1|AAX82199.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  142 bits (343), Expect = 1e-33
 Identities = 68/89 (76%), Positives = 71/89 (79%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +GYALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970374-1|AAX82183.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  141 bits (342), Expect = 2e-33
 Identities = 69/89 (77%), Positives = 71/89 (79%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPL PKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLTPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970485-1|AAX82291.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  141 bits (341), Expect = 2e-33
 Identities = 69/89 (77%), Positives = 71/89 (79%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF TFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFGTFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970365-1|AAX82175.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  141 bits (341), Expect = 2e-33
 Identities = 69/89 (77%), Positives = 71/89 (79%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNEL VAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELGVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970496-1|AAX82302.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  140 bits (340), Expect = 3e-33
 Identities = 69/89 (77%), Positives = 71/89 (79%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWH TFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHRTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970385-1|AAX82194.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  139 bits (337), Expect = 6e-33
 Identities = 67/89 (75%), Positives = 70/89 (78%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKAN EKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANHEKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +GYALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHNVPIYEGYALP 89


>AY970378-1|AAX82187.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  139 bits (336), Expect = 9e-33
 Identities = 72/102 (70%), Positives = 76/102 (74%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALPPRHSLRFGT*PGR 626
            SG        S    +   P  +G AL P  +LR    PGR
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNAL-PHATLRLDL-PGR 100


>AY970479-1|AAX82285.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  138 bits (335), Expect = 1e-32
 Identities = 68/89 (76%), Positives = 70/89 (78%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALP 89


>AY970502-1|AAX82308.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  138 bits (334), Expect = 1e-32
 Identities = 67/89 (75%), Positives = 70/89 (78%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALP 89


>AY970499-1|AAX82305.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  138 bits (334), Expect = 1e-32
 Identities = 68/89 (76%), Positives = 70/89 (78%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG             +      +GYALP
Sbjct: 61  ASGRTTGIVMDFGDGVTHTVSIYEGYALP 89


>AY970480-1|AAX82286.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  138 bits (334), Expect = 1e-32
 Identities = 67/89 (75%), Positives = 70/89 (78%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALP 89


>AY970475-1|AAX82281.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  138 bits (334), Expect = 1e-32
 Identities = 67/89 (75%), Positives = 71/89 (79%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHT YNELRVAPEEHPVLLTEAPLNPKANRE++TQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTLYNELRVAPEEHPVLLTEAPLNPKANREEITQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970464-1|AAX82271.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  138 bits (334), Expect = 1e-32
 Identities = 67/89 (75%), Positives = 70/89 (78%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGRTTGIVMDSGDGFTHTVPIYEGNALP 89


>AY970460-1|AAX82267.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  138 bits (334), Expect = 1e-32
 Identities = 67/89 (75%), Positives = 70/89 (78%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALP 89


>AY970457-1|AAX82264.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  138 bits (334), Expect = 1e-32
 Identities = 67/89 (75%), Positives = 70/89 (78%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALP 89


>AY970431-1|AAX82240.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  138 bits (334), Expect = 1e-32
 Identities = 67/89 (75%), Positives = 70/89 (78%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALP 89


>AY970430-1|AAX82239.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  138 bits (334), Expect = 1e-32
 Identities = 67/89 (75%), Positives = 70/89 (78%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALP 89


>AY970428-1|AAX82237.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  138 bits (334), Expect = 1e-32
 Identities = 67/89 (75%), Positives = 70/89 (78%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALP 89


>AY970389-1|AAX82198.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  138 bits (334), Expect = 1e-32
 Identities = 67/89 (75%), Positives = 70/89 (78%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALP 89


>AY970386-1|AAX82195.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  138 bits (334), Expect = 1e-32
 Identities = 67/89 (75%), Positives = 70/89 (78%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALP 89


>AY970483-1|AAX82289.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  138 bits (333), Expect = 2e-32
 Identities = 67/89 (75%), Positives = 70/89 (78%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           +IWHHTFYNELRVAPEEHPVLLTEA LNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   RIWHHTFYNELRVAPEEHPVLLTEATLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +GYALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970446-1|AAX82255.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  138 bits (333), Expect = 2e-32
 Identities = 67/89 (75%), Positives = 70/89 (78%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGDALP 89


>AY970440-1|AAX82249.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  138 bits (333), Expect = 2e-32
 Identities = 67/89 (75%), Positives = 70/89 (78%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLY
Sbjct: 1   KIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVLDSGDGVTHNVPIYEGYALP 89


>AY970439-1|AAX82248.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  138 bits (333), Expect = 2e-32
 Identities = 67/89 (75%), Positives = 70/89 (78%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLY
Sbjct: 1   KIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVLDSGDGVTHNVPIYEGYALP 89


>AY970424-1|AAX82233.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  137 bits (331), Expect = 3e-32
 Identities = 68/94 (72%), Positives = 74/94 (78%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAP++HPVLLT+APLNPKANREKMTQIMFETFNT AMYVAIQA+LSLY
Sbjct: 1   KIWHHTFYNELRVAPKQHPVLLTKAPLNPKANREKMTQIMFETFNTAAMYVAIQALLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALPPRHSL 602
           ASG        S    +   PF  GYALP  HS+
Sbjct: 61  ASGRTTGIMMDSGDEVTHTVPFYGGYALP--HSI 92


>AY970407-1|AAX82216.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  137 bits (331), Expect = 3e-32
 Identities = 68/89 (76%), Positives = 70/89 (78%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHT YNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM VAIQAVLSLY
Sbjct: 1   KIWHHTSYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMCVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGILMDSGDGVTHTVPIYEGYALP 89


>AY970458-1|AAX82265.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  136 bits (330), Expect = 5e-32
 Identities = 66/89 (74%), Positives = 70/89 (78%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPL+PKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLSPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGRTTGIVMDSGDRVTPTVPIYEGNALP 89


>AY970456-1|AAX82263.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  136 bits (330), Expect = 5e-32
 Identities = 66/89 (74%), Positives = 70/89 (78%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPA+YVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAIYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALP 89


>AY970429-1|AAX82238.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  136 bits (330), Expect = 5e-32
 Identities = 66/89 (74%), Positives = 70/89 (78%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMT+IMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTRIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALP 89


>AY970388-1|AAX82197.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  136 bits (330), Expect = 5e-32
 Identities = 66/89 (74%), Positives = 69/89 (77%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYV IQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVTIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALP 89


>AY970387-1|AAX82196.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  136 bits (330), Expect = 5e-32
 Identities = 66/89 (74%), Positives = 69/89 (77%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYV IQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVTIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALP 89


>AY970463-1|AAX82270.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  136 bits (329), Expect = 6e-32
 Identities = 66/89 (74%), Positives = 70/89 (78%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFY+ELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYSELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGRTTGIVMDSGDGFTHTVPIYEGNALP 89


>AY970432-1|AAX82241.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  136 bits (329), Expect = 6e-32
 Identities = 66/89 (74%), Positives = 69/89 (77%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKAN EKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANHEKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGHTTGIVMDSGDGVTHTVPIYEGNALP 89


>AY970392-1|AAX82201.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  136 bits (329), Expect = 6e-32
 Identities = 66/89 (74%), Positives = 69/89 (77%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKAN EKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANHEKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALP 89


>AY970391-1|AAX82200.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  136 bits (328), Expect = 8e-32
 Identities = 66/89 (74%), Positives = 69/89 (77%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNP ANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPMANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGRTTGIFMDSGDGVTHTAPIYEGNALP 89


>AY970384-1|AAX82193.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  136 bits (328), Expect = 8e-32
 Identities = 65/89 (73%), Positives = 70/89 (78%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIW+HTFYNELRVAP+EHP+LLTEAPLNPK NREKMTQIMFE FNTPAMYVAIQAVLSLY
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMTQIMFEAFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHTVPIYEGYALP 89


>AY970462-1|AAX82269.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  135 bits (327), Expect = 1e-31
 Identities = 66/89 (74%), Positives = 69/89 (77%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV SLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVPSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALP 89


>AY970451-1|AAX82259.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  135 bits (327), Expect = 1e-31
 Identities = 65/89 (73%), Positives = 70/89 (78%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIW+HTFYNELRVAP+EHP+LLTEAPLNPK NREKMTQIMFE FNTPAMYVAIQAVLSLY
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMTQIMFEAFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTLIVPIYEGYALP 89


>AY970454-1|AAX82261.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  135 bits (326), Expect = 1e-31
 Identities = 66/89 (74%), Positives = 69/89 (77%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEH +LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHSILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALP 89


>AY970455-1|AAX82262.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  134 bits (325), Expect = 2e-31
 Identities = 66/89 (74%), Positives = 69/89 (77%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAM VAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMCVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALP 89


>AY970426-1|AAX82235.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  134 bits (325), Expect = 2e-31
 Identities = 66/89 (74%), Positives = 68/89 (76%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV SLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVPSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P   G ALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYDGNALP 89


>AY970452-1|AAX82260.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  133 bits (322), Expect = 4e-31
 Identities = 64/89 (71%), Positives = 69/89 (77%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIW+HTFYNELRVAP+EHP+LLTEAPLNPK NREKMTQIMFE FNTPAMY AIQAVLSLY
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMTQIMFEAFNTPAMYAAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHIVPIYEGYALP 89


>AY970433-1|AAX82242.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  132 bits (320), Expect = 7e-31
 Identities = 64/89 (71%), Positives = 69/89 (77%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIW+HTFYNELRVAP+EHP+LLTEAPLNPK NREKM QIMFE FNTPAMYVAIQAVLSLY
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMIQIMFEAFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  +GYALP
Sbjct: 61  ASGRTTGIVMDSGDGVTHIVPIYEGYALP 89


>AY970461-1|AAX82268.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  132 bits (319), Expect = 1e-30
 Identities = 66/89 (74%), Positives = 67/89 (75%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHT YNELRVAPEEHPVLLTEA LNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTLYNELRVAPEEHPVLLTEATLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P   G ALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYDGNALP 89


>X82208-1|CAA57692.1|  329|Homo sapiens beta-centractin protein.
          Length = 329

 Score =  130 bits (315), Expect = 3e-30
 Identities = 59/119 (49%), Positives = 85/119 (71%), Gaps = 1/119 (0%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREK 425
           E RG+LT++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP  NREK
Sbjct: 34  EHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREK 93

Query: 426 MTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALPPRHSL 602
             ++ FETFN PA+++++QAVLSLYA+G        S    +   P  +G+A+P  HS+
Sbjct: 94  AAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMP--HSI 150



 Score = 36.7 bits (81), Expect = 0.068
 Identities = 14/33 (42%), Positives = 22/33 (66%)
 Frame = +1

Query: 151 PRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           P+  FP+ VGRP+H  VM G  + D ++G +A+
Sbjct: 1   PKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAE 33


>X82207-1|CAA57691.1|  376|Homo sapiens beta-centracetin protein.
          Length = 376

 Score =  130 bits (315), Expect = 3e-30
 Identities = 59/119 (49%), Positives = 85/119 (71%), Gaps = 1/119 (0%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREK 425
           E RG+LT++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP  NREK
Sbjct: 64  EHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREK 123

Query: 426 MTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALPPRHSL 602
             ++ FETFN PA+++++QAVLSLYA+G        S    +   P  +G+A+P  HS+
Sbjct: 124 AAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMP--HSI 180



 Score = 65.7 bits (153), Expect = 1e-10
 Identities = 27/52 (51%), Positives = 38/52 (73%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAE 63


>BC010090-1|AAH10090.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score =  130 bits (315), Expect = 3e-30
 Identities = 59/119 (49%), Positives = 85/119 (71%), Gaps = 1/119 (0%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREK 425
           E RG+LT++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP  NREK
Sbjct: 64  EHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREK 123

Query: 426 MTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALPPRHSL 602
             ++ FETFN PA+++++QAVLSLYA+G        S    +   P  +G+A+P  HS+
Sbjct: 124 AAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMP--HSI 180



 Score = 65.7 bits (153), Expect = 1e-10
 Identities = 27/52 (51%), Positives = 38/52 (73%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAE 63


>BC006372-1|AAH06372.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score =  130 bits (315), Expect = 3e-30
 Identities = 59/119 (49%), Positives = 85/119 (71%), Gaps = 1/119 (0%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREK 425
           E RG+LT++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP  NREK
Sbjct: 64  EHRGLLTIRYPMEHGVVRDWNDMERIWQYAYSKDQLQTFSEEHPVLLTEAPLNPSKNREK 123

Query: 426 MTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALPPRHSL 602
             ++ FETFN PA+++++QAVLSLYA+G        S    +   P  +G+A+P  HS+
Sbjct: 124 AAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMP--HSI 180



 Score = 65.7 bits (153), Expect = 1e-10
 Identities = 27/52 (51%), Positives = 38/52 (73%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAE 63


>BC004374-1|AAH04374.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score =  130 bits (315), Expect = 3e-30
 Identities = 59/119 (49%), Positives = 85/119 (71%), Gaps = 1/119 (0%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREK 425
           E RG+LT++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP  NREK
Sbjct: 64  EHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREK 123

Query: 426 MTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALPPRHSL 602
             ++ FETFN PA+++++QAVLSLYA+G        S    +   P  +G+A+P  HS+
Sbjct: 124 AAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMP--HSI 180



 Score = 65.7 bits (153), Expect = 1e-10
 Identities = 27/52 (51%), Positives = 38/52 (73%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAE 63


>AC017099-2|AAY24280.1|  376|Homo sapiens unknown protein.
          Length = 376

 Score =  130 bits (315), Expect = 3e-30
 Identities = 59/119 (49%), Positives = 85/119 (71%), Gaps = 1/119 (0%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREK 425
           E RG+LT++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP  NREK
Sbjct: 64  EHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREK 123

Query: 426 MTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALPPRHSL 602
             ++ FETFN PA+++++QAVLSLYA+G        S    +   P  +G+A+P  HS+
Sbjct: 124 AAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMP--HSI 180



 Score = 65.7 bits (153), Expect = 1e-10
 Identities = 27/52 (51%), Positives = 38/52 (73%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAE 63


>AY970427-1|AAX82236.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  130 bits (314), Expect = 4e-30
 Identities = 64/89 (71%), Positives = 67/89 (75%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIM ETFNTPAMYVA QA+LSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMSETFNTPAMYVANQAMLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P   G ALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYDGNALP 89


>AY970398-1|AAX82207.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  130 bits (314), Expect = 4e-30
 Identities = 63/89 (70%), Positives = 69/89 (77%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHH F+NELRVAP++HPVLLT+APLNPKANREKMT IMFETFNT AMYVAIQA+LSLY
Sbjct: 1   KIWHHIFHNELRVAPKQHPVLLTKAPLNPKANREKMTHIMFETFNTAAMYVAIQALLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   PF  GYALP
Sbjct: 61  ASGRTTGIMMDSGDEVTHTVPFYGGYALP 89


>Z14978-1|CAA78701.1|  376|Homo sapiens actin-related protein
           protein.
          Length = 376

 Score =  129 bits (311), Expect = 9e-30
 Identities = 58/119 (48%), Positives = 86/119 (72%), Gaps = 1/119 (0%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREK 425
           E RG+L+++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+ NRE+
Sbjct: 64  EHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRER 123

Query: 426 MTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALPPRHSL 602
             ++ FETFN PA+++++QAVLSLYA+G        S    +   P  +G+A+P  HS+
Sbjct: 124 AAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMP--HSI 180



 Score = 64.9 bits (151), Expect = 2e-10
 Identities = 27/52 (51%), Positives = 38/52 (73%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAE 63


>X82206-1|CAA57690.1|  376|Homo sapiens alpha-centractin protein.
          Length = 376

 Score =  129 bits (311), Expect = 9e-30
 Identities = 58/119 (48%), Positives = 86/119 (72%), Gaps = 1/119 (0%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREK 425
           E RG+L+++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+ NRE+
Sbjct: 64  EHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRER 123

Query: 426 MTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALPPRHSL 602
             ++ FETFN PA+++++QAVLSLYA+G        S    +   P  +G+A+P  HS+
Sbjct: 124 AAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMP--HSI 180



 Score = 64.9 bits (151), Expect = 2e-10
 Identities = 27/52 (51%), Positives = 38/52 (73%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAE 63


>BC026016-1|AAH26016.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score =  129 bits (311), Expect = 9e-30
 Identities = 58/119 (48%), Positives = 86/119 (72%), Gaps = 1/119 (0%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREK 425
           E RG+L+++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+ NRE+
Sbjct: 64  EHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRER 123

Query: 426 MTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALPPRHSL 602
             ++ FETFN PA+++++QAVLSLYA+G        S    +   P  +G+A+P  HS+
Sbjct: 124 AAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMP--HSI 180



 Score = 64.9 bits (151), Expect = 2e-10
 Identities = 27/52 (51%), Positives = 38/52 (73%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAE 63


>BC000693-1|AAH00693.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score =  129 bits (311), Expect = 9e-30
 Identities = 58/119 (48%), Positives = 86/119 (72%), Gaps = 1/119 (0%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREK 425
           E RG+L+++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+ NRE+
Sbjct: 64  EHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRER 123

Query: 426 MTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALPPRHSL 602
             ++ FETFN PA+++++QAVLSLYA+G        S    +   P  +G+A+P  HS+
Sbjct: 124 AAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMP--HSI 180



 Score = 64.9 bits (151), Expect = 2e-10
 Identities = 27/52 (51%), Positives = 38/52 (73%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAE 63


>AY970447-1|AAX82256.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 9e-30
 Identities = 63/89 (70%), Positives = 67/89 (75%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIM E F+ PAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMLEIFDRPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALP 89


>AL121928-12|CAC08404.1|  376|Homo sapiens ARP1 actin-related
           protein 1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score =  129 bits (311), Expect = 9e-30
 Identities = 58/119 (48%), Positives = 86/119 (72%), Gaps = 1/119 (0%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREK 425
           E RG+L+++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+ NRE+
Sbjct: 64  EHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRER 123

Query: 426 MTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALPPRHSL 602
             ++ FETFN PA+++++QAVLSLYA+G        S    +   P  +G+A+P  HS+
Sbjct: 124 AAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMP--HSI 180



 Score = 64.9 bits (151), Expect = 2e-10
 Identities = 27/52 (51%), Positives = 38/52 (73%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAE 63


>AL160004-4|CAI19051.1|  287|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 287

 Score =  128 bits (308), Expect = 2e-29
 Identities = 55/62 (88%), Positives = 58/62 (93%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANRE + 
Sbjct: 63  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREIVR 122

Query: 432 QI 437
            I
Sbjct: 123 DI 124



 Score =  120 bits (289), Expect = 4e-27
 Identities = 57/63 (90%), Positives = 58/63 (92%), Gaps = 1/63 (1%)
 Frame = +1

Query: 70  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 247 QSK 255
           QSK
Sbjct: 61  QSK 63


>AY970425-1|AAX82234.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  127 bits (307), Expect = 3e-29
 Identities = 63/89 (70%), Positives = 67/89 (75%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNEL VA +EHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA+LSLY
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAMLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P   G ALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYDGNALP 89


>AY970481-1|AAX82287.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  126 bits (305), Expect = 5e-29
 Identities = 58/63 (92%), Positives = 59/63 (93%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM E F+ PAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMLEIFDRPAMYVAIQAVLSLY 60

Query: 501 ASG 509
            SG
Sbjct: 61  TSG 63



 Score = 38.7 bits (86), Expect = 0.017
 Identities = 16/21 (76%), Positives = 18/21 (85%)
 Frame = +2

Query: 509 RTTGIVLDFGDGVFHTVPIYE 571
           RTT IV+D+ DGV HTVPIYE
Sbjct: 64  RTTDIVMDYDDGVTHTVPIYE 84


>AY970459-1|AAX82266.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  126 bits (305), Expect = 5e-29
 Identities = 61/89 (68%), Positives = 69/89 (77%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHH F+NELRVAP++HP+LLT+APL+PKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHIFHNELRVAPKQHPMLLTKAPLDPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +G ALP
Sbjct: 61  TSGRTTGIVMDSGDGVTHTVPIYEGNALP 89


>AY970400-1|AAX82209.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  126 bits (305), Expect = 5e-29
 Identities = 61/89 (68%), Positives = 69/89 (77%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEE P+LL EAPLNPKAN +KMTQI+FETFNTPAMY+AIQ +LSLY
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLIEAPLNPKANCKKMTQIIFETFNTPAMYLAIQTMLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S+   +   P  +GYALP
Sbjct: 61  ASGRTTGIVLDSSDGVTHTVPIYEGYALP 89


>AY129015-1|AAM98758.1|  109|Homo sapiens unknown protein.
          Length = 109

 Score =  126 bits (303), Expect = 9e-29
 Identities = 61/89 (68%), Positives = 65/89 (73%)
 Frame = +3

Query: 297 VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVA 476
           +TNWDD+EKIWHHTFY  L +A EEH VLLTE PLN KANREKMTQIMF+TFNT AMYVA
Sbjct: 1   MTNWDDIEKIWHHTFYKGLHMALEEHLVLLTEDPLNLKANREKMTQIMFDTFNTLAMYVA 60

Query: 477 IQAVLSLYASGVPPVSCWTSATVSSTPCP 563
           IQA LSLY  G      W     S T CP
Sbjct: 61  IQARLSLYTCGCTLALSWALEMGSPTWCP 89


>AY970467-1|AAX82273.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  125 bits (301), Expect = 1e-28
 Identities = 60/89 (67%), Positives = 69/89 (77%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEE P+LL EAPLNP+AN +KMTQI+FETFNTPAMY+AIQ +LSLY
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKKMTQIIFETFNTPAMYLAIQTMLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S+   +   P  +GYALP
Sbjct: 61  ASGRTTGIVLDSSDGVTHTVPIYEGYALP 89


>AY970448-1|AAX82257.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  125 bits (301), Expect = 1e-28
 Identities = 62/89 (69%), Positives = 65/89 (73%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFY E+RV PEEHPVL+TEA LNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYKEVRVVPEEHPVLVTEATLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
             G        S    +   P   G ALP
Sbjct: 61  TFGRNNGIVMDSGDGVTHTVPIYDGNALP 89


>AY970401-1|AAX82210.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  125 bits (301), Expect = 1e-28
 Identities = 60/89 (67%), Positives = 69/89 (77%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEE P+LL EAPLNP+AN +KMTQI+FETFNTPAMY+AIQ +LSLY
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKKMTQIIFETFNTPAMYLAIQTMLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S+   +   P  +GYALP
Sbjct: 61  ASGRTTGIVLDSSDGVTHTVPIYEGYALP 89


>AY970422-1|AAX82231.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (300), Expect = 2e-28
 Identities = 60/89 (67%), Positives = 69/89 (77%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNELRVAPEE P+LL EAPLNP+AN +KMTQI+FETFNTPAMY+AIQ +LSLY
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKKMTQIIFETFNTPAMYLAIQTMLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S+   +   P  +GYALP
Sbjct: 61  ASGRTTGIVSDSSDGVTHTVPIYEGYALP 89


>AY970423-1|AAX82232.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  123 bits (297), Expect = 5e-28
 Identities = 59/89 (66%), Positives = 69/89 (77%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           +IWHHTFYNELRVAPEE P+LL EAPLNP+AN +KMTQI+FETFNTPAMY+AIQ +LSLY
Sbjct: 1   EIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKKMTQIIFETFNTPAMYLAIQTMLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S+   +   P  +GYALP
Sbjct: 61  ASGRTTGIVLDSSDGVTHTVPIYEGYALP 89


>AY970379-1|AAX82188.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  123 bits (297), Expect = 5e-28
 Identities = 58/89 (65%), Positives = 67/89 (75%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNEL VAP+EH +LLTE PLNPKAN +KMTQIMFETFNTPA+Y+AIQA+LSLY
Sbjct: 1   KIWHHTFYNELHVAPKEHRMLLTEVPLNPKANHKKMTQIMFETFNTPAVYMAIQAMLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
             G        S+   +   P  +GYALP
Sbjct: 61  TYGCTTGIVMDSSDGVTHTVPIYEGYALP 89


>AY970445-1|AAX82254.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  122 bits (295), Expect = 8e-28
 Identities = 60/89 (67%), Positives = 67/89 (75%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHH F+NELRVAP++HPVLLT+APLNP+ANREKMT IMFETF T AMYVAIQA+LSLY
Sbjct: 1   KIWHHIFHNELRVAPKQHPVLLTKAPLNPRANREKMTHIMFETFYTAAMYVAIQALLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +    F  GYALP
Sbjct: 61  ASGRTTGIMMDSGDEVTHTVAFYGGYALP 89


>AY970396-1|AAX82205.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  122 bits (294), Expect = 1e-27
 Identities = 59/89 (66%), Positives = 66/89 (74%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYN+L VAPEE+ VL+T+APLNPKANREKMTQIMFE FNTPAMY+AIQAVLSLY
Sbjct: 1   KIWHHTFYNKLHVAPEEYLVLMTKAPLNPKANREKMTQIMFEVFNTPAMYMAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG             +   P  +GY LP
Sbjct: 61  TSGRTTGIVMDFGDGVAHTVPIYEGYPLP 89


>AY970484-1|AAX82290.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  120 bits (289), Expect = 4e-27
 Identities = 57/89 (64%), Positives = 66/89 (74%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNEL VAP+EH +LLTE PLN KAN +KMTQIMFETFNTPA+Y+AIQA+LSLY
Sbjct: 1   KIWHHTFYNELHVAPKEHRMLLTEVPLNSKANHKKMTQIMFETFNTPAVYMAIQAMLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
             G        S+   +   P  +GYALP
Sbjct: 61  TYGCTTGIVMDSSDGVTHTVPIYEGYALP 89


>AL160004-5|CAI19052.1|  342|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 342

 Score =  120 bits (289), Expect = 4e-27
 Identities = 57/63 (90%), Positives = 58/63 (92%), Gaps = 1/63 (1%)
 Frame = +1

Query: 70  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 247 QSK 255
           QSK
Sbjct: 61  QSK 63



 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 40/60 (66%), Positives = 42/60 (70%)
 Frame = +3

Query: 408 KANREKMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           KANREKMTQIMFETFN PAMYVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 80  KANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALP 139



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 20/32 (62%), Positives = 24/32 (75%), Gaps = 2/32 (6%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVT--NWDDMEKIWHHTF 341
           +RGILTLKYPIEHGI+T  N + M +I   TF
Sbjct: 63  KRGILTLKYPIEHGIITKANREKMTQIMFETF 94


>AY970395-1|AAX82204.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  118 bits (285), Expect = 1e-26
 Identities = 54/63 (85%), Positives = 59/63 (93%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHH FYN LRVAPEE  VLLTEAPLNP+ANREKMTQIMF+TFNTPAMYVAIQAVL+L+
Sbjct: 1   KIWHHVFYNVLRVAPEEQVVLLTEAPLNPRANREKMTQIMFKTFNTPAMYVAIQAVLTLH 60

Query: 501 ASG 509
           +SG
Sbjct: 61  SSG 63



 Score = 42.3 bits (95), Expect = 0.001
 Identities = 18/21 (85%), Positives = 19/21 (90%)
 Frame = +2

Query: 512 TTGIVLDFGDGVFHTVPIYER 574
           TTGIV+D GDGV HTVPIYER
Sbjct: 65  TTGIVMDSGDGVTHTVPIYER 85


>AY970438-1|AAX82247.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  116 bits (279), Expect = 7e-26
 Identities = 58/89 (65%), Positives = 65/89 (73%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIW H FYNEL VAPEE  VLLTEAPLNP+ANREKMTQIMF+TFNTPAMYVAIQAVLSL+
Sbjct: 1   KIWDHVFYNELWVAPEEQVVLLTEAPLNPRANREKMTQIMFKTFNTPAMYVAIQAVLSLH 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           +SG        S    +   P  + + LP
Sbjct: 61  SSGCTTGIVMDSGDGVTHTVPIYERHTLP 89


>AY970465-1|AAX82272.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  116 bits (278), Expect = 9e-26
 Identities = 64/91 (70%), Positives = 68/91 (74%), Gaps = 2/91 (2%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF-NTPAMYVAIQA-VLS 494
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN  KMTQI FETF NTPA+Y+AIQA VLS
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN-HKMTQITFETFSNTPAIYMAIQAVVLS 59

Query: 495 LYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           LYASG+       S     T     + YALP
Sbjct: 60  LYASGLTTGIVMDSGN-GVTHTAIYEWYALP 89


>AY970437-1|AAX82246.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  114 bits (274), Expect = 3e-25
 Identities = 63/91 (69%), Positives = 66/91 (72%), Gaps = 2/91 (2%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIW HTFYNEL VA EEHPVLL EA  NPKANREKMTQIMFETFN+PAMYVAIQ VLSLY
Sbjct: 1   KIWDHTFYNELCVALEEHPVLLIEACPNPKANREKMTQIMFETFNSPAMYVAIQPVLSLY 60

Query: 501 ASG-VPPVSCWTSATVSST-PCPFTKGYALP 587
           ASG    +   +   V  T   P   GYALP
Sbjct: 61  ASGRTSGIVRDSGDGVRVTHTVPIYVGYALP 91


>AY970397-1|AAX82206.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  112 bits (270), Expect = 9e-25
 Identities = 56/89 (62%), Positives = 63/89 (70%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYN+L VAPEE+ VL+T+APL  KANRE MTQIMFE FNT AMY+AIQAVLSLY
Sbjct: 1   KIWHHTFYNKLHVAPEEYLVLMTKAPLMTKANREMMTQIMFEVFNTLAMYMAIQAVLSLY 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            SG        S    +   P  +GY LP
Sbjct: 61  TSGRTTGIAMDSGDGVAHTVPIYEGYTLP 89


>AY970503-1|AAX82309.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  112 bits (269), Expect = 1e-24
 Identities = 51/63 (80%), Positives = 56/63 (88%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNEL VA +EHP+LLT+ PL+PKANREKMTQIM E F+ PAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTKVPLSPKANREKMTQIMLEIFDRPAMYVAIQAVLSLY 60

Query: 501 ASG 509
            SG
Sbjct: 61  TSG 63



 Score = 41.5 bits (93), Expect = 0.002
 Identities = 17/21 (80%), Positives = 19/21 (90%)
 Frame = +2

Query: 509 RTTGIVLDFGDGVFHTVPIYE 571
           RTTGIV+D+ DGV HTVPIYE
Sbjct: 64  RTTGIVMDYDDGVTHTVPIYE 84


>AY970394-1|AAX82203.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  111 bits (268), Expect = 1e-24
 Identities = 51/63 (80%), Positives = 56/63 (88%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNEL VA +EHP+LLT+APL+PKAN EKMTQIM E F+ PAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTKAPLSPKANHEKMTQIMLEIFSRPAMYVAIQAVLSLY 60

Query: 501 ASG 509
            SG
Sbjct: 61  TSG 63



 Score = 37.5 bits (83), Expect = 0.039
 Identities = 15/21 (71%), Positives = 18/21 (85%)
 Frame = +2

Query: 509 RTTGIVLDFGDGVFHTVPIYE 571
           RTT IV+D+ DGV HTVPIY+
Sbjct: 64  RTTDIVMDYDDGVTHTVPIYD 84


>AY970436-1|AAX82245.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  111 bits (267), Expect = 2e-24
 Identities = 56/89 (62%), Positives = 64/89 (71%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHH FYNEL VA EE  VLLTEAPLNP+ANREKMTQIMF+TFNT AMYVAIQAVL+L+
Sbjct: 1   KIWHHVFYNELCVALEEQVVLLTEAPLNPRANREKMTQIMFKTFNTQAMYVAIQAVLTLH 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           +SG        S    +   P  + + LP
Sbjct: 61  SSGCTTGIVMDSGDGVTHTVPIYERHTLP 89


>AY970434-1|AAX82243.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  111 bits (267), Expect = 2e-24
 Identities = 58/94 (61%), Positives = 67/94 (71%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHH FYNEL VA EE  VLLTEAPL P+ANREKMTQIMF+TFNT AMYVAIQAVL+L+
Sbjct: 1   KIWHHVFYNELCVALEEQVVLLTEAPLKPRANREKMTQIMFKTFNTQAMYVAIQAVLTLH 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALPPRHSL 602
           +SG      WT+  V  +    T    +  RH+L
Sbjct: 61  SSG------WTTGIVMDSGDGVTHTVPIYERHTL 88


>Z74696-1|CAI42428.1|  376|Homo sapiens actin-related protein T1
           (ACTRT1) protein.
          Length = 376

 Score =  111 bits (266), Expect = 3e-24
 Identities = 52/108 (48%), Positives = 67/108 (62%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L L YPIE G+VT WDDMEK+W H F  EL V P + PVL+TE  LNP+  REK+ ++MF
Sbjct: 68  LHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREKLAEMMF 127

Query: 444 ETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ETF+ P  Y++  AV +LYAS         S    +   P  +GY+LP
Sbjct: 128 ETFSVPGFYLSNHAVAALYASACVTGLVVDSGDGVTCTVPIFEGYSLP 175



 Score = 50.0 bits (114), Expect = 7e-06
 Identities = 24/58 (41%), Positives = 36/58 (62%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +V A++ DNGSG+CKAG +G+  PR V  S++G  +    +  + QK  +VG EA  K
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK-YFVGQEALYK 64


>BC014597-1|AAH14597.1|  376|Homo sapiens actin-related protein T1
           protein.
          Length = 376

 Score =  111 bits (266), Expect = 3e-24
 Identities = 52/108 (48%), Positives = 67/108 (62%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L L YPIE G+VT WDDMEK+W H F  EL V P + PVL+TE  LNP+  REK+ ++MF
Sbjct: 68  LHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREKLAEMMF 127

Query: 444 ETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ETF+ P  Y++  AV +LYAS         S    +   P  +GY+LP
Sbjct: 128 ETFSVPGFYLSNHAVAALYASACVTGLVVDSGDGVTCTVPIFEGYSLP 175



 Score = 50.0 bits (114), Expect = 7e-06
 Identities = 24/58 (41%), Positives = 36/58 (62%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +V A++ DNGSG+CKAG +G+  PR V  S++G  +    +  + QK  +VG EA  K
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK-YFVGQEALYK 64


>AF440739-1|AAM00432.1|  376|Homo sapiens actin-related protein T1
           protein.
          Length = 376

 Score =  111 bits (266), Expect = 3e-24
 Identities = 52/108 (48%), Positives = 67/108 (62%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L L YPIE G+VT WDDMEK+W H F  EL V P + PVL+TE  LNP+  REK+ ++MF
Sbjct: 68  LHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREKLAEMMF 127

Query: 444 ETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ETF+ P  Y++  AV +LYAS         S    +   P  +GY+LP
Sbjct: 128 ETFSVPGFYLSNHAVAALYASACVTGLVVDSGDGVTCTVPIFEGYSLP 175



 Score = 50.0 bits (114), Expect = 7e-06
 Identities = 24/58 (41%), Positives = 36/58 (62%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +V A++ DNGSG+CKAG +G+  PR V  S++G  +    +  + QK  +VG EA  K
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK-YFVGQEALYK 64


>AY970450-1|AAX82258.1|  102|Homo sapiens actin-like protein
           protein.
          Length = 102

 Score =  110 bits (264), Expect = 5e-24
 Identities = 50/63 (79%), Positives = 56/63 (88%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNEL VAP+EHPVLLT+ PLNPKAN EK+ QIMFETFN PAMY+AI  +LS+Y
Sbjct: 1   KIWHHTFYNEL-VAPKEHPVLLTKVPLNPKANHEKIAQIMFETFNIPAMYMAIWVMLSVY 59

Query: 501 ASG 509
           ASG
Sbjct: 60  ASG 62


>BC029499-1|AAH29499.1|  376|Homo sapiens actin-related protein T2
           protein.
          Length = 376

 Score =  109 bits (261), Expect = 1e-23
 Identities = 50/108 (46%), Positives = 66/108 (61%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+ NREKM ++MF
Sbjct: 68  LQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVMF 127

Query: 444 ETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           E F  PA Y++ QAVL+LYAS         S    +   P  +GY+LP
Sbjct: 128 ENFGVPAFYLSDQAVLALYASACVTGLVVDSGDAVTCTVPIFEGYSLP 175



 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 25/55 (45%), Positives = 33/55 (60%)
 Frame = +1

Query: 91  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+EA  K
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQK-YFVGEEALYK 64


>AY970393-1|AAX82202.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  109 bits (261), Expect = 1e-23
 Identities = 58/91 (63%), Positives = 66/91 (72%), Gaps = 2/91 (2%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF-NTPAMYVAIQA-VLS 494
           KIWHHTFYN+L + PEEHP+LLT+APLNPKAN  KMTQI FETF NTPA+Y+AIQA VLS
Sbjct: 1   KIWHHTFYNKLCMTPEEHPMLLTQAPLNPKAN-HKMTQITFETFSNTPAIYMAIQAVVLS 59

Query: 495 LYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           LYASG+       S    +   P   G ALP
Sbjct: 60  LYASGLTTGIVMDSGNGVTHTVPIYDGNALP 90


>AL356984-1|CAH72587.1|  377|Homo sapiens actin-related protein M2
           (ARPM2) protein.
          Length = 377

 Score =  109 bits (261), Expect = 1e-23
 Identities = 50/108 (46%), Positives = 66/108 (61%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+ NREKM ++MF
Sbjct: 69  LQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVMF 128

Query: 444 ETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           E F  PA Y++ QAVL+LYAS         S    +   P  +GY+LP
Sbjct: 129 ENFGVPAFYLSDQAVLALYASACVTGLVVDSGDAVTCTVPIFEGYSLP 176



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 25/55 (45%), Positives = 33/55 (60%)
 Frame = +1

Query: 91  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+EA  K
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYK 65


>AK058153-1|BAB71690.1|  328|Homo sapiens protein ( Homo sapiens
           cDNA FLJ25424 fis, clone TST04169. ).
          Length = 328

 Score =  109 bits (261), Expect = 1e-23
 Identities = 50/108 (46%), Positives = 66/108 (61%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+ NREKM ++MF
Sbjct: 69  LQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVMF 128

Query: 444 ETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           E F  PA Y++ QAVL+LYAS         S    +   P  +GY+LP
Sbjct: 129 ENFGVPAFYLSDQAVLALYASACVTGLVVDSGDAVTCTVPIFEGYSLP 176



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 25/55 (45%), Positives = 33/55 (60%)
 Frame = +1

Query: 91  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+EA  K
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYK 65


>AF440740-1|AAM00433.1|  377|Homo sapiens actin-related protein T2
           protein.
          Length = 377

 Score =  109 bits (261), Expect = 1e-23
 Identities = 50/108 (46%), Positives = 66/108 (61%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+ NREKM ++MF
Sbjct: 69  LQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVMF 128

Query: 444 ETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           E F  PA Y++ QAVL+LYAS         S    +   P  +GY+LP
Sbjct: 129 ENFGVPAFYLSDQAVLALYASACVTGLVVDSGDAVTCTVPIFEGYSLP 176



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 25/55 (45%), Positives = 33/55 (60%)
 Frame = +1

Query: 91  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+EA  K
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYK 65


>AB057364-1|BAB85862.1|  377|Homo sapiens actin-related protein
           hArpM2 protein.
          Length = 377

 Score =  109 bits (261), Expect = 1e-23
 Identities = 50/108 (46%), Positives = 66/108 (61%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+ NREKM ++MF
Sbjct: 69  LQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVMF 128

Query: 444 ETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           E F  PA Y++ QAVL+LYAS         S    +   P  +GY+LP
Sbjct: 129 ENFGVPAFYLSDQAVLALYASACVTGLVVDSGDAVTCTVPIFEGYSLP 176



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 25/55 (45%), Positives = 33/55 (60%)
 Frame = +1

Query: 91  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+EA  K
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYK 65


>AY970482-1|AAX82288.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  108 bits (260), Expect = 1e-23
 Identities = 49/63 (77%), Positives = 55/63 (87%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHHTFYNEL VA +EHP+LLT+ PL+PKAN +KMTQIM E F+ PAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTKVPLSPKANHKKMTQIMLEIFDRPAMYVAIQAVLSLY 60

Query: 501 ASG 509
            SG
Sbjct: 61  TSG 63



 Score = 38.7 bits (86), Expect = 0.017
 Identities = 16/21 (76%), Positives = 18/21 (85%)
 Frame = +2

Query: 509 RTTGIVLDFGDGVFHTVPIYE 571
           RTT IV+D+ DGV HTVPIYE
Sbjct: 64  RTTDIVMDYDDGVTHTVPIYE 84


>BC036253-1|AAH36253.1|  339|Homo sapiens ACTR2 protein protein.
          Length = 339

 Score =  108 bits (259), Expect = 2e-23
 Identities = 52/115 (45%), Positives = 74/115 (64%), Gaps = 1/115 (0%)
 Frame = +3

Query: 246 TEQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANRE 422
           +E R +L + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP  NRE
Sbjct: 7   SELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNRE 66

Query: 423 KMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           K+ ++MFET+    +YVAIQAVL+LYA G+       S    +  CP  +G++LP
Sbjct: 67  KIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLP 121


>AF006082-1|AAB64187.1|  394|Homo sapiens Arp2 protein.
          Length = 394

 Score =  108 bits (259), Expect = 2e-23
 Identities = 52/115 (45%), Positives = 74/115 (64%), Gaps = 1/115 (0%)
 Frame = +3

Query: 246 TEQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANRE 422
           +E R +L + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP  NRE
Sbjct: 62  SELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNRE 121

Query: 423 KMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           K+ ++MFET+    +YVAIQAVL+LYA G+       S    +  CP  +G++LP
Sbjct: 122 KIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLP 176



 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 2/53 (3%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEA 246
           +V DNG+G  K G+AG + P  +FP++VGRP  R    +  +  KD  VGDEA
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEA 61


>AY970435-1|AAX82244.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  107 bits (258), Expect = 2e-23
 Identities = 54/89 (60%), Positives = 63/89 (70%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIWHH FYNEL VA EE  VLLTE PLNP+ANREKMTQIMF+TFNT AMYVAI+AVL+L+
Sbjct: 1   KIWHHVFYNELCVALEEQVVLLTEPPLNPRANREKMTQIMFKTFNTQAMYVAIRAVLTLH 60

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           +SG        S    +   P  + + LP
Sbjct: 61  SSGCTTGIVMDSGDGVTHTVPIYERHTLP 89


>BC014546-1|AAH14546.1|  394|Homo sapiens ARP2 actin-related protein
           2 homolog (yeast) protein.
          Length = 394

 Score =  105 bits (251), Expect = 2e-22
 Identities = 51/115 (44%), Positives = 72/115 (62%), Gaps = 1/115 (0%)
 Frame = +3

Query: 246 TEQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANRE 422
           +E R  L + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP  NRE
Sbjct: 62  SELRSTLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNRE 121

Query: 423 KMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           K+ ++MFET+    +YVAIQAVL+LYA G+       S    +  CP  + ++LP
Sbjct: 122 KIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYESFSLP 176



 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 2/53 (3%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEA 246
           +V DNG+G  K G+AG + P  +FP++VGRP  R    +  +  KD  VGDEA
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEA 61


>AK055346-1|BAB70906.1|  372|Homo sapiens protein ( Homo sapiens
           cDNA FLJ30784 fis, clone FEBRA2000881, moderately
           similar to ACTIN 6. ).
          Length = 372

 Score =  105 bits (251), Expect = 2e-22
 Identities = 52/137 (37%), Positives = 79/137 (57%)
 Frame = +3

Query: 177 GKAPPSGRDGRYGTEGLLCRR*GTEQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 356
           G+A    R  + G E L       + R  L + YP+E G++T+W+DME +W H +   L+
Sbjct: 36  GRAKGQSRAAQGGLE-LCVGDQAQDWRSSLFISYPVERGLITSWEDMEIMWKHIYDYNLK 94

Query: 357 VAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTS 536
           + P + PVL+TE  LNP ANR+++T++ FE    PA Y++IQAVL+L+A+G        S
Sbjct: 95  LKPCDGPVLITEPALNPLANRQQITEMFFEHLGVPAFYMSIQAVLALFAAGFTTGLVLNS 154

Query: 537 ATVSSTPCPFTKGYALP 587
               +   P  +GY LP
Sbjct: 155 GAGVTQSVPIFEGYCLP 171



 Score = 50.4 bits (115), Expect = 5e-06
 Identities = 24/52 (46%), Positives = 34/52 (65%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VGD+AQ
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVGDQAQ 58


>AB049117-1|BAB39481.1|  372|Homo sapiens actin related protein
           protein.
          Length = 372

 Score =  105 bits (251), Expect = 2e-22
 Identities = 52/137 (37%), Positives = 79/137 (57%)
 Frame = +3

Query: 177 GKAPPSGRDGRYGTEGLLCRR*GTEQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 356
           G+A    R  + G E L       + R  L + YP+E G++T+W+DME +W H +   L+
Sbjct: 36  GRAKGQSRAAQGGLE-LCVGDQAQDWRSSLFISYPVERGLITSWEDMEIMWKHIYDYNLK 94

Query: 357 VAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTS 536
           + P + PVL+TE  LNP ANR+++T++ FE    PA Y++IQAVL+L+A+G        S
Sbjct: 95  LKPCDGPVLITEPALNPLANRQQITEMFFEHLGVPAFYMSIQAVLALFAAGFTTGLVLNS 154

Query: 537 ATVSSTPCPFTKGYALP 587
               +   P  +GY LP
Sbjct: 155 GAGVTQSVPIFEGYCLP 171



 Score = 50.4 bits (115), Expect = 5e-06
 Identities = 24/52 (46%), Positives = 34/52 (65%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VGD+AQ
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVGDQAQ 58


>BC014610-1|AAH14610.1|  435|Homo sapiens actin-like 7A protein.
          Length = 435

 Score =  103 bits (247), Expect = 5e-22
 Identities = 46/108 (42%), Positives = 68/108 (62%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P  NREK  +++F
Sbjct: 129 LKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLF 188

Query: 444 ETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           E FNTPAM++A Q+ LS+Y+ G             S   P  +GY LP
Sbjct: 189 EAFNTPAMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLP 236



 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 22/55 (40%), Positives = 31/55 (56%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 243
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG E
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQE 121


>AL359692-4|CAI40571.1|  435|Homo sapiens actin-like 7A protein.
          Length = 435

 Score =  103 bits (247), Expect = 5e-22
 Identities = 46/108 (42%), Positives = 68/108 (62%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P  NREK  +++F
Sbjct: 129 LKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLF 188

Query: 444 ETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           E FNTPAM++A Q+ LS+Y+ G             S   P  +GY LP
Sbjct: 189 EAFNTPAMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLP 236



 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 22/55 (40%), Positives = 31/55 (56%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 243
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG E
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQE 121


>AF113526-1|AAD44109.1|  435|Homo sapiens actin-like-7-alpha
           protein.
          Length = 435

 Score =  103 bits (247), Expect = 5e-22
 Identities = 46/108 (42%), Positives = 68/108 (62%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P  NREK  +++F
Sbjct: 129 LKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLF 188

Query: 444 ETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           E FNTPAM++A Q+ LS+Y+ G             S   P  +GY LP
Sbjct: 189 EAFNTPAMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLP 236



 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 22/55 (40%), Positives = 31/55 (56%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 243
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG E
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQE 121


>AB284520-1|BAF41971.1|  435|Homo sapiens human t-actin 2 protein.
          Length = 435

 Score =  103 bits (247), Expect = 5e-22
 Identities = 46/108 (42%), Positives = 68/108 (62%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P  NREK  +++F
Sbjct: 129 LKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLF 188

Query: 444 ETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           E FNTPAM++A Q+ LS+Y+ G             S   P  +GY LP
Sbjct: 189 EAFNTPAMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLP 236



 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 22/55 (40%), Positives = 31/55 (56%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 243
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG E
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQE 121


>BC007289-1|AAH07289.1|  372|Homo sapiens actin related protein M1
           protein.
          Length = 372

 Score =   99 bits (238), Expect = 6e-21
 Identities = 51/137 (37%), Positives = 78/137 (56%)
 Frame = +3

Query: 177 GKAPPSGRDGRYGTEGLLCRR*GTEQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 356
           G+A    R  + G E L       + R  L + YP+E G++T+ +DME +W H +   L+
Sbjct: 36  GRAKGQSRAAQGGLE-LCVGDQAQDWRSSLFISYPVERGLITSCEDMEIMWKHIYDYNLK 94

Query: 357 VAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTS 536
           + P + PVL+TE  LNP ANR+++T++ FE    PA Y++IQAVL+L+A+G        S
Sbjct: 95  LKPCDGPVLITEPALNPLANRQQITEMFFEHLGVPAFYMSIQAVLALFAAGFTTGLVLNS 154

Query: 537 ATVSSTPCPFTKGYALP 587
               +   P  +GY LP
Sbjct: 155 GAGVTQSVPIFEGYCLP 171



 Score = 50.4 bits (115), Expect = 5e-06
 Identities = 24/52 (46%), Positives = 34/52 (65%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VGD+AQ
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVGDQAQ 58


>BC033789-1|AAH33789.1|  415|Homo sapiens actin-like 7B protein.
          Length = 415

 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 45/108 (41%), Positives = 68/108 (62%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L L  P++HGIV +WD ++ IW + F   +++ PEEH VL+++ PL+P +NREK  ++MF
Sbjct: 109 LKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELMF 168

Query: 444 ETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ETF  PAM+V  Q++LS+Y+ G        S    S   P ++G  LP
Sbjct: 169 ETFGIPAMHVTSQSLLSIYSYGKTSGLVVESGHGVSHVVPISEGDVLP 216



 Score = 37.5 bits (83), Expect = 0.039
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 243
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG E
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHE 101


>AL359692-3|CAI40570.1|  415|Homo sapiens actin-like 7B protein.
          Length = 415

 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 45/108 (41%), Positives = 68/108 (62%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L L  P++HGIV +WD ++ IW + F   +++ PEEH VL+++ PL+P +NREK  ++MF
Sbjct: 109 LKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELMF 168

Query: 444 ETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ETF  PAM+V  Q++LS+Y+ G        S    S   P ++G  LP
Sbjct: 169 ETFGIPAMHVTSQSLLSIYSYGKTSGLVVESGHGVSHVVPISEGDVLP 216



 Score = 37.5 bits (83), Expect = 0.039
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 243
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG E
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHE 101


>AF113527-1|AAD44110.1|  415|Homo sapiens actin-like-7-beta protein.
          Length = 415

 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 45/108 (41%), Positives = 68/108 (62%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L L  P++HGIV +WD ++ IW + F   +++ PEEH VL+++ PL+P +NREK  ++MF
Sbjct: 109 LKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELMF 168

Query: 444 ETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ETF  PAM+V  Q++LS+Y+ G        S    S   P ++G  LP
Sbjct: 169 ETFGIPAMHVTSQSLLSIYSYGKTSGLVVESGHGVSHVVPISEGDVLP 216



 Score = 37.5 bits (83), Expect = 0.039
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 243
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG E
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHE 101


>AB284521-1|BAF41972.1|  415|Homo sapiens t-actin 1 protein.
          Length = 415

 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 45/108 (41%), Positives = 68/108 (62%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L L  P++HGIV +WD ++ IW + F   +++ PEEH VL+++ PL+P +NREK  ++MF
Sbjct: 109 LKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELMF 168

Query: 444 ETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ETF  PAM+V  Q++LS+Y+ G        S    S   P ++G  LP
Sbjct: 169 ETFGIPAMHVTSQSLLSIYSYGKTSGLVVESGHGVSHVVPISEGDVLP 216



 Score = 37.5 bits (83), Expect = 0.039
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 243
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG E
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHE 101


>BC045752-1|AAH45752.1|  416|Homo sapiens hypothetical protein
           MGC33407 protein.
          Length = 416

 Score = 97.5 bits (232), Expect = 3e-20
 Identities = 49/108 (45%), Positives = 68/108 (62%), Gaps = 1/108 (0%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           LTL  P+  GIV +WD  E IW H   ++LRVA  +HP+L ++ P +P  NREK+ ++ F
Sbjct: 108 LTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLFSDPPFSPATNREKLVEVAF 167

Query: 444 ETFNTPAMYVAIQAVLSLYASG-VPPVSCWTSATVSSTPCPFTKGYAL 584
           E+  +PAMYVA Q+VLS+YA G V  +   T   V+ T  P  +GY L
Sbjct: 168 ESLRSPAMYVASQSVLSVYAHGRVSGLVVDTGHGVTYT-VPVFQGYNL 214



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 17/56 (30%), Positives = 30/56 (53%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           +  A+V+D G+G CK GFAG  +P     +I+G    +    G     +++G+ A+
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIGEAAR 103


>BC024028-1|AAH24028.1|  416|Homo sapiens hypothetical protein
           MGC33407 protein.
          Length = 416

 Score = 97.5 bits (232), Expect = 3e-20
 Identities = 49/108 (45%), Positives = 68/108 (62%), Gaps = 1/108 (0%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           LTL  P+  GIV +WD  E IW H   ++LRVA  +HP+L ++ P +P  NREK+ ++ F
Sbjct: 108 LTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLFSDPPFSPATNREKLVEVAF 167

Query: 444 ETFNTPAMYVAIQAVLSLYASG-VPPVSCWTSATVSSTPCPFTKGYAL 584
           E+  +PAMYVA Q+VLS+YA G V  +   T   V+ T  P  +GY L
Sbjct: 168 ESLRSPAMYVASQSVLSVYAHGRVSGLVVDTGHGVTYT-VPVFQGYNL 214



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 17/56 (30%), Positives = 30/56 (53%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           +  A+V+D G+G CK GFAG  +P     +I+G    +    G     +++G+ A+
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIGEAAR 103


>AY970399-1|AAX82208.1|   97|Homo sapiens actin-like protein
           protein.
          Length = 97

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 54/89 (60%), Positives = 60/89 (67%)
 Frame = +3

Query: 321 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 500
           KIW    YNEL VAPEEHPV LTEAP+N KAN +KMTQIMFETFNTPA+YVA    +SLY
Sbjct: 1   KIW---LYNELGVAPEEHPVQLTEAPMNHKANCKKMTQIMFETFNTPAIYVAF---VSLY 54

Query: 501 ASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ASG        S    +   P  KG+ALP
Sbjct: 55  ASGRTTSIMMDSGDGVTHTVPMYKGHALP 83


>BC044590-1|AAH44590.1|  418|Homo sapiens ARP3 actin-related protein
           3 homolog (yeast) protein.
          Length = 418

 Score = 94.3 bits (224), Expect = 3e-19
 Identities = 42/78 (53%), Positives = 53/78 (67%)
 Frame = +3

Query: 273 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 452
           K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE+F
Sbjct: 75  KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESF 134

Query: 453 NTPAMYVAIQAVLSLYAS 506
           N P +Y+A+QAVL+L AS
Sbjct: 135 NVPGLYIAVQAVLALAAS 152



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 8/63 (12%)
 Frame = +1

Query: 91  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 246
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GDEA
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 247 QSK 255
             K
Sbjct: 67  IEK 69



 Score = 31.1 bits (67), Expect = 3.4
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 506 RRTTGIVLDFGDGVFHTVPIYE 571
           R  TG V+D GDGV H +P+ E
Sbjct: 161 RTLTGTVIDSGDGVTHVIPVAE 182


>AF127773-1|AAD51904.1|  418|Homo sapiens unknown protein.
          Length = 418

 Score = 94.3 bits (224), Expect = 3e-19
 Identities = 42/78 (53%), Positives = 53/78 (67%)
 Frame = +3

Query: 273 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 452
           K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE+F
Sbjct: 75  KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESF 134

Query: 453 NTPAMYVAIQAVLSLYAS 506
           N P +Y+A+QAVL+L AS
Sbjct: 135 NVPGLYIAVQAVLALAAS 152



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 8/63 (12%)
 Frame = +1

Query: 91  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 246
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GDEA
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 247 QSK 255
             K
Sbjct: 67  IEK 69



 Score = 31.1 bits (67), Expect = 3.4
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 506 RRTTGIVLDFGDGVFHTVPIYE 571
           R  TG V+D GDGV H +P+ E
Sbjct: 161 RTLTGTVIDSGDGVTHVIPVAE 182


>AF006083-1|AAB64188.1|  418|Homo sapiens Arp3 protein.
          Length = 418

 Score = 94.3 bits (224), Expect = 3e-19
 Identities = 42/78 (53%), Positives = 53/78 (67%)
 Frame = +3

Query: 273 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 452
           K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE+F
Sbjct: 75  KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESF 134

Query: 453 NTPAMYVAIQAVLSLYAS 506
           N P +Y+A+QAVL+L AS
Sbjct: 135 NVPGLYIAVQAVLALAAS 152



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 8/63 (12%)
 Frame = +1

Query: 91  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 246
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GDEA
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 247 QSK 255
             K
Sbjct: 67  IEK 69



 Score = 31.1 bits (67), Expect = 3.4
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 506 RRTTGIVLDFGDGVFHTVPIYE 571
           R  TG V+D GDGV H +P+ E
Sbjct: 161 RTLTGTVIDSGDGVTHVIPVAE 182


>AC110769-1|AAX93226.1|  418|Homo sapiens unknown protein.
          Length = 418

 Score = 94.3 bits (224), Expect = 3e-19
 Identities = 42/78 (53%), Positives = 53/78 (67%)
 Frame = +3

Query: 273 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 452
           K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE+F
Sbjct: 75  KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESF 134

Query: 453 NTPAMYVAIQAVLSLYAS 506
           N P +Y+A+QAVL+L AS
Sbjct: 135 NVPGLYIAVQAVLALAAS 152



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 8/63 (12%)
 Frame = +1

Query: 91  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 246
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GDEA
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 247 QSK 255
             K
Sbjct: 67  IEK 69



 Score = 31.1 bits (67), Expect = 3.4
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 506 RRTTGIVLDFGDGVFHTVPIYE 571
           R  TG V+D GDGV H +P+ E
Sbjct: 161 RTLTGTVIDSGDGVTHVIPVAE 182


>AB209353-1|BAD92590.1|  369|Homo sapiens ARP3 actin-related protein
           3 homolog variant protein.
          Length = 369

 Score = 94.3 bits (224), Expect = 3e-19
 Identities = 42/78 (53%), Positives = 53/78 (67%)
 Frame = +3

Query: 273 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 452
           K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE+F
Sbjct: 26  KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESF 85

Query: 453 NTPAMYVAIQAVLSLYAS 506
           N P +Y+A+QAVL+L AS
Sbjct: 86  NVPGLYIAVQAVLALAAS 103


>BC015207-1|AAH15207.1|  348|Homo sapiens ARP3 actin-related protein
           3 homolog B (yeast) protein.
          Length = 348

 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 40/78 (51%), Positives = 54/78 (69%)
 Frame = +3

Query: 273 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 452
           K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE PLN   NRE + +IMFE+F
Sbjct: 75  KWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESF 134

Query: 453 NTPAMYVAIQAVLSLYAS 506
           N P +Y+A+QAVL+L AS
Sbjct: 135 NVPGLYIAVQAVLALAAS 152



 Score = 34.7 bits (76), Expect = 0.27
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 8/61 (13%)
 Frame = +1

Query: 97  VVDNGSGMCKAGFAGDDAPRAVFPSIVG--------RPRHQGVMVGMGQKDSYVGDEAQS 252
           VVD G+G  K G+AG+  P+ + PS +             + V+ G+   D ++GDEA  
Sbjct: 9   VVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAID 68

Query: 253 K 255
           K
Sbjct: 69  K 69



 Score = 33.1 bits (72), Expect = 0.83
 Identities = 13/22 (59%), Positives = 16/22 (72%)
 Frame = +2

Query: 506 RRTTGIVLDFGDGVFHTVPIYE 571
           R  TGIV+D GDGV H +P+ E
Sbjct: 161 RTLTGIVIDSGDGVTHVIPVAE 182


>BC008682-1|AAH08682.1|  418|Homo sapiens ARP3 actin-related protein
           3 homolog B (yeast) protein.
          Length = 418

 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 40/78 (51%), Positives = 54/78 (69%)
 Frame = +3

Query: 273 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 452
           K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE PLN   NRE + +IMFE+F
Sbjct: 75  KWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESF 134

Query: 453 NTPAMYVAIQAVLSLYAS 506
           N P +Y+A+QAVL+L AS
Sbjct: 135 NVPGLYIAVQAVLALAAS 152



 Score = 34.7 bits (76), Expect = 0.27
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 8/61 (13%)
 Frame = +1

Query: 97  VVDNGSGMCKAGFAGDDAPRAVFPSIVG--------RPRHQGVMVGMGQKDSYVGDEAQS 252
           VVD G+G  K G+AG+  P+ + PS +             + V+ G+   D ++GDEA  
Sbjct: 9   VVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAID 68

Query: 253 K 255
           K
Sbjct: 69  K 69



 Score = 33.1 bits (72), Expect = 0.83
 Identities = 13/22 (59%), Positives = 16/22 (72%)
 Frame = +2

Query: 506 RRTTGIVLDFGDGVFHTVPIYE 571
           R  TGIV+D GDGV H +P+ E
Sbjct: 161 RTLTGIVIDSGDGVTHVIPVAE 182


>AF086920-1|AAP97150.1|  402|Homo sapiens actin related protein ARP4
           protein.
          Length = 402

 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 40/78 (51%), Positives = 54/78 (69%)
 Frame = +3

Query: 273 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 452
           K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE PLN   NRE + +IMFE+F
Sbjct: 56  KWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESF 115

Query: 453 NTPAMYVAIQAVLSLYAS 506
           N P +Y+A+QAVL+L AS
Sbjct: 116 NVPGLYIAVQAVLALAAS 133



 Score = 31.9 bits (69), Expect = 1.9
 Identities = 12/20 (60%), Positives = 15/20 (75%)
 Frame = +2

Query: 506 RRTTGIVLDFGDGVFHTVPI 565
           R  TGIV+D GDGV H +P+
Sbjct: 142 RTLTGIVIDSGDGVTHVIPV 161


>AF023453-1|AAC98904.1|  418|Homo sapiens actin-related protein
           3-beta protein.
          Length = 418

 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 40/78 (51%), Positives = 54/78 (69%)
 Frame = +3

Query: 273 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 452
           K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE PLN   NRE + +IMFE+F
Sbjct: 75  KWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESF 134

Query: 453 NTPAMYVAIQAVLSLYAS 506
           N P +Y+A+QAVL+L AS
Sbjct: 135 NVPGLYIAVQAVLALAAS 152



 Score = 34.7 bits (76), Expect = 0.27
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 8/61 (13%)
 Frame = +1

Query: 97  VVDNGSGMCKAGFAGDDAPRAVFPSIVG--------RPRHQGVMVGMGQKDSYVGDEAQS 252
           VVD G+G  K G+AG+  P+ + PS +             + V+ G+   D ++GDEA  
Sbjct: 9   VVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAID 68

Query: 253 K 255
           K
Sbjct: 69  K 69



 Score = 33.1 bits (72), Expect = 0.83
 Identities = 13/22 (59%), Positives = 16/22 (72%)
 Frame = +2

Query: 506 RRTTGIVLDFGDGVFHTVPIYE 571
           R  TGIV+D GDGV H +P+ E
Sbjct: 161 RTLTGIVIDSGDGVTHVIPVAE 182


>BC020944-1|AAH20944.1|  426|Homo sapiens actin-like 6B protein.
          Length = 426

 Score = 84.2 bits (199), Expect = 3e-16
 Identities = 37/102 (36%), Positives = 60/102 (58%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 458
           P+++G++ +W+    I  HT+   ++  P  HPVL++EAP N +A REK+T++MFE +N 
Sbjct: 84  PLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNI 143

Query: 459 PAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYAL 584
           PA ++   AVL+ +A+G        S    +T  P   GY L
Sbjct: 144 PAFFLCKTAVLTAFANGRSTGLVLDSGATHTTAIPVHDGYVL 185



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           +EV ALV D GS   +AG+AG+D P+A FP+ VG
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVG 42


>AF053356-5|AAC78795.1|  475|Homo sapiens actin like gene protein.
          Length = 475

 Score = 84.2 bits (199), Expect = 3e-16
 Identities = 37/102 (36%), Positives = 60/102 (58%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 458
           P+++G++ +W+    I  HT+   ++  P  HPVL++EAP N +A REK+T++MFE +N 
Sbjct: 84  PLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNI 143

Query: 459 PAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYAL 584
           PA ++   AVL+ +A+G        S    +T  P   GY L
Sbjct: 144 PAFFLCKTAVLTAFANGRSTGLVLDSGATHTTAIPVHDGYVL 185



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           +EV ALV D GS   +AG+AG+D P+A FP+ VG
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVG 42


>AF041475-1|AAD54678.1|  426|Homo sapiens BAF53b protein.
          Length = 426

 Score = 84.2 bits (199), Expect = 3e-16
 Identities = 37/102 (36%), Positives = 60/102 (58%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 458
           P+++G++ +W+    I  HT+   ++  P  HPVL++EAP N +A REK+T++MFE +N 
Sbjct: 84  PLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNI 143

Query: 459 PAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYAL 584
           PA ++   AVL+ +A+G        S    +T  P   GY L
Sbjct: 144 PAFFLCKTAVLTAFANGRSTGLVLDSGATHTTAIPVHDGYVL 185



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           +EV ALV D GS   +AG+AG+D P+A FP+ VG
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVG 42


>AC099394-1|AAP21874.1|  426|Homo sapiens unknown protein.
          Length = 426

 Score = 84.2 bits (199), Expect = 3e-16
 Identities = 37/102 (36%), Positives = 60/102 (58%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 458
           P+++G++ +W+    I  HT+   ++  P  HPVL++EAP N +A REK+T++MFE +N 
Sbjct: 84  PLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNI 143

Query: 459 PAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYAL 584
           PA ++   AVL+ +A+G        S    +T  P   GY L
Sbjct: 144 PAFFLCKTAVLTAFANGRSTGLVLDSGATHTTAIPVHDGYVL 185



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           +EV ALV D GS   +AG+AG+D P+A FP+ VG
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVG 42


>AB015906-1|BAA74576.1|  426|Homo sapiens actin-related protein
           hArpN alpha protein.
          Length = 426

 Score = 84.2 bits (199), Expect = 3e-16
 Identities = 37/102 (36%), Positives = 60/102 (58%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 458
           P+++G++ +W+    I  HT+   ++  P  HPVL++EAP N +A REK+T++MFE +N 
Sbjct: 84  PLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNI 143

Query: 459 PAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYAL 584
           PA ++   AVL+ +A+G        S    +T  P   GY L
Sbjct: 144 PAFFLCKTAVLTAFANGRSTGLVLDSGATHTTAIPVHDGYVL 185



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           +EV ALV D GS   +AG+AG+D P+A FP+ VG
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVG 42


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 111,903,165
Number of Sequences: 237096
Number of extensions: 2877309
Number of successful extensions: 9041
Number of sequences better than 10.0: 307
Number of HSP's better than 10.0 without gapping: 7732
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8758
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6860268620
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).