SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0025
         (588 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U63743-1|AAC27660.1|  725|Homo sapiens mitotic centromere-associ...    31   2.3  
CR450302-1|CAG29298.1|  725|Homo sapiens KIF2C protein.                31   2.3  
BT006759-1|AAP35405.1|  725|Homo sapiens kinesin-like 6 (mitotic...    31   2.3  
BC032038-1|AAH32038.1|  468|Homo sapiens Unknown (protein for IM...    31   2.3  
BC014924-1|AAH14924.1|  725|Homo sapiens kinesin family member 2...    31   2.3  
BC008764-1|AAH08764.1|  725|Homo sapiens kinesin family member 2...    31   2.3  
AY026505-1|AAK20168.1|  671|Homo sapiens testis specific mitotic...    31   2.3  
AL592166-4|CAI12999.1|  671|Homo sapiens kinesin family member 2...    31   2.3  
AL592166-2|CAI12997.1|  725|Homo sapiens kinesin family member 2...    31   2.3  
AL592166-1|CAI12996.1|  336|Homo sapiens kinesin family member 2...    31   2.3  

>U63743-1|AAC27660.1|  725|Homo sapiens mitotic
           centromere-associated kinesin protein.
          Length = 725

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 23/72 (31%), Positives = 34/72 (47%)
 Frame = -1

Query: 336 PSWTRLE*NEPEIQLVLHLYLLNSALFFCSRTFGSTPDPIVFCNFSSRPLLQS*KVSRLF 157
           PS   L  +EP++++ L  YL N A  F    F  T    V   F++RPL+Q+       
Sbjct: 284 PSKCLLLVHEPKLKVDLTKYLENQAFCF-DFAFDETASNEVVYRFTARPLVQTIFEGGKA 342

Query: 156 NCCAHGKRHQNK 121
            C A+G+    K
Sbjct: 343 TCFAYGQTGSGK 354


>CR450302-1|CAG29298.1|  725|Homo sapiens KIF2C protein.
          Length = 725

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 23/72 (31%), Positives = 34/72 (47%)
 Frame = -1

Query: 336 PSWTRLE*NEPEIQLVLHLYLLNSALFFCSRTFGSTPDPIVFCNFSSRPLLQS*KVSRLF 157
           PS   L  +EP++++ L  YL N A  F    F  T    V   F++RPL+Q+       
Sbjct: 284 PSKCLLLVHEPKLKVDLTKYLENQAFCF-DFAFDETASNEVVYRFTARPLVQTIFEGGKA 342

Query: 156 NCCAHGKRHQNK 121
            C A+G+    K
Sbjct: 343 TCFAYGQTGSGK 354


>BT006759-1|AAP35405.1|  725|Homo sapiens kinesin-like 6 (mitotic
           centromere-associated kinesin) protein.
          Length = 725

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 23/72 (31%), Positives = 34/72 (47%)
 Frame = -1

Query: 336 PSWTRLE*NEPEIQLVLHLYLLNSALFFCSRTFGSTPDPIVFCNFSSRPLLQS*KVSRLF 157
           PS   L  +EP++++ L  YL N A  F    F  T    V   F++RPL+Q+       
Sbjct: 284 PSKCLLLVHEPKLKVDLTKYLENQAFCF-DFAFDETASNEVVYRFTARPLVQTIFEGGKA 342

Query: 156 NCCAHGKRHQNK 121
            C A+G+    K
Sbjct: 343 TCFAYGQTGSGK 354


>BC032038-1|AAH32038.1|  468|Homo sapiens Unknown (protein for
           IMAGE:5166633) protein.
          Length = 468

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 23/72 (31%), Positives = 34/72 (47%)
 Frame = -1

Query: 336 PSWTRLE*NEPEIQLVLHLYLLNSALFFCSRTFGSTPDPIVFCNFSSRPLLQS*KVSRLF 157
           PS   L  +EP++++ L  YL N A  F    F  T    V   F++RPL+Q+       
Sbjct: 27  PSKCLLLVHEPKLKVDLTKYLENQAFCF-DFAFDETASNEVVYRFTARPLVQTIFEGGKA 85

Query: 156 NCCAHGKRHQNK 121
            C A+G+    K
Sbjct: 86  TCFAYGQTGSGK 97


>BC014924-1|AAH14924.1|  725|Homo sapiens kinesin family member 2C
           protein.
          Length = 725

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 23/72 (31%), Positives = 34/72 (47%)
 Frame = -1

Query: 336 PSWTRLE*NEPEIQLVLHLYLLNSALFFCSRTFGSTPDPIVFCNFSSRPLLQS*KVSRLF 157
           PS   L  +EP++++ L  YL N A  F    F  T    V   F++RPL+Q+       
Sbjct: 284 PSKCLLLVHEPKLKVDLTKYLENQAFCF-DFAFDETASNEVVYRFTARPLVQTIFEGGKA 342

Query: 156 NCCAHGKRHQNK 121
            C A+G+    K
Sbjct: 343 TCFAYGQTGSGK 354


>BC008764-1|AAH08764.1|  725|Homo sapiens kinesin family member 2C
           protein.
          Length = 725

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 23/72 (31%), Positives = 34/72 (47%)
 Frame = -1

Query: 336 PSWTRLE*NEPEIQLVLHLYLLNSALFFCSRTFGSTPDPIVFCNFSSRPLLQS*KVSRLF 157
           PS   L  +EP++++ L  YL N A  F    F  T    V   F++RPL+Q+       
Sbjct: 284 PSKCLLLVHEPKLKVDLTKYLENQAFCF-DFAFDETASNEVVYRFTARPLVQTIFEGGKA 342

Query: 156 NCCAHGKRHQNK 121
            C A+G+    K
Sbjct: 343 TCFAYGQTGSGK 354


>AY026505-1|AAK20168.1|  671|Homo sapiens testis specific mitotic
           centromere-associated kinesin protein.
          Length = 671

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 23/72 (31%), Positives = 34/72 (47%)
 Frame = -1

Query: 336 PSWTRLE*NEPEIQLVLHLYLLNSALFFCSRTFGSTPDPIVFCNFSSRPLLQS*KVSRLF 157
           PS   L  +EP++++ L  YL N A  F    F  T    V   F++RPL+Q+       
Sbjct: 230 PSKCLLLVHEPKLKVDLTKYLENQAFCF-DFAFDETASNEVVYRFTARPLVQTIFEGGKA 288

Query: 156 NCCAHGKRHQNK 121
            C A+G+    K
Sbjct: 289 TCFAYGQTGSGK 300


>AL592166-4|CAI12999.1|  671|Homo sapiens kinesin family member 2C
           protein.
          Length = 671

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 23/72 (31%), Positives = 34/72 (47%)
 Frame = -1

Query: 336 PSWTRLE*NEPEIQLVLHLYLLNSALFFCSRTFGSTPDPIVFCNFSSRPLLQS*KVSRLF 157
           PS   L  +EP++++ L  YL N A  F    F  T    V   F++RPL+Q+       
Sbjct: 230 PSKCLLLVHEPKLKVDLTKYLENQAFCF-DFAFDETASNEVVYRFTARPLVQTIFEGGKA 288

Query: 156 NCCAHGKRHQNK 121
            C A+G+    K
Sbjct: 289 TCFAYGQTGSGK 300


>AL592166-2|CAI12997.1|  725|Homo sapiens kinesin family member 2C
           protein.
          Length = 725

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 23/72 (31%), Positives = 34/72 (47%)
 Frame = -1

Query: 336 PSWTRLE*NEPEIQLVLHLYLLNSALFFCSRTFGSTPDPIVFCNFSSRPLLQS*KVSRLF 157
           PS   L  +EP++++ L  YL N A  F    F  T    V   F++RPL+Q+       
Sbjct: 284 PSKCLLLVHEPKLKVDLTKYLENQAFCF-DFAFDETASNEVVYRFTARPLVQTIFEGGKA 342

Query: 156 NCCAHGKRHQNK 121
            C A+G+    K
Sbjct: 343 TCFAYGQTGSGK 354


>AL592166-1|CAI12996.1|  336|Homo sapiens kinesin family member 2C
           protein.
          Length = 336

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 23/72 (31%), Positives = 34/72 (47%)
 Frame = -1

Query: 336 PSWTRLE*NEPEIQLVLHLYLLNSALFFCSRTFGSTPDPIVFCNFSSRPLLQS*KVSRLF 157
           PS   L  +EP++++ L  YL N A  F    F  T    V   F++RPL+Q+       
Sbjct: 243 PSKCLLLVHEPKLKVDLTKYLENQAFCF-DFAFDETASNEVVYRFTARPLVQTIFEGGKA 301

Query: 156 NCCAHGKRHQNK 121
            C A+G+    K
Sbjct: 302 TCFAYGQTGSGK 313


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 79,093,858
Number of Sequences: 237096
Number of extensions: 1686305
Number of successful extensions: 4098
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 3971
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4098
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 6155099854
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).