SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0021
         (393 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BX538184-1|CAD98056.1|  215|Homo sapiens hypothetical protein pr...   127   1e-29
BC101466-1|AAI01467.1| 1849|Homo sapiens SET binding factor 2 pr...   127   1e-29
BC063656-1|AAH63656.1|  230|Homo sapiens SBF2 protein protein.        127   1e-29
BC053867-1|AAH53867.1|  254|Homo sapiens SBF2 protein protein.        127   1e-29
BC043389-1|AAH43389.1|  243|Homo sapiens SBF2 protein protein.        127   1e-29
AY234241-1|AAO62733.1| 1849|Homo sapiens SET binding factor 2 pr...   127   1e-29
BC011143-1|AAH11143.1|  100|Homo sapiens SBF2 protein protein.        125   5e-29
U93181-1|AAC39675.1| 1697|Homo sapiens nuclear dual-specificity ...   121   1e-27
BC087612-1|AAH87612.1| 1893|Homo sapiens SBF1 protein protein.        121   1e-27
BC046169-1|AAH46169.2|  400|Homo sapiens SBF1 protein protein.        121   1e-27
BC009268-1|AAH09268.2|  930|Homo sapiens SBF1 protein protein.        121   1e-27
AL096767-11|CAO03462.1| 1893|Homo sapiens SET binding factor 1 p...   121   1e-27
AL096767-10|CAI42962.1| 1867|Homo sapiens SET binding factor 1 p...   121   1e-27
AL096767-9|CAO03461.1| 1630|Homo sapiens SET binding factor 1 pr...   121   1e-27
AL096767-8|CAO03460.1|  414|Homo sapiens SET binding factor 1 pr...   121   1e-27
BC056915-1|AAH56915.1|  414|Homo sapiens SBF1 protein protein.        119   3e-27
BC013031-1|AAH13031.2|  691|Homo sapiens PHLDB1 protein protein.       49   6e-06
AK125783-1|BAC86289.1|  731|Homo sapiens protein ( Homo sapiens ...    49   6e-06
AK074918-1|BAC11292.1|  613|Homo sapiens protein ( Homo sapiens ...    49   6e-06
AK074070-1|BAB84896.1| 1326|Homo sapiens FLJ00141 protein protein.     49   6e-06
AK027510-1|BAB55164.1|  402|Homo sapiens protein ( Homo sapiens ...    49   6e-06
AB177859-1|BAD66837.1| 1125|Homo sapiens KIAA0638 splice variant...    49   6e-06
AB094090-1|BAC76044.1| 1377|Homo sapiens DLNB07 protein.               49   6e-06
AB014538-1|BAA31613.2| 1384|Homo sapiens KIAA0638 protein protein.     49   6e-06
BC150210-1|AAI50211.1| 1253|Homo sapiens PHLDB2 protein protein.       46   4e-05
BC142678-1|AAI42679.1| 1253|Homo sapiens PHLDB2 protein protein.       46   4e-05
BC031000-1|AAH31000.1|  195|Homo sapiens PHLDB2 protein protein.       46   4e-05
AJ496194-1|CAD42711.1| 1253|Homo sapiens LL5 beta protein protein.     46   4e-05
AF506820-1|AAM33634.1| 1210|Homo sapiens hypothetical protein pr...    46   4e-05
AB209903-1|BAD93140.1| 1259|Homo sapiens LL5 beta protein varian...    46   4e-05
EF560749-1|ABQ59059.1|  698|Homo sapiens ARHGAP22 protein protein.     45   8e-05
BC126444-1|AAI26445.1|  714|Homo sapiens ARHGAP22 protein protein.     45   8e-05
AY324801-1|AAP85632.1|  698|Homo sapiens Rho GTPase activating p...    45   8e-05
BC007947-1|AAH07947.3|  178|Homo sapiens PHLDB3 protein protein.       42   7e-04
Z97832-4|CAI20190.1|  631|Homo sapiens differentially expressed ...    41   0.001
AJ276095-1|CAC08450.1|  631|Homo sapiens Def-6 protein protein.        41   0.001
BC014510-1|AAH14510.1|  101|Homo sapiens PHLDB1 protein protein.       41   0.002
AY241694-1|AAO91767.1|  631|Homo sapiens IRF4-binding protein pr...    41   0.002
BC044567-1|AAH44567.1|  300|Homo sapiens pleckstrin homology dom...    40   0.003
AF286162-1|AAG15199.1|  300|Homo sapiens Phosphoinositol 4-phosp...    40   0.003
AC009948-4|AAX88884.1|  300|Homo sapiens unknown protein.              40   0.003
BC012924-1|AAH12924.1|  280|Homo sapiens DAPP1 protein protein.        39   0.007
BC003168-1|AAH03168.2|  764|Homo sapiens oxysterol binding prote...    39   0.007
AF392451-1|AAL40664.1|  764|Homo sapiens oxysterol-binding prote...    39   0.007
AF346291-1|AAK31140.1|  251|Homo sapiens OSBP related protein 10...    39   0.007
AF186022-1|AAF14578.1|  280|Homo sapiens B lymphocyte adapter pr...    39   0.007
AF178987-1|AAF44351.1|  280|Homo sapiens protein-tyrosine phosph...    39   0.007
AF163254-1|AAD49697.1|  280|Homo sapiens adaptor protein DAPP1 p...    39   0.007
BC053990-1|AAH53990.1|  455|Homo sapiens PLEKHA8 protein protein.      38   0.009
BC002838-1|AAH02838.1|  440|Homo sapiens pleckstrin homology dom...    38   0.009
AK023180-1|BAB14449.1|  372|Homo sapiens protein ( Homo sapiens ...    38   0.009
AF380162-1|AAK55424.1|  507|Homo sapiens phosphoinositol 4-phosp...    38   0.009
AF308300-1|AAG48267.1|  391|Homo sapiens serologically defined b...    38   0.009
AY026527-1|AAK07684.1|  917|Homo sapiens prostate antigen PARIS-...    38   0.012
AL591502-2|CAI12580.1|  917|Homo sapiens TBC1 domain family, mem...    38   0.012
AL591502-1|CAI12579.1|  860|Homo sapiens TBC1 domain family, mem...    38   0.012
AL360081-4|CAH71887.1|  917|Homo sapiens TBC1 domain family, mem...    38   0.012
AL360081-3|CAH71886.1|  860|Homo sapiens TBC1 domain family, mem...    38   0.012
AL137073-3|CAI13885.1|  917|Homo sapiens TBC1 domain family, mem...    38   0.012
AL137073-2|CAI13884.1|  860|Homo sapiens TBC1 domain family, mem...    38   0.012
AB209721-1|BAD92958.1|  452|Homo sapiens Hypothetical protein pp...    38   0.012
BC146787-1|AAI46788.1| 1364|Homo sapiens pleckstrin homology dom...    36   0.048
AK123305-1|BAC85577.1|  269|Homo sapiens protein ( Homo sapiens ...    36   0.048
AB033026-1|BAA86514.1| 1403|Homo sapiens KIAA1200 protein protein.     36   0.048
X07743-1|CAA30564.1|  350|Homo sapiens protein ( Human mRNA for ...    35   0.083
CR542079-1|CAG46876.1|  350|Homo sapiens PLEK protein.                 35   0.083
CR542056-1|CAG46853.1|  350|Homo sapiens PLEK protein.                 35   0.083
BC018549-1|AAH18549.1|  350|Homo sapiens pleckstrin protein.           35   0.083
AF125362-2|AAF37737.1|  389|Homo sapiens cytohesin 1 protein.          35   0.083
AC015969-2|AAX93121.1|  350|Homo sapiens unknown protein.              35   0.083
Z94160-1|CAI22121.1|  394|Homo sapiens pleckstrin homology, Sec7...    35   0.11 
X99753-1|CAA68084.1|  399|Homo sapiens Arno protein (ARF exchang...    35   0.11 
CR456551-1|CAG30437.1|  394|Homo sapiens PSCD4 protein.                35   0.11 
BC041161-1|AAH41161.1|  394|Homo sapiens pleckstrin homology, Se...    35   0.11 
BC028717-1|AAH28717.1|  399|Homo sapiens pleckstrin homology, Se...    35   0.11 
BC008191-1|AAH08191.1|  179|Homo sapiens PSCD3 protein protein.        35   0.11 
AJ223957-1|CAA11686.1|  399|Homo sapiens ARNO3 protein.                35   0.11 
AJ005197-1|CAA06434.1|  399|Homo sapiens GRP1 protein protein.         35   0.11 
AF125349-1|AAF28896.1|  394|Homo sapiens guanine nucleotide exch...    35   0.11 
AF075458-1|AAF15389.1|  394|Homo sapiens cytohesin-4 protein.          35   0.11 
AC004895-2|AAS00358.1|  179|Homo sapiens unknown protein.              35   0.11 
AC004895-1|AAS00357.1|  387|Homo sapiens unknown protein.              35   0.11 
AB028978-1|BAA83007.1|  868|Homo sapiens KIAA1055 protein protein.     35   0.11 
D29642-1|BAA06125.2|  666|Homo sapiens KIAA0053 protein.               34   0.19 
BC039591-1|AAH39591.1|  458|Homo sapiens ARHGAP25 protein protein.     34   0.19 
BC000616-1|AAH00616.1|  585|Homo sapiens SWAP-70 protein protein.      33   0.25 
AL831767-4|CAI14844.1|  736|Homo sapiens oxysterol binding prote...    33   0.25 
AL831767-2|CAI14842.1|  752|Homo sapiens oxysterol binding prote...    33   0.25 
AL831767-1|CAI14841.1|  741|Homo sapiens oxysterol binding prote...    33   0.25 
AL772260-5|CAH71119.1|  736|Homo sapiens oxysterol binding prote...    33   0.25 
AL772260-3|CAH71117.1|  752|Homo sapiens oxysterol binding prote...    33   0.25 
AL772260-2|CAH71116.1|  741|Homo sapiens oxysterol binding prote...    33   0.25 
AL050343-7|CAI22219.1|  736|Homo sapiens oxysterol binding prote...    33   0.25 
AL050343-5|CAI22218.1|  752|Homo sapiens oxysterol binding prote...    33   0.25 
AL050343-4|CAI22217.1|  741|Homo sapiens oxysterol binding prote...    33   0.25 
AK027535-1|BAB55184.1|  723|Homo sapiens protein ( Homo sapiens ...    33   0.25 
AF392445-1|AAL40658.1|  736|Homo sapiens oxysterol-binding prote...    33   0.25 
AF210818-1|AAF24486.1|  585|Homo sapiens SWAP-70 protein.              33   0.25 
AF134894-1|AAF61403.1|  585|Homo sapiens SWAP-70 homolog protein.      33   0.25 
AB208967-1|BAD92204.1|  308|Homo sapiens PLEK protein variant pr...    33   0.25 
AB014540-1|BAA31615.1|  603|Homo sapiens KIAA0640 protein protein.     33   0.25 
BC063310-1|AAH63310.1|  796|Homo sapiens PLEKHH2 protein protein.      33   0.34 
AY178997-1|AAO20108.1|  719|Homo sapiens oxysterol-binding prote...    33   0.34 
AL833400-1|CAD38637.1|  930|Homo sapiens hypothetical protein pr...    33   0.34 
AL831767-3|CAI14843.1|  719|Homo sapiens oxysterol binding prote...    33   0.34 
AL772260-4|CAH71118.1|  719|Homo sapiens oxysterol binding prote...    33   0.34 
AL050343-6|CAI22220.1|  719|Homo sapiens oxysterol binding prote...    33   0.34 
AB095948-1|BAC23124.1| 1449|Homo sapiens KIAA2028 protein protein.     33   0.34 
BX664700-3|CAI23598.1|  383|Homo sapiens pleckstrin homology dom...    33   0.44 
BX664700-2|CAI23597.1|  404|Homo sapiens pleckstrin homology dom...    33   0.44 
BC042458-1|AAH42458.1|  404|Homo sapiens pleckstrin homology dom...    33   0.44 
BC001136-1|AAH01136.1|  404|Homo sapiens pleckstrin homology dom...    33   0.44 
AF286160-1|AAG15197.1|  404|Homo sapiens Tandem PH Domain Contai...    33   0.44 
AC112700-1|AAY24006.1|   80|Homo sapiens unknown protein.              33   0.44 
AB209407-1|BAD92644.1|  230|Homo sapiens pleckstrin homology dom...    33   0.44 
BC064601-1|AAH64601.1|  583|Homo sapiens PLEKHA4 protein protein.      32   0.59 
BC024157-1|AAH24157.1|  779|Homo sapiens pleckstrin homology dom...    32   0.59 
AY007233-1|AAG01896.1|  779|Homo sapiens phosphoinositol 3-phosp...    32   0.59 
M86917-1|AAA59973.1|  807|Homo sapiens oxysterol-binding protein...    32   0.77 
BC011581-1|AAH11581.1|  807|Homo sapiens oxysterol binding prote...    32   0.77 
BC008056-1|AAH08056.2|  351|Homo sapiens PLEK2 protein protein.        32   0.77 
BC001226-1|AAH01226.1|  353|Homo sapiens pleckstrin 2 protein.         32   0.77 
AK002145-1|BAA92107.1|  201|Homo sapiens protein ( Homo sapiens ...    32   0.77 
AF286164-1|AAG15201.1|  304|Homo sapiens Tandem PH Domain Contai...    32   0.77 
AF228603-1|AAF34791.1|  353|Homo sapiens pleckstrin 2 protein.         32   0.77 
AF185705-1|AAG28373.1|  807|Homo sapiens oxysterol binding prote...    32   0.77 
AF185696-1|AAG17011.1|  807|Homo sapiens oxysterol-binding prote...    32   0.77 
D30758-1|BAA06418.2|  796|Homo sapiens KIAA0050 protein.               31   1.0  
BT009788-1|AAP88790.1|  740|Homo sapiens centaurin, beta 1 protein.    31   1.0  
BC127092-1|AAI27093.1| 1116|Homo sapiens pleckstrin homology dom...    31   1.0  
BC070174-1|AAH70174.1|  320|Homo sapiens PLEKHA5 protein protein.      31   1.0  
BC018543-1|AAH18543.1|  740|Homo sapiens centaurin, beta 1 protein.    31   1.0  
BC000969-1|AAH00969.1|  492|Homo sapiens PLEKHA5 protein protein.      31   1.0  
AF302150-1|AAG22817.1| 1116|Homo sapiens phosphoinositol 3-phosp...    31   1.0  
AB051473-1|BAB21777.2| 1175|Homo sapiens KIAA1686 protein protein.     31   1.0  
M85169-1|AAA36602.1|  398|Homo sapiens protein ( Human homologue...    31   1.4  
M23612-1|AAA35865.1|  870|Homo sapiens GTPase-activating protein...    31   1.4  
M23379-1|AAA52517.1| 1047|Homo sapiens GTPase-activating protein...    31   1.4  
BC050695-1|AAH50695.2|  222|Homo sapiens pleckstrin homology dom...    31   1.4  
BC050452-1|AAH50452.1|  398|Homo sapiens pleckstrin homology, Se...    31   1.4  
BC038385-1|AAH38385.1|  398|Homo sapiens pleckstrin homology, Se...    31   1.4  
BC033015-1|AAH33015.1| 1047|Homo sapiens RAS p21 protein activat...    31   1.4  
BC013991-1|AAH13991.1|  222|Homo sapiens pleckstrin homology dom...    31   1.4  
BC001428-1|AAH01428.1|  309|Homo sapiens pleckstrin homology dom...    31   1.4  
AK223338-1|BAD97058.1|  221|Homo sapiens pleckstrin homology dom...    31   1.4  
AK000790-1|BAA91379.1|  221|Homo sapiens protein ( Homo sapiens ...    31   1.4  
AF125362-1|AAF37738.1|  390|Homo sapiens cytohesin 1 protein.          31   1.4  
AC009477-2|AAX93135.1|  222|Homo sapiens unknown protein.              31   1.4  
AB209106-1|BAD92343.1|  871|Homo sapiens RAS p21 protein activat...    31   1.4  
AB011143-1|BAA25497.2|  683|Homo sapiens KIAA0571 protein protein.     31   1.4  
U70728-1|AAB09591.1|  400|Homo sapiens cytohesin-2 protein.            31   1.8  
U59752-1|AAB17532.1|  266|Homo sapiens protein ( Human Sec7p-lik...    31   1.8  
L26584-1|AAA58417.1| 1275|Homo sapiens CDC25 protein.                  31   1.8  
BC150285-1|AAI50286.1| 2058|Homo sapiens myosin X protein.             31   1.8  
BC065213-1|AAH65213.1|  747|Homo sapiens oxysterol binding prote...    31   1.8  
BC047918-1|AAH47918.1|  246|Homo sapiens ARHGAP24 protein protein.     31   1.8  
BC040275-1|AAH40275.1| 1181|Homo sapiens RASGRF1 protein protein.      31   1.8  
BC004361-1|AAH04361.1|  400|Homo sapiens pleckstrin homology, Se...    31   1.8  
AK130576-1|BAC85384.1|  239|Homo sapiens protein ( Homo sapiens ...    31   1.8  
AK091196-1|BAC03606.1|  748|Homo sapiens protein ( Homo sapiens ...    31   1.8  
AK074717-1|BAC11158.1|  984|Homo sapiens protein ( Homo sapiens ...    31   1.8  
AF392454-1|AAL40667.1|  747|Homo sapiens oxysterol-binding prote...    31   1.8  
AF392446-1|AAL40659.1|  842|Homo sapiens oxysterol-binding prote...    31   1.8  
AF346292-1|AAK31141.1|  315|Homo sapiens OSBP related protein 11...    31   1.8  
AF247457-1|AAF68025.2| 2058|Homo sapiens myosin X protein.             31   1.8  
AF234532-1|AAF37875.1| 2058|Homo sapiens myosin X protein.             31   1.8  
AF132021-1|AAF36524.1| 1540|Homo sapiens myosin X protein.             31   1.8  
AB018342-1|BAA34519.2| 2111|Homo sapiens KIAA0799 protein protein.     31   1.8  
BC033758-1|AAH33758.1|  380|Homo sapiens centaurin, alpha 2 prot...    30   2.4  
BT006900-1|AAP35546.1|  720|Homo sapiens connector enhancer of K...    30   3.1  
BC126112-1|AAI26113.1| 1237|Homo sapiens Ras protein-specific gu...    30   3.1  
BC118914-1|AAI18915.1|  915|Homo sapiens oxysterol binding prote...    30   3.1  
BC012797-1|AAH12797.1|  720|Homo sapiens CNKSR1 protein protein.       30   3.1  
BC011604-1|AAH11604.1|  720|Homo sapiens CNKSR1 protein protein.       30   3.1  
AL391650-10|CAI17138.1|  720|Homo sapiens connector enhancer of ...    30   3.1  
AL391650-9|CAI17139.1|  713|Homo sapiens connector enhancer of k...    30   3.1  
AL355877-5|CAH71543.1|  720|Homo sapiens connector enhancer of k...    30   3.1  
AL355877-4|CAH71542.1|  713|Homo sapiens connector enhancer of k...    30   3.1  
AL079299-1|CAI14632.1|  917|Homo sapiens oxysterol binding prote...    30   3.1  
AL022336-1|CAI22805.1|  917|Homo sapiens oxysterol binding prote...    30   3.1  
AK222904-1|BAD96624.1|  713|Homo sapiens connector enhancer of k...    30   3.1  
AK222817-1|BAD96537.1|  713|Homo sapiens connector enhancer of k...    30   3.1  
AF323731-1|AAG53406.1|  916|Homo sapiens OSBP-related protein 4 ...    30   3.1  
AF288742-1|AAK56865.1|  878|Homo sapiens oxysterol binding prote...    30   3.1  
AF288741-1|AAK56864.1|  878|Homo sapiens oxysterol binding prote...    30   3.1  
AF181250-1|AAD55268.1| 1237|Homo sapiens Ras guanine nucleotide ...    30   3.1  
AF100153-1|AAC80558.1|  713|Homo sapiens connector enhancer of K...    30   3.1  
AF023130-1|AAB80953.1| 1237|Homo sapiens Ras-GRF2 protein.             30   3.1  
AB209335-1|BAD92572.1|  456|Homo sapiens Connector enhancer of k...    30   3.1  
AB051451-1|BAB33334.2|  920|Homo sapiens KIAA1664 protein protein.     30   3.1  
DQ907253-1|ABI93267.1|  393|Homo sapiens WDR13 protein.                29   4.1  
BC125069-1|AAI25070.1|  417|Homo sapiens zinc finger protein 114...    29   4.1  
BC065482-1|AAH65482.1|  842|Homo sapiens oxysterol binding prote...    29   4.1  
BC038713-1|AAH38713.1|  400|Homo sapiens pleckstrin homology, Se...    29   4.1  
BC028010-1|AAH28010.1|  357|Homo sapiens OSBPL7 protein protein.       29   4.1  
BC000102-1|AAH00102.1|  598|Homo sapiens COL4A3BP protein protein.     29   4.1  
AY453386-1|AAR26718.1|  624|Homo sapiens lipid-transfer protein ...    29   4.1  
AY453385-1|AAR26717.1|  598|Homo sapiens lipid-transfer protein ...    29   4.1  
AK091851-1|BAC03762.1|  598|Homo sapiens protein ( Homo sapiens ...    29   4.1  
AK075062-1|BAC11378.1|  417|Homo sapiens protein ( Homo sapiens ...    29   4.1  
AK000267-1|BAA91043.1|  564|Homo sapiens protein ( Homo sapiens ...    29   4.1  
AF323729-1|AAG53410.1|  842|Homo sapiens OSBP-related protein 7 ...    29   4.1  
AF232930-1|AAG42046.1|  598|Homo sapiens Goodpasture antigen-bin...    29   4.1  
AF136450-1|AAD30288.1|  624|Homo sapiens goodpasture antigen-bin...    29   4.1  
M95936-1|AAA58364.1|  481|Homo sapiens protein serine/threonine ...    29   5.5  
M77198-1|AAA36585.1|  520|Homo sapiens rac protein kinase-beta p...    29   5.5  
DQ907254-1|ABI93268.1|  363|Homo sapiens WDR13 protein.                29   5.5  
DQ907252-1|ABI93266.1|  485|Homo sapiens WDR13 protein.                29   5.5  
BC131711-1|AAI31712.1|  676|Homo sapiens GRB2-associated binding...    29   5.5  
BC120995-1|AAI20996.1|  438|Homo sapiens AKT2 protein protein.         29   5.5  
BC120994-1|AAI20995.1|  481|Homo sapiens v-akt murine thymoma vi...    29   5.5  
BC080579-1|AAH80579.1|  485|Homo sapiens WD repeat domain 13 pro...    29   5.5  
BC067094-1|AAH67094.1|  535|Homo sapiens WDR13 protein protein.        29   5.5  
BC032709-1|AAH32709.1|  344|Homo sapiens AKT2 protein protein.         29   5.5  
BC002507-1|AAH02507.2|  340|Homo sapiens WDR13 protein protein.        29   5.5  
AK000570-1|BAA91261.1|  198|Homo sapiens protein ( Homo sapiens ...    29   5.5  
AF329819-1|AAG47845.3|  485|Homo sapiens WDR13 protein protein.        29   5.5  
AF149817-1|AAK13247.1|  485|Homo sapiens WDR13 protein protein.        29   5.5  
AB018413-1|BAA76737.1|  676|Homo sapiens Gab2 protein.                 29   5.5  
X12883-1|CAA31377.1|  424|Homo sapiens cytokeratin 18 (424 AA) p...    29   7.2  
X12881-1|CAA31375.1|  430|Homo sapiens cytokeratin 18 protein.         29   7.2  
M63167-1|AAA36539.1|  480|Homo sapiens rac protein kinase-alpha ...    29   7.2  
BT019412-1|AAV38219.1|  430|Homo sapiens keratin 18 protein.           29   7.2  
BC125226-1|AAI25227.1|  639|Homo sapiens FGD6 protein protein.         29   7.2  
BC125225-1|AAI25226.1|  639|Homo sapiens FGD6 protein protein.         29   7.2  
BC084538-1|AAH84538.1|  480|Homo sapiens v-akt murine thymoma vi...    29   7.2  
BC072017-1|AAH72017.1|  430|Homo sapiens keratin 18 protein.           29   7.2  
BC020982-1|AAH20982.1|  430|Homo sapiens keratin 18 protein.           29   7.2  
BC008636-1|AAH08636.1|  430|Homo sapiens keratin 18 protein.           29   7.2  
BC004253-1|AAH04253.1|  430|Homo sapiens keratin 18 protein.           29   7.2  
BC000698-1|AAH00698.1|  430|Homo sapiens keratin 18 protein.           29   7.2  
BC000479-1|AAH00479.1|  480|Homo sapiens v-akt murine thymoma vi...    29   7.2  
BC000180-1|AAH00180.1|  430|Homo sapiens keratin 18 protein.           29   7.2  
AY762101-1|AAX07828.1|  430|Homo sapiens cell proliferation-indu...    29   7.2  
AK223093-1|BAD96813.1|  430|Homo sapiens keratin 18 variant prot...    29   7.2  
AK128492-1|BAC87464.1| 1053|Homo sapiens protein ( Homo sapiens ...    29   7.2  
AK124904-1|BAC85990.1| 1430|Homo sapiens protein ( Homo sapiens ...    29   7.2  
AK002045-1|BAA92052.1|  432|Homo sapiens protein ( Homo sapiens ...    29   7.2  
AF283830-1|AAL55732.1|  480|Homo sapiens AKT1 protein.                 29   7.2  
AF179904-1|AAA59461.1|  430|Homo sapiens keratin 18 protein.           29   7.2  
AB036936-1|BAB58977.1|   45|Homo sapiens Thr/Ser kinase protein.       29   7.2  
BC105987-1|AAI05988.1|  662|Homo sapiens M-RIP protein protein.        28   9.5  
BC075847-1|AAH75847.1|  832|Homo sapiens M-RIP protein protein.        28   9.5  
BC009982-1|AAH09982.2|  842|Homo sapiens M-RIP protein protein.        28   9.5  
AY296247-1|AAQ63176.1| 1024|Homo sapiens myosin phosphatase-Rho ...    28   9.5  
AL834513-1|CAD39169.1|  987|Homo sapiens hypothetical protein pr...    28   9.5  
AL592114-6|CAH71228.1| 1048|Homo sapiens pleckstrin homology dom...    28   9.5  
AK092287-1|BAC03851.1|  586|Homo sapiens protein ( Homo sapiens ...    28   9.5  
AB189741-1|BAD89507.1| 1036|Homo sapiens Rho interacting protein...    28   9.5  
AB098507-1|BAC78198.1| 1037|Homo sapiens Rho-interacting protein...    28   9.5  
AB023186-1|BAA76813.2| 1091|Homo sapiens KIAA0969 protein protein.     28   9.5  

>BX538184-1|CAD98056.1|  215|Homo sapiens hypothetical protein
           protein.
          Length = 215

 Score =  127 bits (306), Expect = 1e-29
 Identities = 57/82 (69%), Positives = 64/82 (78%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           G LYKRGALLKGWK RWFVLD  KHQLRYYD+ ED+ CKG IDLAEV  V  A P+ G P
Sbjct: 114 GTLYKRGALLKGWKPRWFVLDVTKHQLRYYDSGEDTSCKGHIDLAEVEMVIPAGPSMGAP 173

Query: 73  KKCDDRSFFDLRTSRRTYNFCA 8
           K   D++FFDL+TS+R YNFCA
Sbjct: 174 KHTSDKAFFDLKTSKRVYNFCA 195


>BC101466-1|AAI01467.1| 1849|Homo sapiens SET binding factor 2
            protein.
          Length = 1849

 Score =  127 bits (306), Expect = 1e-29
 Identities = 57/82 (69%), Positives = 64/82 (78%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
            G LYKRGALLKGWK RWFVLD  KHQLRYYD+ ED+ CKG IDLAEV  V  A P+ G P
Sbjct: 1748 GTLYKRGALLKGWKPRWFVLDVTKHQLRYYDSGEDTSCKGHIDLAEVEMVIPAGPSMGAP 1807

Query: 73   KKCDDRSFFDLRTSRRTYNFCA 8
            K   D++FFDL+TS+R YNFCA
Sbjct: 1808 KHTSDKAFFDLKTSKRVYNFCA 1829


>BC063656-1|AAH63656.1|  230|Homo sapiens SBF2 protein protein.
          Length = 230

 Score =  127 bits (306), Expect = 1e-29
 Identities = 57/82 (69%), Positives = 64/82 (78%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           G LYKRGALLKGWK RWFVLD  KHQLRYYD+ ED+ CKG IDLAEV  V  A P+ G P
Sbjct: 129 GTLYKRGALLKGWKPRWFVLDVTKHQLRYYDSGEDTSCKGHIDLAEVEMVIPAGPSMGAP 188

Query: 73  KKCDDRSFFDLRTSRRTYNFCA 8
           K   D++FFDL+TS+R YNFCA
Sbjct: 189 KHTSDKAFFDLKTSKRVYNFCA 210


>BC053867-1|AAH53867.1|  254|Homo sapiens SBF2 protein protein.
          Length = 254

 Score =  127 bits (306), Expect = 1e-29
 Identities = 57/82 (69%), Positives = 64/82 (78%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           G LYKRGALLKGWK RWFVLD  KHQLRYYD+ ED+ CKG IDLAEV  V  A P+ G P
Sbjct: 153 GTLYKRGALLKGWKPRWFVLDVTKHQLRYYDSGEDTSCKGHIDLAEVEMVIPAGPSMGAP 212

Query: 73  KKCDDRSFFDLRTSRRTYNFCA 8
           K   D++FFDL+TS+R YNFCA
Sbjct: 213 KHTSDKAFFDLKTSKRVYNFCA 234


>BC043389-1|AAH43389.1|  243|Homo sapiens SBF2 protein protein.
          Length = 243

 Score =  127 bits (306), Expect = 1e-29
 Identities = 57/82 (69%), Positives = 64/82 (78%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           G LYKRGALLKGWK RWFVLD  KHQLRYYD+ ED+ CKG IDLAEV  V  A P+ G P
Sbjct: 142 GTLYKRGALLKGWKPRWFVLDVTKHQLRYYDSGEDTSCKGHIDLAEVEMVIPAGPSMGAP 201

Query: 73  KKCDDRSFFDLRTSRRTYNFCA 8
           K   D++FFDL+TS+R YNFCA
Sbjct: 202 KHTSDKAFFDLKTSKRVYNFCA 223


>AY234241-1|AAO62733.1| 1849|Homo sapiens SET binding factor 2
            protein.
          Length = 1849

 Score =  127 bits (306), Expect = 1e-29
 Identities = 57/82 (69%), Positives = 64/82 (78%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
            G LYKRGALLKGWK RWFVLD  KHQLRYYD+ ED+ CKG IDLAEV  V  A P+ G P
Sbjct: 1748 GTLYKRGALLKGWKPRWFVLDVTKHQLRYYDSGEDTSCKGHIDLAEVEMVIPAGPSMGAP 1807

Query: 73   KKCDDRSFFDLRTSRRTYNFCA 8
            K   D++FFDL+TS+R YNFCA
Sbjct: 1808 KHTSDKAFFDLKTSKRVYNFCA 1829


>BC011143-1|AAH11143.1|  100|Homo sapiens SBF2 protein protein.
          Length = 100

 Score =  125 bits (302), Expect = 5e-29
 Identities = 56/80 (70%), Positives = 63/80 (78%)
 Frame = -3

Query: 247 LYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPPKK 68
           LYKRGALLKGWK RWFVLD  KHQLRYYD+ ED+ CKG IDLAEV  V  A P+ G PK 
Sbjct: 1   LYKRGALLKGWKPRWFVLDVTKHQLRYYDSGEDTSCKGHIDLAEVEMVIPAGPSMGAPKH 60

Query: 67  CDDRSFFDLRTSRRTYNFCA 8
             D++FFDL+TS+R YNFCA
Sbjct: 61  TSDKAFFDLKTSKRVYNFCA 80


>U93181-1|AAC39675.1| 1697|Homo sapiens nuclear dual-specificity
            phosphatase protein.
          Length = 1697

 Score =  121 bits (291), Expect = 1e-27
 Identities = 52/82 (63%), Positives = 61/82 (74%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
            G LYK+GA +K WK RWFVLD  KHQLRYYD   D+ CKG IDLAEV AV   TP  G P
Sbjct: 1533 GTLYKKGAFMKPWKARWFVLDKTKHQLRYYDHRVDTECKGVIDLAEVEAVAPGTPTMGAP 1592

Query: 73   KKCDDRSFFDLRTSRRTYNFCA 8
            K  D+++FFD++T+RR YNFCA
Sbjct: 1593 KTVDEKAFFDVKTTRRVYNFCA 1614


>BC087612-1|AAH87612.1| 1893|Homo sapiens SBF1 protein protein.
          Length = 1893

 Score =  121 bits (291), Expect = 1e-27
 Identities = 52/82 (63%), Positives = 61/82 (74%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
            G LYK+GA +K WK RWFVLD  KHQLRYYD   D+ CKG IDLAEV AV   TP  G P
Sbjct: 1792 GTLYKKGAFMKPWKARWFVLDKTKHQLRYYDHRVDTECKGVIDLAEVEAVAPGTPTMGAP 1851

Query: 73   KKCDDRSFFDLRTSRRTYNFCA 8
            K  D+++FFD++T+RR YNFCA
Sbjct: 1852 KTVDEKAFFDVKTTRRVYNFCA 1873


>BC046169-1|AAH46169.2|  400|Homo sapiens SBF1 protein protein.
          Length = 400

 Score =  121 bits (291), Expect = 1e-27
 Identities = 52/82 (63%), Positives = 61/82 (74%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           G LYK+GA +K WK RWFVLD  KHQLRYYD   D+ CKG IDLAEV AV   TP  G P
Sbjct: 299 GTLYKKGAFMKPWKARWFVLDKTKHQLRYYDHRVDTECKGVIDLAEVEAVAPGTPTMGAP 358

Query: 73  KKCDDRSFFDLRTSRRTYNFCA 8
           K  D+++FFD++T+RR YNFCA
Sbjct: 359 KTVDEKAFFDVKTTRRVYNFCA 380


>BC009268-1|AAH09268.2|  930|Homo sapiens SBF1 protein protein.
          Length = 930

 Score =  121 bits (291), Expect = 1e-27
 Identities = 52/82 (63%), Positives = 61/82 (74%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
            G LYK+GA +K WK RWFVLD  KHQLRYYD   D+ CKG IDLAEV AV   TP  G P
Sbjct: 829  GTLYKKGAFMKPWKARWFVLDKTKHQLRYYDHRVDTECKGVIDLAEVEAVAPGTPTMGAP 888

Query: 73   KKCDDRSFFDLRTSRRTYNFCA 8
            K  D+++FFD++T+RR YNFCA
Sbjct: 889  KTVDEKAFFDVKTTRRVYNFCA 910


>AL096767-11|CAO03462.1| 1893|Homo sapiens SET binding factor 1
            protein.
          Length = 1893

 Score =  121 bits (291), Expect = 1e-27
 Identities = 52/82 (63%), Positives = 61/82 (74%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
            G LYK+GA +K WK RWFVLD  KHQLRYYD   D+ CKG IDLAEV AV   TP  G P
Sbjct: 1792 GTLYKKGAFMKPWKARWFVLDKTKHQLRYYDHRVDTECKGVIDLAEVEAVAPGTPTMGAP 1851

Query: 73   KKCDDRSFFDLRTSRRTYNFCA 8
            K  D+++FFD++T+RR YNFCA
Sbjct: 1852 KTVDEKAFFDVKTTRRVYNFCA 1873


>AL096767-10|CAI42962.1| 1867|Homo sapiens SET binding factor 1
            protein.
          Length = 1867

 Score =  121 bits (291), Expect = 1e-27
 Identities = 52/82 (63%), Positives = 61/82 (74%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
            G LYK+GA +K WK RWFVLD  KHQLRYYD   D+ CKG IDLAEV AV   TP  G P
Sbjct: 1766 GTLYKKGAFMKPWKARWFVLDKTKHQLRYYDHRVDTECKGVIDLAEVEAVAPGTPTMGAP 1825

Query: 73   KKCDDRSFFDLRTSRRTYNFCA 8
            K  D+++FFD++T+RR YNFCA
Sbjct: 1826 KTVDEKAFFDVKTTRRVYNFCA 1847


>AL096767-9|CAO03461.1| 1630|Homo sapiens SET binding factor 1
            protein.
          Length = 1630

 Score =  121 bits (291), Expect = 1e-27
 Identities = 52/82 (63%), Positives = 61/82 (74%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
            G LYK+GA +K WK RWFVLD  KHQLRYYD   D+ CKG IDLAEV AV   TP  G P
Sbjct: 1529 GTLYKKGAFMKPWKARWFVLDKTKHQLRYYDHRVDTECKGVIDLAEVEAVAPGTPTMGAP 1588

Query: 73   KKCDDRSFFDLRTSRRTYNFCA 8
            K  D+++FFD++T+RR YNFCA
Sbjct: 1589 KTVDEKAFFDVKTTRRVYNFCA 1610


>AL096767-8|CAO03460.1|  414|Homo sapiens SET binding factor 1
           protein.
          Length = 414

 Score =  121 bits (291), Expect = 1e-27
 Identities = 52/82 (63%), Positives = 61/82 (74%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           G LYK+GA +K WK RWFVLD  KHQLRYYD   D+ CKG IDLAEV AV   TP  G P
Sbjct: 313 GTLYKKGAFMKPWKARWFVLDKTKHQLRYYDHRVDTECKGVIDLAEVEAVAPGTPTMGAP 372

Query: 73  KKCDDRSFFDLRTSRRTYNFCA 8
           K  D+++FFD++T+RR YNFCA
Sbjct: 373 KTVDEKAFFDVKTTRRVYNFCA 394


>BC056915-1|AAH56915.1|  414|Homo sapiens SBF1 protein protein.
          Length = 414

 Score =  119 bits (287), Expect = 3e-27
 Identities = 51/82 (62%), Positives = 60/82 (73%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           G LYK+GA +K WK RWFVLD  KHQLRYYD   D+ CKG IDLAEV  V   TP  G P
Sbjct: 313 GTLYKKGAFMKPWKARWFVLDKTKHQLRYYDHRVDTECKGVIDLAEVEVVAPGTPTMGAP 372

Query: 73  KKCDDRSFFDLRTSRRTYNFCA 8
           K  D+++FFD++T+RR YNFCA
Sbjct: 373 KTVDEKAFFDVKTTRRVYNFCA 394


>BC013031-1|AAH13031.2|  691|Homo sapiens PHLDB1 protein protein.
          Length = 691

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 20/43 (46%), Positives = 26/43 (60%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
           RG+L K G  +K WK+RWFV D +K  L YY    ++  KG I
Sbjct: 585 RGYLVKMGGKIKSWKKRWFVFDRLKRTLSYYVDKHETKLKGVI 627


>AK125783-1|BAC86289.1|  731|Homo sapiens protein ( Homo sapiens
           cDNA FLJ43795 fis, clone TESTI4000079. ).
          Length = 731

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 20/43 (46%), Positives = 26/43 (60%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
           RG+L K G  +K WK+RWFV D +K  L YY    ++  KG I
Sbjct: 625 RGYLVKMGGKIKSWKKRWFVFDRLKRTLSYYVDKHETKLKGVI 667


>AK074918-1|BAC11292.1|  613|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90437 fis, clone NT2RP3000838, weakly similar to
           TRICHOHYALIN. ).
          Length = 613

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 20/43 (46%), Positives = 26/43 (60%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
           RG+L K G  +K WK+RWFV D +K  L YY    ++  KG I
Sbjct: 507 RGYLVKMGGKIKSWKKRWFVFDRLKRTLSYYVDKHETKLKGVI 549


>AK074070-1|BAB84896.1| 1326|Homo sapiens FLJ00141 protein protein.
          Length = 1326

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 20/43 (46%), Positives = 26/43 (60%)
 Frame = -3

Query: 256  RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
            RG+L K G  +K WK+RWFV D +K  L YY    ++  KG I
Sbjct: 1220 RGYLVKMGGKIKSWKKRWFVFDRLKRTLSYYVDKHETKLKGVI 1262


>AK027510-1|BAB55164.1|  402|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14604 fis, clone NT2RP1000363, moderately
           similar to R.norvegicus LL5 mRNA. ).
          Length = 402

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 20/43 (46%), Positives = 26/43 (60%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
           RG+L K G  +K WK+RWFV D +K  L YY    ++  KG I
Sbjct: 296 RGYLVKMGGKIKSWKKRWFVFDRLKRTLSYYVDKHETKLKGVI 338


>AB177859-1|BAD66837.1| 1125|Homo sapiens KIAA0638 splice variant 2
            protein.
          Length = 1125

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 20/43 (46%), Positives = 26/43 (60%)
 Frame = -3

Query: 256  RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
            RG+L K G  +K WK+RWFV D +K  L YY    ++  KG I
Sbjct: 1019 RGYLVKMGGKIKSWKKRWFVFDRLKRTLSYYVDKHETKLKGVI 1061


>AB094090-1|BAC76044.1| 1377|Homo sapiens DLNB07 protein.
          Length = 1377

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 20/43 (46%), Positives = 26/43 (60%)
 Frame = -3

Query: 256  RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
            RG+L K G  +K WK+RWFV D +K  L YY    ++  KG I
Sbjct: 1260 RGYLVKMGGKIKSWKKRWFVFDRLKRTLSYYVDKHETKLKGVI 1302


>AB014538-1|BAA31613.2| 1384|Homo sapiens KIAA0638 protein protein.
          Length = 1384

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 20/43 (46%), Positives = 26/43 (60%)
 Frame = -3

Query: 256  RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
            RG+L K G  +K WK+RWFV D +K  L YY    ++  KG I
Sbjct: 1267 RGYLVKMGGKIKSWKKRWFVFDRLKRTLSYYVDKHETKLKGVI 1309


>BC150210-1|AAI50211.1| 1253|Homo sapiens PHLDB2 protein protein.
          Length = 1253

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 20/47 (42%), Positives = 25/47 (53%)
 Frame = -3

Query: 268  EQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
            E+  RG L K G  +K WK+RWFV D  K    YY    ++  KG I
Sbjct: 1143 EKTCRGFLIKMGGKIKTWKKRWFVFDRNKRTFSYYADKHETKLKGVI 1189


>BC142678-1|AAI42679.1| 1253|Homo sapiens PHLDB2 protein protein.
          Length = 1253

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 20/47 (42%), Positives = 25/47 (53%)
 Frame = -3

Query: 268  EQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
            E+  RG L K G  +K WK+RWFV D  K    YY    ++  KG I
Sbjct: 1143 EKTCRGFLIKMGGKIKTWKKRWFVFDRNKRTFSYYADKHETKLKGVI 1189


>BC031000-1|AAH31000.1|  195|Homo sapiens PHLDB2 protein protein.
          Length = 195

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 20/47 (42%), Positives = 25/47 (53%)
 Frame = -3

Query: 268 EQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
           E+  RG L K G  +K WK+RWFV D  K    YY    ++  KG I
Sbjct: 85  EKTCRGFLIKMGGKIKTWKKRWFVFDRNKRTFSYYADKHETKLKGVI 131


>AJ496194-1|CAD42711.1| 1253|Homo sapiens LL5 beta protein protein.
          Length = 1253

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 20/47 (42%), Positives = 25/47 (53%)
 Frame = -3

Query: 268  EQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
            E+  RG L K G  +K WK+RWFV D  K    YY    ++  KG I
Sbjct: 1143 EKTCRGFLIKMGGKIKTWKKRWFVFDRNKRTFSYYADKHETKLKGVI 1189


>AF506820-1|AAM33634.1| 1210|Homo sapiens hypothetical protein
            protein.
          Length = 1210

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 20/47 (42%), Positives = 25/47 (53%)
 Frame = -3

Query: 268  EQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
            E+  RG L K G  +K WK+RWFV D  K    YY    ++  KG I
Sbjct: 1100 EKTCRGFLIKMGGKIKTWKKRWFVFDRNKRTFSYYADKHETKLKGVI 1146


>AB209903-1|BAD93140.1| 1259|Homo sapiens LL5 beta protein variant
            protein.
          Length = 1259

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 20/47 (42%), Positives = 25/47 (53%)
 Frame = -3

Query: 268  EQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
            E+  RG L K G  +K WK+RWFV D  K    YY    ++  KG I
Sbjct: 1149 EKTCRGFLIKMGGKIKTWKKRWFVFDRNKRTFSYYADKHETKLKGVI 1195


>EF560749-1|ABQ59059.1|  698|Homo sapiens ARHGAP22 protein protein.
          Length = 698

 Score = 45.2 bits (102), Expect = 8e-05
 Identities = 25/62 (40%), Positives = 35/62 (56%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           G L K+ +++K W+QRWFVL     QL YY   ++   +GFI L +   VT+  P P  P
Sbjct: 42  GWLKKQRSIMKNWQQRWFVLRG--DQLFYYKDKDEIKPQGFISL-QGTQVTELPPGPEDP 98

Query: 73  KK 68
            K
Sbjct: 99  GK 100


>BC126444-1|AAI26445.1|  714|Homo sapiens ARHGAP22 protein protein.
          Length = 714

 Score = 45.2 bits (102), Expect = 8e-05
 Identities = 25/62 (40%), Positives = 35/62 (56%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           G L K+ +++K W+QRWFVL     QL YY   ++   +GFI L +   VT+  P P  P
Sbjct: 42  GWLKKQRSIMKNWQQRWFVLRG--DQLFYYKDKDEIKPQGFISL-QGTQVTELPPGPEDP 98

Query: 73  KK 68
            K
Sbjct: 99  GK 100


>AY324801-1|AAP85632.1|  698|Homo sapiens Rho GTPase activating
           protein 2 protein.
          Length = 698

 Score = 45.2 bits (102), Expect = 8e-05
 Identities = 25/62 (40%), Positives = 35/62 (56%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           G L K+ +++K W+QRWFVL     QL YY   ++   +GFI L +   VT+  P P  P
Sbjct: 42  GWLKKQRSIMKNWQQRWFVLRG--DQLFYYKDKDEIKPQGFISL-QGTQVTELPPGPEDP 98

Query: 73  KK 68
            K
Sbjct: 99  GK 100


>BC007947-1|AAH07947.3|  178|Homo sapiens PHLDB3 protein protein.
          Length = 178

 Score = 41.9 bits (94), Expect = 7e-04
 Identities = 18/43 (41%), Positives = 24/43 (55%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
           RG L K G  +K W++RWF  D    +L YY   E++  KG I
Sbjct: 74  RGPLVKMGGRIKTWRKRWFCFDRQARRLAYYADKEETKLKGVI 116


>Z97832-4|CAI20190.1|  631|Homo sapiens differentially expressed in
           FDCP 6 homolog (mouse) protein.
          Length = 631

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 32/102 (31%), Positives = 47/102 (46%)
 Frame = -3

Query: 310 LSTIL*TVLVERRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGF 131
           LS  +  V  E  ++   +G+L+KRG L + W +RWF L      L Y+ + E    +G 
Sbjct: 202 LSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQLQ--PSCLCYFGSEECKEKRGI 259

Query: 130 IDLAEVIAVTQATPAPGPPKKCDDRSFFDLRTSRRTYNFCAS 5
           I L     V       G  K+C     F ++T+ RTY   AS
Sbjct: 260 IPLDAHCCVEVLPDRDG--KRC----MFCVKTANRTYEMSAS 295


>AJ276095-1|CAC08450.1|  631|Homo sapiens Def-6 protein protein.
          Length = 631

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 32/102 (31%), Positives = 47/102 (46%)
 Frame = -3

Query: 310 LSTIL*TVLVERRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGF 131
           LS  +  V  E  ++   +G+L+KRG L + W +RWF L      L Y+ + E    +G 
Sbjct: 202 LSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQLQ--PSCLCYFGSEECKEKRGI 259

Query: 130 IDLAEVIAVTQATPAPGPPKKCDDRSFFDLRTSRRTYNFCAS 5
           I L     V       G  K+C     F ++T+ RTY   AS
Sbjct: 260 IPLDAHCCVEVLPDRDG--KRC----MFCVKTANRTYEMSAS 295


>BC014510-1|AAH14510.1|  101|Homo sapiens PHLDB1 protein protein.
          Length = 101

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = -3

Query: 235 GALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
           G  +K WK+RWFV D +K  L YY    ++  KG I
Sbjct: 2   GGKIKSWKKRWFVFDRLKRTLSYYVDKHETKLKGVI 37


>AY241694-1|AAO91767.1|  631|Homo sapiens IRF4-binding protein
           protein.
          Length = 631

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 32/102 (31%), Positives = 47/102 (46%)
 Frame = -3

Query: 310 LSTIL*TVLVERRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGF 131
           LS  +  V  E  ++   +G+L+KRG L + W +RWF L      L Y+ + E    +G 
Sbjct: 202 LSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQLQ--PSCLCYFGSEECKEKRGI 259

Query: 130 IDLAEVIAVTQATPAPGPPKKCDDRSFFDLRTSRRTYNFCAS 5
           I L     V       G  K+C     F ++T+ RTY   AS
Sbjct: 260 IPLDAHCCVEVLPDRDG--KRC----MFCVKTATRTYEMSAS 295


>BC044567-1|AAH44567.1|  300|Homo sapiens pleckstrin homology domain
           containing, family A (phosphoinositide binding speci
           protein.
          Length = 300

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 21/40 (52%), Positives = 25/40 (62%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKG 134
           G LYK    L GW+ RWFVLD+    L YYD+ +D  CKG
Sbjct: 3   GVLYKWTNYLTGWQPRWFVLDN--GILSYYDSQDDV-CKG 39


>AF286162-1|AAG15199.1|  300|Homo sapiens Phosphoinositol
           4-phosphate Adaptor Protein-1 protein.
          Length = 300

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 21/40 (52%), Positives = 25/40 (62%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKG 134
           G LYK    L GW+ RWFVLD+    L YYD+ +D  CKG
Sbjct: 3   GVLYKWTNYLTGWQPRWFVLDN--GILSYYDSQDDV-CKG 39


>AC009948-4|AAX88884.1|  300|Homo sapiens unknown protein.
          Length = 300

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 21/40 (52%), Positives = 25/40 (62%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKG 134
           G LYK    L GW+ RWFVLD+    L YYD+ +D  CKG
Sbjct: 3   GVLYKWTNYLTGWQPRWFVLDN--GILSYYDSQDDV-CKG 39


>BC012924-1|AAH12924.1|  280|Homo sapiens DAPP1 protein protein.
          Length = 280

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 19/50 (38%), Positives = 28/50 (56%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAV 104
           G+L K+G L+K WK RWF L   +++L+Y+           +DL E  AV
Sbjct: 169 GYLTKQGGLVKTWKTRWFTLH--RNELKYFKDQMSPEPIRILDLTECSAV 216


>BC003168-1|AAH03168.2|  764|Homo sapiens oxysterol binding
           protein-like 10 protein.
          Length = 764

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 26/67 (38%), Positives = 36/67 (53%), Gaps = 2/67 (2%)
 Frame = -3

Query: 277 RRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCK--GFIDLAEVIAV 104
           RRRE    G L K   LL+GW+ R+FVLD     L+Y+   +  H K  G + L+  I V
Sbjct: 71  RRREPALEGVLSKYTNLLQGWQNRYFVLDFEAGILQYFVNEQSKHQKPRGVLSLSGAI-V 129

Query: 103 TQATPAP 83
           + +  AP
Sbjct: 130 SLSDEAP 136


>AF392451-1|AAL40664.1|  764|Homo sapiens oxysterol-binding
           protein-like protein OSBPL10 protein.
          Length = 764

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 26/67 (38%), Positives = 36/67 (53%), Gaps = 2/67 (2%)
 Frame = -3

Query: 277 RRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCK--GFIDLAEVIAV 104
           RRRE    G L K   LL+GW+ R+FVLD     L+Y+   +  H K  G + L+  I V
Sbjct: 71  RRREPALEGVLSKYTNLLQGWQNRYFVLDFEAGILQYFVNEQSKHQKPRGVLSLSGAI-V 129

Query: 103 TQATPAP 83
           + +  AP
Sbjct: 130 SLSDEAP 136


>AF346291-1|AAK31140.1|  251|Homo sapiens OSBP related protein 10
           protein.
          Length = 251

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 26/67 (38%), Positives = 36/67 (53%), Gaps = 2/67 (2%)
 Frame = -3

Query: 277 RRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCK--GFIDLAEVIAV 104
           RRRE    G L K   LL+GW+ R+FVLD     L+Y+   +  H K  G + L+  I V
Sbjct: 71  RRREPALEGVLSKYTNLLQGWQNRYFVLDFEAGILQYFVNEQSKHQKPRGVLSLSGAI-V 129

Query: 103 TQATPAP 83
           + +  AP
Sbjct: 130 SLSDEAP 136


>AF186022-1|AAF14578.1|  280|Homo sapiens B lymphocyte adapter
           protein BAM32 protein.
          Length = 280

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 19/50 (38%), Positives = 28/50 (56%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAV 104
           G+L K+G L+K WK RWF L   +++L+Y+           +DL E  AV
Sbjct: 169 GYLTKQGGLVKTWKTRWFTLH--RNELKYFKDQMSPEPIRILDLTECSAV 216


>AF178987-1|AAF44351.1|  280|Homo sapiens protein-tyrosine
           phosphatase D protein.
          Length = 280

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 19/50 (38%), Positives = 28/50 (56%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAV 104
           G+L K+G L+K WK RWF L   +++L+Y+           +DL E  AV
Sbjct: 169 GYLTKQGGLVKTWKTRWFTLH--RNELKYFKDQMSPEPIRILDLTECSAV 216


>AF163254-1|AAD49697.1|  280|Homo sapiens adaptor protein DAPP1
           protein.
          Length = 280

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 19/50 (38%), Positives = 28/50 (56%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAV 104
           G+L K+G L+K WK RWF L   +++L+Y+           +DL E  AV
Sbjct: 169 GYLTKQGGLVKTWKTRWFTLH--RNELKYFKDQMSPEPIRILDLTECSAV 216


>BC053990-1|AAH53990.1|  455|Homo sapiens PLEKHA8 protein protein.
          Length = 455

 Score = 38.3 bits (85), Expect = 0.009
 Identities = 22/47 (46%), Positives = 27/47 (57%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDS--HCKGFIDLA 119
           G LYK    L GW+ RWF+L      L YYD+ ED+   CKG I +A
Sbjct: 3   GVLYKWTNYLSGWQPRWFLL--CGGILSYYDSPEDAWKGCKGSIQMA 47


>BC002838-1|AAH02838.1|  440|Homo sapiens pleckstrin homology domain
           containing, family A (phosphoinositide binding speci
           protein.
          Length = 440

 Score = 38.3 bits (85), Expect = 0.009
 Identities = 22/47 (46%), Positives = 27/47 (57%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDS--HCKGFIDLA 119
           G LYK    L GW+ RWF+L      L YYD+ ED+   CKG I +A
Sbjct: 3   GVLYKWTNYLSGWQPRWFLL--CGGILSYYDSPEDAWKGCKGSIQMA 47


>AK023180-1|BAB14449.1|  372|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13118 fis, clone NT2RP3002663, highly similar to
           Homo sapiens putative glycolipid transfer protein mRNA.
           ).
          Length = 372

 Score = 38.3 bits (85), Expect = 0.009
 Identities = 22/47 (46%), Positives = 27/47 (57%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDS--HCKGFIDLA 119
           G LYK    L GW+ RWF+L      L YYD+ ED+   CKG I +A
Sbjct: 3   GVLYKWTNYLSGWQPRWFLL--CGGILSYYDSPEDAWKGCKGSIQMA 47


>AF380162-1|AAK55424.1|  507|Homo sapiens phosphoinositol
           4-phosphate adaptor protein-2 protein.
          Length = 507

 Score = 38.3 bits (85), Expect = 0.009
 Identities = 22/47 (46%), Positives = 27/47 (57%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDS--HCKGFIDLA 119
           G LYK    L GW+ RWF+L      L YYD+ ED+   CKG I +A
Sbjct: 3   GVLYKWTNYLSGWQPRWFLL--CGGILSYYDSPEDAWKGCKGSIQMA 47


>AF308300-1|AAG48267.1|  391|Homo sapiens serologically defined
           breast cancer antigen NY-BR-86 protein.
          Length = 391

 Score = 38.3 bits (85), Expect = 0.009
 Identities = 22/47 (46%), Positives = 27/47 (57%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDS--HCKGFIDLA 119
           G LYK    L GW+ RWF+L      L YYD+ ED+   CKG I +A
Sbjct: 29  GVLYKWTNYLSGWQPRWFLL--CGGILSYYDSPEDAWKGCKGSIQMA 73


>AY026527-1|AAK07684.1|  917|Homo sapiens prostate antigen PARIS-1
           protein.
          Length = 917

 Score = 37.9 bits (84), Expect = 0.012
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
 Frame = -3

Query: 253 GHLYKRGAL--LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPG 80
           G+L K G    ++GWK RWF  D  K QL Y    +D++    IDL+  +   +A    G
Sbjct: 50  GYLSKFGGKGPIRGWKSRWFFYDERKCQLYYSRTAQDANPLDSIDLSSAVFDCKADAEEG 109


>AL591502-2|CAI12580.1|  917|Homo sapiens TBC1 domain family, member
           2 protein.
          Length = 917

 Score = 37.9 bits (84), Expect = 0.012
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
 Frame = -3

Query: 253 GHLYKRGAL--LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPG 80
           G+L K G    ++GWK RWF  D  K QL Y    +D++    IDL+  +   +A    G
Sbjct: 50  GYLSKFGGKGPIRGWKSRWFFYDERKCQLYYSRTAQDANPLDSIDLSSAVFDCKADAEEG 109


>AL591502-1|CAI12579.1|  860|Homo sapiens TBC1 domain family, member
           2 protein.
          Length = 860

 Score = 37.9 bits (84), Expect = 0.012
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
 Frame = -3

Query: 253 GHLYKRGAL--LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPG 80
           G+L K G    ++GWK RWF  D  K QL Y    +D++    IDL+  +   +A    G
Sbjct: 50  GYLSKFGGKGPIRGWKSRWFFYDERKCQLYYSRTAQDANPLDSIDLSSAVFDCKADAEEG 109


>AL360081-4|CAH71887.1|  917|Homo sapiens TBC1 domain family, member
           2 protein.
          Length = 917

 Score = 37.9 bits (84), Expect = 0.012
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
 Frame = -3

Query: 253 GHLYKRGAL--LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPG 80
           G+L K G    ++GWK RWF  D  K QL Y    +D++    IDL+  +   +A    G
Sbjct: 50  GYLSKFGGKGPIRGWKSRWFFYDERKCQLYYSRTAQDANPLDSIDLSSAVFDCKADAEEG 109


>AL360081-3|CAH71886.1|  860|Homo sapiens TBC1 domain family, member
           2 protein.
          Length = 860

 Score = 37.9 bits (84), Expect = 0.012
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
 Frame = -3

Query: 253 GHLYKRGAL--LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPG 80
           G+L K G    ++GWK RWF  D  K QL Y    +D++    IDL+  +   +A    G
Sbjct: 50  GYLSKFGGKGPIRGWKSRWFFYDERKCQLYYSRTAQDANPLDSIDLSSAVFDCKADAEEG 109


>AL137073-3|CAI13885.1|  917|Homo sapiens TBC1 domain family, member
           2 protein.
          Length = 917

 Score = 37.9 bits (84), Expect = 0.012
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
 Frame = -3

Query: 253 GHLYKRGAL--LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPG 80
           G+L K G    ++GWK RWF  D  K QL Y    +D++    IDL+  +   +A    G
Sbjct: 50  GYLSKFGGKGPIRGWKSRWFFYDERKCQLYYSRTAQDANPLDSIDLSSAVFDCKADAEEG 109


>AL137073-2|CAI13884.1|  860|Homo sapiens TBC1 domain family, member
           2 protein.
          Length = 860

 Score = 37.9 bits (84), Expect = 0.012
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
 Frame = -3

Query: 253 GHLYKRGAL--LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPG 80
           G+L K G    ++GWK RWF  D  K QL Y    +D++    IDL+  +   +A    G
Sbjct: 50  GYLSKFGGKGPIRGWKSRWFFYDERKCQLYYSRTAQDANPLDSIDLSSAVFDCKADAEEG 109


>AB209721-1|BAD92958.1|  452|Homo sapiens Hypothetical protein
           pp8997 variant protein.
          Length = 452

 Score = 37.9 bits (84), Expect = 0.012
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
 Frame = -3

Query: 253 GHLYKRGAL--LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPG 80
           G+L K G    ++GWK RWF  D  K QL Y    +D++    IDL+  +   +A    G
Sbjct: 43  GYLSKFGGKGPIRGWKSRWFFYDERKCQLYYSRTAQDANPLDSIDLSSAVFDCKADAEEG 102


>BC146787-1|AAI46788.1| 1364|Homo sapiens pleckstrin homology domain
           containing, family H (with MyTH4 domain) member 1
           protein.
          Length = 1364

 Score = 35.9 bits (79), Expect = 0.048
 Identities = 16/35 (45%), Positives = 23/35 (65%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMED 149
           G+L K G+ +K WK+RWFVL   + Q+ YY +  D
Sbjct: 583 GYLLKMGSQVKTWKRRWFVLR--QGQIMYYKSPSD 615


>AK123305-1|BAC85577.1|  269|Homo sapiens protein ( Homo sapiens
           cDNA FLJ41311 fis, clone BRAMY2042760. ).
          Length = 269

 Score = 35.9 bits (79), Expect = 0.048
 Identities = 16/35 (45%), Positives = 23/35 (65%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMED 149
           G+L K G+ +K WK+RWFVL   + Q+ YY +  D
Sbjct: 98  GYLLKMGSQVKTWKRRWFVLR--QGQIMYYKSPSD 130


>AB033026-1|BAA86514.1| 1403|Homo sapiens KIAA1200 protein protein.
          Length = 1403

 Score = 35.9 bits (79), Expect = 0.048
 Identities = 16/35 (45%), Positives = 23/35 (65%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMED 149
           G+L K G+ +K WK+RWFVL   + Q+ YY +  D
Sbjct: 622 GYLLKMGSQVKTWKRRWFVLR--QGQIMYYKSPSD 654


>X07743-1|CAA30564.1|  350|Homo sapiens protein ( Human mRNA for
           pleckstrin (P47). ).
          Length = 350

 Score = 35.1 bits (77), Expect = 0.083
 Identities = 22/81 (27%), Positives = 37/81 (45%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGP 77
           +G L K+G   K WK R F+L      L YYD        G I L   +  +  + + G 
Sbjct: 248 QGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESNSNG- 306

Query: 76  PKKCDDRSFFDLRTSRRTYNF 14
            +K ++ + F++ T+   + F
Sbjct: 307 -RKSEEENLFEIITADEVHYF 326



 Score = 33.5 bits (73), Expect = 0.25
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G+L K+G++   WK  W VL  ++  + +Y    D+  KG I L
Sbjct: 9   GYLVKKGSVFNTWKPMWVVL--LEDGIEFYKKKSDNSPKGMIPL 50


>CR542079-1|CAG46876.1|  350|Homo sapiens PLEK protein.
          Length = 350

 Score = 35.1 bits (77), Expect = 0.083
 Identities = 22/81 (27%), Positives = 37/81 (45%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGP 77
           +G L K+G   K WK R F+L      L YYD        G I L   +  +  + + G 
Sbjct: 248 QGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAGDPLGAIHLRGCVVTSVESNSNG- 306

Query: 76  PKKCDDRSFFDLRTSRRTYNF 14
            +K ++ + F++ T+   + F
Sbjct: 307 -RKSEEENLFEIITADEVHYF 326



 Score = 33.5 bits (73), Expect = 0.25
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G+L K+G++   WK  W VL  ++  + +Y    D+  KG I L
Sbjct: 9   GYLVKKGSVFNTWKPMWVVL--LEDGIEFYKKKSDNSPKGMIPL 50


>CR542056-1|CAG46853.1|  350|Homo sapiens PLEK protein.
          Length = 350

 Score = 35.1 bits (77), Expect = 0.083
 Identities = 22/81 (27%), Positives = 37/81 (45%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGP 77
           +G L K+G   K WK R F+L      L YYD        G I L   +  +  + + G 
Sbjct: 248 QGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESNSNG- 306

Query: 76  PKKCDDRSFFDLRTSRRTYNF 14
            +K ++ + F++ T+   + F
Sbjct: 307 -RKSEEENLFEIITADEVHYF 326



 Score = 33.5 bits (73), Expect = 0.25
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G+L K+G++   WK  W VL  ++  + +Y    D+  KG I L
Sbjct: 9   GYLVKKGSVFNTWKPMWVVL--LEDGIEFYKKKSDNSPKGMIPL 50


>BC018549-1|AAH18549.1|  350|Homo sapiens pleckstrin protein.
          Length = 350

 Score = 35.1 bits (77), Expect = 0.083
 Identities = 22/81 (27%), Positives = 37/81 (45%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGP 77
           +G L K+G   K WK R F+L      L YYD        G I L   +  +  + + G 
Sbjct: 248 QGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESNSNG- 306

Query: 76  PKKCDDRSFFDLRTSRRTYNF 14
            +K ++ + F++ T+   + F
Sbjct: 307 -RKSEEENLFEIITADEVHYF 326



 Score = 33.5 bits (73), Expect = 0.25
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G+L K+G++   WK  W VL  ++  + +Y    D+  KG I L
Sbjct: 9   GYLVKKGSVFNTWKPMWVVL--LEDGIEFYKKKSDNSPKGMIPL 50


>AF125362-2|AAF37737.1|  389|Homo sapiens cytohesin 1 protein.
          Length = 389

 Score = 35.1 bits (77), Expect = 0.083
 Identities = 19/59 (32%), Positives = 31/59 (52%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGP 77
           G L K G  +K WK+RWF+L    + L Y++   D   +G I L E +++ +   +  P
Sbjct: 257 GWLLKLGGRVKTWKRRWFILTD--NCLYYFEYTTDKEPRGIIPL-ENLSIREVEDSKKP 312


>AC015969-2|AAX93121.1|  350|Homo sapiens unknown protein.
          Length = 350

 Score = 35.1 bits (77), Expect = 0.083
 Identities = 22/81 (27%), Positives = 37/81 (45%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGP 77
           +G L K+G   K WK R F+L      L YYD        G I L   +  +  + + G 
Sbjct: 248 QGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESNSNG- 306

Query: 76  PKKCDDRSFFDLRTSRRTYNF 14
            +K ++ + F++ T+   + F
Sbjct: 307 -RKSEEENLFEIITADEVHYF 326



 Score = 33.5 bits (73), Expect = 0.25
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G+L K+G++   WK  W VL  ++  + +Y    D+  KG I L
Sbjct: 9   GYLVKKGSVFNTWKPMWVVL--LEDGIEFYKKKSDNSPKGMIPL 50


>Z94160-1|CAI22121.1|  394|Homo sapiens pleckstrin homology, Sec7
           and coiled-coil domainsEB1) protein.
          Length = 394

 Score = 34.7 bits (76), Expect = 0.11
 Identities = 17/44 (38%), Positives = 24/44 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G L K G  +K WK+RWF+L    + L Y++   D   +G I L
Sbjct: 264 GWLLKLGGRVKTWKRRWFILTD--NCLYYFEFTTDKEPRGIIPL 305


>X99753-1|CAA68084.1|  399|Homo sapiens Arno protein (ARF exchange
           factor) protein.
          Length = 399

 Score = 34.7 bits (76), Expect = 0.11
 Identities = 17/44 (38%), Positives = 24/44 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G L K G  +K WK+RWF+L    + L Y++   D   +G I L
Sbjct: 264 GWLLKLGGRVKTWKRRWFILTD--NCLYYFEYTTDKEPRGIIPL 305


>CR456551-1|CAG30437.1|  394|Homo sapiens PSCD4 protein.
          Length = 394

 Score = 34.7 bits (76), Expect = 0.11
 Identities = 17/44 (38%), Positives = 24/44 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G L K G  +K WK+RWF+L    + L Y++   D   +G I L
Sbjct: 264 GWLLKLGGRVKTWKRRWFILTD--NCLYYFEFTTDKEPRGIIPL 305


>BC041161-1|AAH41161.1|  394|Homo sapiens pleckstrin homology, Sec7
           and coiled-coil domains 4 protein.
          Length = 394

 Score = 34.7 bits (76), Expect = 0.11
 Identities = 17/44 (38%), Positives = 24/44 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G L K G  +K WK+RWF+L    + L Y++   D   +G I L
Sbjct: 264 GWLLKLGGRVKTWKRRWFILTD--NCLYYFEFTTDKEPRGIIPL 305


>BC028717-1|AAH28717.1|  399|Homo sapiens pleckstrin homology, Sec7
           and coiled-coil domains 3 protein.
          Length = 399

 Score = 34.7 bits (76), Expect = 0.11
 Identities = 17/44 (38%), Positives = 24/44 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G L K G  +K WK+RWF+L    + L Y++   D   +G I L
Sbjct: 269 GWLLKLGGRVKTWKRRWFILTD--NCLYYFEYTTDKEPRGIIPL 310


>BC008191-1|AAH08191.1|  179|Homo sapiens PSCD3 protein protein.
          Length = 179

 Score = 34.7 bits (76), Expect = 0.11
 Identities = 17/44 (38%), Positives = 24/44 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G L K G  +K WK+RWF+L    + L Y++   D   +G I L
Sbjct: 49  GWLLKLGGRVKTWKRRWFILTD--NCLYYFEYTTDKEPRGIIPL 90


>AJ223957-1|CAA11686.1|  399|Homo sapiens ARNO3 protein.
          Length = 399

 Score = 34.7 bits (76), Expect = 0.11
 Identities = 17/44 (38%), Positives = 24/44 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G L K G  +K WK+RWF+L    + L Y++   D   +G I L
Sbjct: 269 GWLLKLGGRVKTWKRRWFILTD--NCLYYFEYTTDKEPRGIIPL 310


>AJ005197-1|CAA06434.1|  399|Homo sapiens GRP1 protein protein.
          Length = 399

 Score = 34.7 bits (76), Expect = 0.11
 Identities = 17/44 (38%), Positives = 24/44 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G L K G  +K WK+RWF+L    + L Y++   D   +G I L
Sbjct: 269 GWLLKLGGRVKTWKRRWFILTD--NCLYYFEYTTDKEPRGIIPL 310


>AF125349-1|AAF28896.1|  394|Homo sapiens guanine nucleotide
           exchange factor cytohesin-4p protein.
          Length = 394

 Score = 34.7 bits (76), Expect = 0.11
 Identities = 17/44 (38%), Positives = 24/44 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G L K G  +K WK+RWF+L    + L Y++   D   +G I L
Sbjct: 264 GWLLKLGGRVKTWKRRWFILTD--NCLYYFEFTTDKEPRGIIPL 305


>AF075458-1|AAF15389.1|  394|Homo sapiens cytohesin-4 protein.
          Length = 394

 Score = 34.7 bits (76), Expect = 0.11
 Identities = 17/44 (38%), Positives = 24/44 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G L K G  +K WK+RWF+L    + L Y++   D   +G I L
Sbjct: 264 GWLLKLGGRVKTWKRRWFILTD--NCLYYFEFTTDKEPRGIIPL 305


>AC004895-2|AAS00358.1|  179|Homo sapiens unknown protein.
          Length = 179

 Score = 34.7 bits (76), Expect = 0.11
 Identities = 17/44 (38%), Positives = 24/44 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G L K G  +K WK+RWF+L    + L Y++   D   +G I L
Sbjct: 49  GWLLKLGGRVKTWKRRWFILTD--NCLYYFEYTTDKEPRGIIPL 90


>AC004895-1|AAS00357.1|  387|Homo sapiens unknown protein.
          Length = 387

 Score = 34.7 bits (76), Expect = 0.11
 Identities = 17/44 (38%), Positives = 24/44 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G L K G  +K WK+RWF+L    + L Y++   D   +G I L
Sbjct: 257 GWLLKLGGRVKTWKRRWFILTD--NCLYYFEYTTDKEPRGIIPL 298


>AB028978-1|BAA83007.1|  868|Homo sapiens KIAA1055 protein protein.
          Length = 868

 Score = 34.7 bits (76), Expect = 0.11
 Identities = 13/37 (35%), Positives = 25/37 (67%)
 Frame = -3

Query: 226 LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAE 116
           L+G++ RWFV D+ +  L Y+ + +D+   G +D+A+
Sbjct: 4   LRGYRSRWFVFDARRCYLYYFKSPQDALPLGHLDIAD 40


>D29642-1|BAA06125.2|  666|Homo sapiens KIAA0053 protein.
          Length = 666

 Score = 33.9 bits (74), Expect = 0.19
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKG 134
           G L K+ +++K W+QR+FVL +   QL YY   ED+  +G
Sbjct: 72  GWLKKQRSIVKNWQQRYFVLRA--QQLYYYKDEEDTKPQG 109


>BC039591-1|AAH39591.1|  458|Homo sapiens ARHGAP25 protein protein.
          Length = 458

 Score = 33.9 bits (74), Expect = 0.19
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKG 134
           G L K+ +++K W+QR+FVL +   QL YY   ED+  +G
Sbjct: 44  GWLKKQRSIVKNWQQRYFVLRA--QQLYYYKDEEDTKPQG 81


>BC000616-1|AAH00616.1|  585|Homo sapiens SWAP-70 protein protein.
          Length = 585

 Score = 33.5 bits (73), Expect = 0.25
 Identities = 22/64 (34%), Positives = 31/64 (48%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGP 77
           +G++ K+G   K W +RWFVL    + + YY + +    KG I L E   V       G 
Sbjct: 214 QGYMMKKGHRRKNWTERWFVLK--PNIISYYVSEDLKDKKGDILLDENCCVESLPDKDG- 270

Query: 76  PKKC 65
            KKC
Sbjct: 271 -KKC 273


>AL831767-4|CAI14844.1|  736|Homo sapiens oxysterol binding
           protein-like 9 protein.
          Length = 736

 Score = 33.5 bits (73), Expect = 0.25
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAME 152
           G L K   ++KGW+ RWFVLD     L YY + +
Sbjct: 7   GPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKD 40


>AL831767-2|CAI14842.1|  752|Homo sapiens oxysterol binding
           protein-like 9 protein.
          Length = 752

 Score = 33.5 bits (73), Expect = 0.25
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAME 152
           G L K   ++KGW+ RWFVLD     L YY + +
Sbjct: 13  GPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKD 46


>AL831767-1|CAI14841.1|  741|Homo sapiens oxysterol binding
           protein-like 9 protein.
          Length = 741

 Score = 33.5 bits (73), Expect = 0.25
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAME 152
           G L K   ++KGW+ RWFVLD     L YY + +
Sbjct: 25  GPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKD 58


>AL772260-5|CAH71119.1|  736|Homo sapiens oxysterol binding
           protein-like 9 protein.
          Length = 736

 Score = 33.5 bits (73), Expect = 0.25
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAME 152
           G L K   ++KGW+ RWFVLD     L YY + +
Sbjct: 7   GPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKD 40


>AL772260-3|CAH71117.1|  752|Homo sapiens oxysterol binding
           protein-like 9 protein.
          Length = 752

 Score = 33.5 bits (73), Expect = 0.25
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAME 152
           G L K   ++KGW+ RWFVLD     L YY + +
Sbjct: 13  GPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKD 46


>AL772260-2|CAH71116.1|  741|Homo sapiens oxysterol binding
           protein-like 9 protein.
          Length = 741

 Score = 33.5 bits (73), Expect = 0.25
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAME 152
           G L K   ++KGW+ RWFVLD     L YY + +
Sbjct: 25  GPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKD 58


>AL050343-7|CAI22219.1|  736|Homo sapiens oxysterol binding
           protein-like 9 protein.
          Length = 736

 Score = 33.5 bits (73), Expect = 0.25
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAME 152
           G L K   ++KGW+ RWFVLD     L YY + +
Sbjct: 7   GPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKD 40


>AL050343-5|CAI22218.1|  752|Homo sapiens oxysterol binding
           protein-like 9 protein.
          Length = 752

 Score = 33.5 bits (73), Expect = 0.25
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAME 152
           G L K   ++KGW+ RWFVLD     L YY + +
Sbjct: 13  GPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKD 46


>AL050343-4|CAI22217.1|  741|Homo sapiens oxysterol binding
           protein-like 9 protein.
          Length = 741

 Score = 33.5 bits (73), Expect = 0.25
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAME 152
           G L K   ++KGW+ RWFVLD     L YY + +
Sbjct: 25  GPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKD 58


>AK027535-1|BAB55184.1|  723|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14629 fis, clone NT2RP2000448, weakly similar to
           KES1 PROTEIN. ).
          Length = 723

 Score = 33.5 bits (73), Expect = 0.25
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAME 152
           G L K   ++KGW+ RWFVLD     L YY + +
Sbjct: 7   GPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKD 40


>AF392445-1|AAL40658.1|  736|Homo sapiens oxysterol-binding
           protein-like protein OSBPL9 protein.
          Length = 736

 Score = 33.5 bits (73), Expect = 0.25
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAME 152
           G L K   ++KGW+ RWFVLD     L YY + +
Sbjct: 7   GPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKD 40


>AF210818-1|AAF24486.1|  585|Homo sapiens SWAP-70 protein.
          Length = 585

 Score = 33.5 bits (73), Expect = 0.25
 Identities = 22/64 (34%), Positives = 31/64 (48%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGP 77
           +G++ K+G   K W +RWFVL    + + YY + +    KG I L E   V       G 
Sbjct: 214 QGYMMKKGHRRKNWTERWFVLK--PNIISYYVSEDLKDKKGDILLDENCCVESLPDKDG- 270

Query: 76  PKKC 65
            KKC
Sbjct: 271 -KKC 273


>AF134894-1|AAF61403.1|  585|Homo sapiens SWAP-70 homolog protein.
          Length = 585

 Score = 33.5 bits (73), Expect = 0.25
 Identities = 22/64 (34%), Positives = 31/64 (48%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGP 77
           +G++ K+G   K W +RWFVL    + + YY + +    KG I L E   V       G 
Sbjct: 214 QGYMMKKGHRRKNWTERWFVLK--PNIISYYVSEDLKDKKGDILLDENCCVESLPDKDG- 270

Query: 76  PKKC 65
            KKC
Sbjct: 271 -KKC 273


>AB208967-1|BAD92204.1|  308|Homo sapiens PLEK protein variant
           protein.
          Length = 308

 Score = 33.5 bits (73), Expect = 0.25
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G+L K+G++   WK  W VL  ++  + +Y    D+  KG I L
Sbjct: 27  GYLVKKGSVFNTWKPMWVVL--LEDGIEFYKKKSDNSPKGMIPL 68



 Score = 29.1 bits (62), Expect = 5.5
 Identities = 14/32 (43%), Positives = 17/32 (53%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYD 161
           +G L K+G   K WK R F+L      L YYD
Sbjct: 266 QGCLLKQGHRRKNWKVRKFILREDPAYLHYYD 297


>AB014540-1|BAA31615.1|  603|Homo sapiens KIAA0640 protein protein.
          Length = 603

 Score = 33.5 bits (73), Expect = 0.25
 Identities = 22/64 (34%), Positives = 31/64 (48%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGP 77
           +G++ K+G   K W +RWFVL    + + YY + +    KG I L E   V       G 
Sbjct: 232 QGYMMKKGHRRKNWTERWFVLK--PNIISYYVSEDLKDKKGDILLDENCCVESLPDKDG- 288

Query: 76  PKKC 65
            KKC
Sbjct: 289 -KKC 291


>BC063310-1|AAH63310.1|  796|Homo sapiens PLEKHH2 protein protein.
          Length = 796

 Score = 33.1 bits (72), Expect = 0.34
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMED 149
           G+L K    +K WK+RWFVL     +L YY +  D
Sbjct: 708 GYLLKMSGKVKSWKRRWFVLKG--GELLYYKSPSD 740


>AY178997-1|AAO20108.1|  719|Homo sapiens oxysterol-binding
           protein-like protein 9 protein.
          Length = 719

 Score = 33.1 bits (72), Expect = 0.34
 Identities = 15/30 (50%), Positives = 18/30 (60%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYY 164
           G L K   ++KGW+ RWFVLD     L YY
Sbjct: 7   GPLSKWTNVMKGWQYRWFVLDYNAGLLSYY 36


>AL833400-1|CAD38637.1|  930|Homo sapiens hypothetical protein
           protein.
          Length = 930

 Score = 33.1 bits (72), Expect = 0.34
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMED 149
           G+L K    +K WK+RWFVL     +L YY +  D
Sbjct: 145 GYLLKMSGKVKSWKRRWFVLKG--GELLYYKSPSD 177


>AL831767-3|CAI14843.1|  719|Homo sapiens oxysterol binding
           protein-like 9 protein.
          Length = 719

 Score = 33.1 bits (72), Expect = 0.34
 Identities = 15/30 (50%), Positives = 18/30 (60%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYY 164
           G L K   ++KGW+ RWFVLD     L YY
Sbjct: 7   GPLSKWTNVMKGWQYRWFVLDYNAGLLSYY 36


>AL772260-4|CAH71118.1|  719|Homo sapiens oxysterol binding
           protein-like 9 protein.
          Length = 719

 Score = 33.1 bits (72), Expect = 0.34
 Identities = 15/30 (50%), Positives = 18/30 (60%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYY 164
           G L K   ++KGW+ RWFVLD     L YY
Sbjct: 7   GPLSKWTNVMKGWQYRWFVLDYNAGLLSYY 36


>AL050343-6|CAI22220.1|  719|Homo sapiens oxysterol binding
           protein-like 9 protein.
          Length = 719

 Score = 33.1 bits (72), Expect = 0.34
 Identities = 15/30 (50%), Positives = 18/30 (60%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYY 164
           G L K   ++KGW+ RWFVLD     L YY
Sbjct: 7   GPLSKWTNVMKGWQYRWFVLDYNAGLLSYY 36


>AB095948-1|BAC23124.1| 1449|Homo sapiens KIAA2028 protein protein.
          Length = 1449

 Score = 33.1 bits (72), Expect = 0.34
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMED 149
           G+L K    +K WK+RWFVL     +L YY +  D
Sbjct: 664 GYLLKMSGKVKSWKRRWFVLKG--GELLYYKSPSD 696


>BX664700-3|CAI23598.1|  383|Homo sapiens pleckstrin homology domain
           containing, family A (phosphoinositide binding speci
           protein.
          Length = 383

 Score = 32.7 bits (71), Expect = 0.44
 Identities = 17/52 (32%), Positives = 30/52 (57%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQ 98
           G+  K+GA++K WK+R+F LD  ++ + Y+ +  +      I L EV  V +
Sbjct: 196 GYCVKQGAVMKNWKRRYFQLD--ENTIGYFKSELEKEPLRVIPLKEVHKVQE 245


>BX664700-2|CAI23597.1|  404|Homo sapiens pleckstrin homology domain
           containing, family A (phosphoinositide binding speci
           protein.
          Length = 404

 Score = 32.7 bits (71), Expect = 0.44
 Identities = 17/52 (32%), Positives = 30/52 (57%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQ 98
           G+  K+GA++K WK+R+F LD  ++ + Y+ +  +      I L EV  V +
Sbjct: 196 GYCVKQGAVMKNWKRRYFQLD--ENTIGYFKSELEKEPLRVIPLKEVHKVQE 245


>BC042458-1|AAH42458.1|  404|Homo sapiens pleckstrin homology domain
           containing, family A (phosphoinositide binding speci
           protein.
          Length = 404

 Score = 32.7 bits (71), Expect = 0.44
 Identities = 17/52 (32%), Positives = 30/52 (57%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQ 98
           G+  K+GA++K WK+R+F LD  ++ + Y+ +  +      I L EV  V +
Sbjct: 196 GYCVKQGAVMKNWKRRYFQLD--ENTIGYFKSELEKEPLRVIPLKEVHKVQE 245


>BC001136-1|AAH01136.1|  404|Homo sapiens pleckstrin homology domain
           containing, family A (phosphoinositide binding speci
           protein.
          Length = 404

 Score = 32.7 bits (71), Expect = 0.44
 Identities = 17/52 (32%), Positives = 30/52 (57%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQ 98
           G+  K+GA++K WK+R+F LD  ++ + Y+ +  +      I L EV  V +
Sbjct: 196 GYCVKQGAVMKNWKRRYFQLD--ENTIGYFKSELEKEPLRVIPLKEVHKVQE 245


>AF286160-1|AAG15197.1|  404|Homo sapiens Tandem PH Domain
           Containing Protein-1 protein.
          Length = 404

 Score = 32.7 bits (71), Expect = 0.44
 Identities = 17/52 (32%), Positives = 30/52 (57%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQ 98
           G+  K+GA++K WK+R+F LD  ++ + Y+ +  +      I L EV  V +
Sbjct: 196 GYCVKQGAVMKNWKRRYFQLD--ENTIGYFKSELEKEPLRVIPLKEVHKVQE 245


>AC112700-1|AAY24006.1|   80|Homo sapiens unknown protein.
          Length = 80

 Score = 32.7 bits (71), Expect = 0.44
 Identities = 16/36 (44%), Positives = 24/36 (66%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDS 146
           G L K+ +++K W+QR+FVL +   QL YY   ED+
Sbjct: 44  GWLKKQRSIVKNWQQRYFVLRA--QQLYYYKDEEDT 77


>AB209407-1|BAD92644.1|  230|Homo sapiens pleckstrin homology domain
           containing, family A (phosphoinositide binding speci
           protein.
          Length = 230

 Score = 32.7 bits (71), Expect = 0.44
 Identities = 17/52 (32%), Positives = 30/52 (57%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQ 98
           G+  K+GA++K WK+R+F LD  ++ + Y+ +  +      I L EV  V +
Sbjct: 95  GYCVKQGAVMKNWKRRYFQLD--ENTIGYFKSELEKEPLRVIPLKEVHKVQE 144


>BC064601-1|AAH64601.1|  583|Homo sapiens PLEKHA4 protein protein.
          Length = 583

 Score = 32.3 bits (70), Expect = 0.59
 Identities = 19/39 (48%), Positives = 26/39 (66%), Gaps = 2/39 (5%)
 Frame = -3

Query: 256 RGHLYKRGAL-LKGWKQRWFVLDSIKHQLRYY-DAMEDS 146
           RG L+K+ +  L+ WK+RWFVL    H L YY D+ E+S
Sbjct: 58  RGWLHKQDSSGLRLWKRRWFVLSG--HCLFYYKDSREES 94


>BC024157-1|AAH24157.1|  779|Homo sapiens pleckstrin homology domain
           containing, family A (phosphoinositide binding speci
           protein.
          Length = 779

 Score = 32.3 bits (70), Expect = 0.59
 Identities = 19/39 (48%), Positives = 26/39 (66%), Gaps = 2/39 (5%)
 Frame = -3

Query: 256 RGHLYKRGAL-LKGWKQRWFVLDSIKHQLRYY-DAMEDS 146
           RG L+K+ +  L+ WK+RWFVL    H L YY D+ E+S
Sbjct: 58  RGWLHKQDSSGLRLWKRRWFVLSG--HCLFYYKDSREES 94


>AY007233-1|AAG01896.1|  779|Homo sapiens phosphoinositol
           3-phosphate binding protein-1 protein.
          Length = 779

 Score = 32.3 bits (70), Expect = 0.59
 Identities = 19/39 (48%), Positives = 26/39 (66%), Gaps = 2/39 (5%)
 Frame = -3

Query: 256 RGHLYKRGAL-LKGWKQRWFVLDSIKHQLRYY-DAMEDS 146
           RG L+K+ +  L+ WK+RWFVL    H L YY D+ E+S
Sbjct: 58  RGWLHKQDSSGLRLWKRRWFVLSG--HCLFYYKDSREES 94


>M86917-1|AAA59973.1|  807|Homo sapiens oxysterol-binding protein
           protein.
          Length = 807

 Score = 31.9 bits (69), Expect = 0.77
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSH--CKGFIDLA 119
           G L+K    +KG+++RWFVL +    L YY +  +    C+G I+LA
Sbjct: 93  GWLFKWTNYIKGYQRRWFVLSN--GLLSYYRSKAEMRHTCRGTINLA 137


>BC011581-1|AAH11581.1|  807|Homo sapiens oxysterol binding protein
           protein.
          Length = 807

 Score = 31.9 bits (69), Expect = 0.77
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSH--CKGFIDLA 119
           G L+K    +KG+++RWFVL +    L YY +  +    C+G I+LA
Sbjct: 93  GWLFKWTNYIKGYQRRWFVLSN--GLLSYYRSKAEMRHTCRGTINLA 137


>BC008056-1|AAH08056.2|  351|Homo sapiens PLEK2 protein protein.
          Length = 351

 Score = 31.9 bits (69), Expect = 0.77
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYY 164
           G L KRG ++  WK RWF+L   ++ L YY
Sbjct: 7   GFLVKRGHIVHNWKARWFILR--QNTLVYY 34



 Score = 31.1 bits (67), Expect = 1.4
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSH 143
           +G+L K+G   K WK R FVL      L YYD  ++ +
Sbjct: 249 QGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEEN 286


>BC001226-1|AAH01226.1|  353|Homo sapiens pleckstrin 2 protein.
          Length = 353

 Score = 31.9 bits (69), Expect = 0.77
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYY 164
           G L KRG ++  WK RWF+L   ++ L YY
Sbjct: 9   GFLVKRGHIVHNWKARWFILR--QNTLVYY 36



 Score = 31.1 bits (67), Expect = 1.4
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSH 143
           +G+L K+G   K WK R FVL      L YYD  ++ +
Sbjct: 251 QGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEEN 288


>AK002145-1|BAA92107.1|  201|Homo sapiens protein ( Homo sapiens
           cDNA FLJ11283 fis, clone PLACE1009524, moderately
           similar to ARF NUCLEOTIDE-BINDING SITE OPENER. ).
          Length = 201

 Score = 31.9 bits (69), Expect = 0.77
 Identities = 16/44 (36%), Positives = 23/44 (52%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G L K G  +K WK+ WF+L    + L Y++   D   +G I L
Sbjct: 71  GWLLKLGGRVKTWKRGWFILTD--NCLYYFEFTTDKEPRGIIPL 112


>AF286164-1|AAG15201.1|  304|Homo sapiens Tandem PH Domain
           Containing Protein-2 protein.
          Length = 304

 Score = 31.9 bits (69), Expect = 0.77
 Identities = 21/78 (26%), Positives = 36/78 (46%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           G+  K+G + K WK+R+F LD     + Y+   +D      I   +V+   +     G  
Sbjct: 203 GYCVKQGNVRKSWKRRFFALDDF--TICYFKCEQDREPLRTIFFKDVLKTHECLVKSGDL 260

Query: 73  KKCDDRSFFDLRTSRRTY 20
              D  + F++ TS RT+
Sbjct: 261 LMRD--NLFEIITSSRTF 276


>AF228603-1|AAF34791.1|  353|Homo sapiens pleckstrin 2 protein.
          Length = 353

 Score = 31.9 bits (69), Expect = 0.77
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYY 164
           G L KRG ++  WK RWF+L   ++ L YY
Sbjct: 9   GFLVKRGHIVHNWKARWFILR--QNTLVYY 36



 Score = 31.1 bits (67), Expect = 1.4
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSH 143
           +G+L K+G   K WK R FVL      L YYD  ++ +
Sbjct: 251 QGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEEN 288


>AF185705-1|AAG28373.1|  807|Homo sapiens oxysterol binding protein
           1 protein.
          Length = 807

 Score = 31.9 bits (69), Expect = 0.77
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSH--CKGFIDLA 119
           G L+K    +KG+++RWFVL +    L YY +  +    C+G I+LA
Sbjct: 93  GWLFKWTNYIKGYQRRWFVLSN--GLLSYYRSKAEMRHTCRGTINLA 137


>AF185696-1|AAG17011.1|  807|Homo sapiens oxysterol-binding protein
           1 protein.
          Length = 807

 Score = 31.9 bits (69), Expect = 0.77
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSH--CKGFIDLA 119
           G L+K    +KG+++RWFVL +    L YY +  +    C+G I+LA
Sbjct: 93  GWLFKWTNYIKGYQRRWFVLSN--GLLSYYRSKAEMRHTCRGTINLA 137


>D30758-1|BAA06418.2|  796|Homo sapiens KIAA0050 protein.
          Length = 796

 Score = 31.5 bits (68), Expect = 1.0
 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 3/34 (8%)
 Frame = -3

Query: 253 GHLYKRGA-LLKGWKQRWFVLDS--IKHQLRYYD 161
           GHL+KR +   K W +RWF + S  + +Q +Y D
Sbjct: 326 GHLFKRASNAFKTWSRRWFTIQSNQLVYQKKYKD 359


>BT009788-1|AAP88790.1|  740|Homo sapiens centaurin, beta 1 protein.
          Length = 740

 Score = 31.5 bits (68), Expect = 1.0
 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 3/34 (8%)
 Frame = -3

Query: 253 GHLYKRGA-LLKGWKQRWFVLDS--IKHQLRYYD 161
           GHL+KR +   K W +RWF + S  + +Q +Y D
Sbjct: 270 GHLFKRASNAFKTWSRRWFTIQSNQLVYQKKYKD 303


>BC127092-1|AAI27093.1| 1116|Homo sapiens pleckstrin homology domain
           containing, family A member 5 protein.
          Length = 1116

 Score = 31.5 bits (68), Expect = 1.0
 Identities = 27/83 (32%), Positives = 38/83 (45%), Gaps = 1/83 (1%)
 Frame = -3

Query: 256 RGHLYKRGAL-LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPG 80
           RG LYK+ +  +K WK+RWFVL  +   L YY   ++    G I L     +   T    
Sbjct: 173 RGWLYKQDSTGMKLWKKRWFVLSDL--CLFYYRDEKEEGILGSI-LLPSFQIALLTSEDH 229

Query: 79  PPKKCDDRSFFDLRTSRRTYNFC 11
             +K    +F     + RTY FC
Sbjct: 230 INRK---YAFKAAHPNMRTYYFC 249


>BC070174-1|AAH70174.1|  320|Homo sapiens PLEKHA5 protein protein.
          Length = 320

 Score = 31.5 bits (68), Expect = 1.0
 Identities = 27/83 (32%), Positives = 38/83 (45%), Gaps = 1/83 (1%)
 Frame = -3

Query: 256 RGHLYKRGAL-LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPG 80
           RG LYK+ +  +K WK+RWFVL  +   L YY   ++    G I L     +   T    
Sbjct: 173 RGWLYKQDSTGMKLWKKRWFVLSDL--CLFYYRDEKEEGILGSI-LLPSFQIALLTSEDH 229

Query: 79  PPKKCDDRSFFDLRTSRRTYNFC 11
             +K    +F     + RTY FC
Sbjct: 230 INRK---YAFKAAHPNMRTYYFC 249


>BC018543-1|AAH18543.1|  740|Homo sapiens centaurin, beta 1 protein.
          Length = 740

 Score = 31.5 bits (68), Expect = 1.0
 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 3/34 (8%)
 Frame = -3

Query: 253 GHLYKRGA-LLKGWKQRWFVLDS--IKHQLRYYD 161
           GHL+KR +   K W +RWF + S  + +Q +Y D
Sbjct: 270 GHLFKRASNAFKTWSRRWFTIQSNQLVYQKKYKD 303


>BC000969-1|AAH00969.1|  492|Homo sapiens PLEKHA5 protein protein.
          Length = 492

 Score = 31.5 bits (68), Expect = 1.0
 Identities = 27/83 (32%), Positives = 38/83 (45%), Gaps = 1/83 (1%)
 Frame = -3

Query: 256 RGHLYKRGAL-LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPG 80
           RG LYK+ +  +K WK+RWFVL  +   L YY   ++    G I L     +   T    
Sbjct: 15  RGWLYKQDSTGMKLWKKRWFVLSDL--CLFYYRDEKEEGILGSI-LLPSFQIALLTSEDH 71

Query: 79  PPKKCDDRSFFDLRTSRRTYNFC 11
             +K    +F     + RTY FC
Sbjct: 72  INRK---YAFKAAHPNMRTYYFC 91


>AF302150-1|AAG22817.1| 1116|Homo sapiens phosphoinositol
           3-phosphate-binding protein-2 protein.
          Length = 1116

 Score = 31.5 bits (68), Expect = 1.0
 Identities = 27/83 (32%), Positives = 38/83 (45%), Gaps = 1/83 (1%)
 Frame = -3

Query: 256 RGHLYKRGAL-LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPG 80
           RG LYK+ +  +K WK+RWFVL  +   L YY   ++    G I L     +   T    
Sbjct: 173 RGWLYKQDSTGMKLWKKRWFVLSDL--CLFYYRDEKEEGILGSI-LLPSFQIALLTSEDH 229

Query: 79  PPKKCDDRSFFDLRTSRRTYNFC 11
             +K    +F     + RTY FC
Sbjct: 230 INRK---YAFKAAHPNMRTYYFC 249


>AB051473-1|BAB21777.2| 1175|Homo sapiens KIAA1686 protein protein.
          Length = 1175

 Score = 31.5 bits (68), Expect = 1.0
 Identities = 27/83 (32%), Positives = 38/83 (45%), Gaps = 1/83 (1%)
 Frame = -3

Query: 256 RGHLYKRGAL-LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPG 80
           RG LYK+ +  +K WK+RWFVL  +   L YY   ++    G I L     +   T    
Sbjct: 174 RGWLYKQDSTGMKLWKKRWFVLSDL--CLFYYRDEKEEGILGSI-LLPSFQIALLTSEDH 230

Query: 79  PPKKCDDRSFFDLRTSRRTYNFC 11
             +K    +F     + RTY FC
Sbjct: 231 INRK---YAFKAAHPNMRTYYFC 250


>M85169-1|AAA36602.1|  398|Homo sapiens protein ( Human homologue of
           yeast sec7 mRNA, complete cds. ).
          Length = 398

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = -3

Query: 235 GALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGP 77
           G  +K WK+RWF+L    + L Y++   D   +G I L E +++ +   +  P
Sbjct: 272 GGRVKTWKRRWFILTD--NCLYYFEYTTDKEPRGIIPL-ENLSIREVEDSKKP 321


>M23612-1|AAA35865.1|  870|Homo sapiens GTPase-activating protein
           protein.
          Length = 870

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDA-MEDSHCKGFIDLA 119
           +G+L K+G   K WK  +F+L+    QL Y+++    +  KG IDL+
Sbjct: 301 KGYLLKKGKG-KRWKNLYFILEGSDAQLIYFESEKRATKPKGLIDLS 346


>M23379-1|AAA52517.1| 1047|Homo sapiens GTPase-activating protein
           protein.
          Length = 1047

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDA-MEDSHCKGFIDLA 119
           +G+L K+G   K WK  +F+L+    QL Y+++    +  KG IDL+
Sbjct: 478 KGYLLKKGKG-KRWKNLYFILEGSDAQLIYFESEKRATKPKGLIDLS 523


>BC050695-1|AAH50695.2|  222|Homo sapiens pleckstrin homology domain
           containing, family B (evectins) member 2 protein.
          Length = 222

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYD 161
           G L ++  +LK WK+ WF L S  H L YYD
Sbjct: 7   GWLLRQSTILKRWKKNWFDLWSDGH-LIYYD 36


>BC050452-1|AAH50452.1|  398|Homo sapiens pleckstrin homology, Sec7
           and coiled-coil domains 1(cytohesin 1) protein.
          Length = 398

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = -3

Query: 235 GALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGP 77
           G  +K WK+RWF+L    + L Y++   D   +G I L E +++ +   +  P
Sbjct: 272 GGRVKTWKRRWFILTD--NCLYYFEYTTDKEPRGIIPL-ENLSIREVEDSKKP 321


>BC038385-1|AAH38385.1|  398|Homo sapiens pleckstrin homology, Sec7
           and coiled-coil domains 1(cytohesin 1) protein.
          Length = 398

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = -3

Query: 235 GALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGP 77
           G  +K WK+RWF+L    + L Y++   D   +G I L E +++ +   +  P
Sbjct: 272 GGRVKTWKRRWFILTD--NCLYYFEYTTDKEPRGIIPL-ENLSIREVEDSKKP 321


>BC033015-1|AAH33015.1| 1047|Homo sapiens RAS p21 protein activator
           (GTPase activating protein) 1 protein.
          Length = 1047

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDA-MEDSHCKGFIDLA 119
           +G+L K+G   K WK  +F+L+    QL Y+++    +  KG IDL+
Sbjct: 478 KGYLLKKGKG-KRWKNLYFILEGSDAQLIYFESEKRATKPKGLIDLS 523


>BC013991-1|AAH13991.1|  222|Homo sapiens pleckstrin homology domain
           containing, family B (evectins) member 2 protein.
          Length = 222

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYD 161
           G L ++  +LK WK+ WF L S  H L YYD
Sbjct: 7   GWLLRQSTILKRWKKNWFDLWSDGH-LIYYD 36


>BC001428-1|AAH01428.1|  309|Homo sapiens pleckstrin homology domain
           containing, family B (evectins) member 2 protein.
          Length = 309

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYD 161
           G L ++  +LK WK+ WF L S  H L YYD
Sbjct: 7   GWLLRQSTILKRWKKNWFDLWSDGH-LIYYD 36


>AK223338-1|BAD97058.1|  221|Homo sapiens pleckstrin homology domain
           containing, family B (evectins) member 2 variant
           protein.
          Length = 221

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYD 161
           G L ++  +LK WK+ WF L S  H L YYD
Sbjct: 7   GWLLRQSTILKRWKKNWFDLWSDGH-LIYYD 36


>AK000790-1|BAA91379.1|  221|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20783 fis, clone COL03108. ).
          Length = 221

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYD 161
           G L ++  +LK WK+ WF L S  H L YYD
Sbjct: 7   GWLLRQSTILKRWKKNWFDLWSDGH-LIYYD 36


>AF125362-1|AAF37738.1|  390|Homo sapiens cytohesin 1 protein.
          Length = 390

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = -3

Query: 235 GALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGP 77
           G  +K WK+RWF+L    + L Y++   D   +G I L E +++ +   +  P
Sbjct: 264 GGRVKTWKRRWFILTD--NCLYYFEYTTDKEPRGIIPL-ENLSIREVEDSKKP 313


>AC009477-2|AAX93135.1|  222|Homo sapiens unknown protein.
          Length = 222

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYD 161
           G L ++  +LK WK+ WF L S  H L YYD
Sbjct: 7   GWLLRQSTILKRWKKNWFDLWSDGH-LIYYD 36


>AB209106-1|BAD92343.1|  871|Homo sapiens RAS p21 protein activator
           1 isoform 1 variant protein.
          Length = 871

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDA-MEDSHCKGFIDLA 119
           +G+L K+G   K WK  +F+L+    QL Y+++    +  KG IDL+
Sbjct: 511 KGYLLKKGKG-KRWKNLYFILEGSDAQLIYFESEKRATKPKGLIDLS 556


>AB011143-1|BAA25497.2|  683|Homo sapiens KIAA0571 protein protein.
          Length = 683

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 23/78 (29%), Positives = 35/78 (44%), Gaps = 6/78 (7%)
 Frame = -3

Query: 223 KGWKQRWFVLDSIKHQ-----LRYYDAMEDSHCKGFIDLAEVIAVTQATPA-PGPPKKCD 62
           K WK+RWF+L S +       L YY   ++ H K  + +  +    Q         K+  
Sbjct: 32  KAWKKRWFILRSGRMSGDPDVLEYY---KNDHSKKPLRIINLNFCEQVDAGLTFNKKELQ 88

Query: 61  DRSFFDLRTSRRTYNFCA 8
           D   FD++TS RT+   A
Sbjct: 89  DSFVFDIKTSERTFYLVA 106


>U70728-1|AAB09591.1|  400|Homo sapiens cytohesin-2 protein.
          Length = 400

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = -3

Query: 235 GALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G  +K WK+RWF+L    + L Y++   D   +G I L
Sbjct: 271 GGRVKTWKRRWFILTD--NCLYYFEYTTDKEPRGIIPL 306


>U59752-1|AAB17532.1|  266|Homo sapiens protein ( Human Sec7p-like
           protein mRNA, partial cds. ).
          Length = 266

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = -3

Query: 235 GALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G  +K WK+RWF+L    + L Y++   D   +G I L
Sbjct: 137 GGRVKTWKRRWFILTD--NCLYYFEYTTDKEPRGIIPL 172


>L26584-1|AAA58417.1| 1275|Homo sapiens CDC25 protein.
          Length = 1275

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 16/64 (25%), Positives = 31/64 (48%)
 Frame = -3

Query: 274 RREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQA 95
           R++   +G+L KR +    W+ +WF L  +++ L Y+++   S   G   L   +     
Sbjct: 20  RKDGTRKGYLSKRSSDNTKWQTKWFAL--LQNLLFYFESDSSSRPSGLYLLEGCVCDRAP 77

Query: 94  TPAP 83
           +P P
Sbjct: 78  SPKP 81


>BC150285-1|AAI50286.1| 2058|Homo sapiens myosin X protein.
          Length = 2058

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 5/56 (8%)
 Frame = -3

Query: 274  RREQNARGHLYKRGA-----LLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
            ++E   +G L+K+G        + WK+RWFVL   K  L Y++   +   KG +++
Sbjct: 1210 KQEALKQGWLHKKGGGSSTLSRRNWKKRWFVLRQSK--LMYFENDSEEKLKGTVEV 1263



 Score = 29.5 bits (63), Expect = 4.1
 Identities = 10/18 (55%), Positives = 13/18 (72%)
 Frame = -3

Query: 247  LYKRGALLKGWKQRWFVL 194
            LY +G L+  WK+RW VL
Sbjct: 1182 LYMKGGLMNSWKRRWCVL 1199


>BC065213-1|AAH65213.1|  747|Homo sapiens oxysterol binding
           protein-like 11 protein.
          Length = 747

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 2/54 (3%)
 Frame = -3

Query: 265 QNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYY--DAMEDSHCKGFIDLAEVI 110
           +N  G+L K   L+ GW+ R+FVL++    L Y+  +   +   +G + LA  +
Sbjct: 59  ENVYGYLMKYTNLVTGWQYRFFVLNNEAGLLEYFVNEQSRNQKPRGTLQLAGAV 112


>BC047918-1|AAH47918.1|  246|Homo sapiens ARHGAP24 protein protein.
          Length = 246

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 17/44 (38%), Positives = 23/44 (52%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G L K+G  +K W  RWFVL     QL Y+   +++   G I L
Sbjct: 24  GWLRKQGGFVKTWHTRWFVLKG--DQLYYFKDEDETKPLGTIFL 65


>BC040275-1|AAH40275.1| 1181|Homo sapiens RASGRF1 protein protein.
          Length = 1181

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 16/64 (25%), Positives = 31/64 (48%)
 Frame = -3

Query: 274 RREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQA 95
           R++   +G+L KR +    W+ +WF L  +++ L Y+++   S   G   L   +     
Sbjct: 20  RKDGTRKGYLSKRSSDNTKWQTKWFAL--LQNLLFYFESDSSSRPSGLYLLEGCVCDRAP 77

Query: 94  TPAP 83
           +P P
Sbjct: 78  SPKP 81


>BC004361-1|AAH04361.1|  400|Homo sapiens pleckstrin homology, Sec7
           and coiled-coil domains 2 (cytohesin-2) protein.
          Length = 400

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = -3

Query: 235 GALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G  +K WK+RWF+L    + L Y++   D   +G I L
Sbjct: 271 GGRVKTWKRRWFILTD--NCLYYFEYTTDKEPRGIIPL 306


>AK130576-1|BAC85384.1|  239|Homo sapiens protein ( Homo sapiens
           cDNA FLJ27066 fis, clone SPL01327. ).
          Length = 239

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 17/44 (38%), Positives = 23/44 (52%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G L K+G  +K W  RWFVL     QL Y+   +++   G I L
Sbjct: 169 GWLRKQGGFVKTWHTRWFVLKG--DQLYYFKDEDETKPLGTIFL 210


>AK091196-1|BAC03606.1|  748|Homo sapiens protein ( Homo sapiens
           cDNA FLJ33877 fis, clone CTONG2007072, weakly similar to
           N-CHIMAERIN. ).
          Length = 748

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 17/44 (38%), Positives = 23/44 (52%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G L K+G  +K W  RWFVL     QL Y+   +++   G I L
Sbjct: 24  GWLRKQGGFVKTWHTRWFVLKG--DQLYYFKDEDETKPLGTIFL 65


>AK074717-1|BAC11158.1|  984|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90236 fis, clone NT2RM2000589, moderately
           similar to Bos taurus myosin X, complete cds. ).
          Length = 984

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 5/56 (8%)
 Frame = -3

Query: 274 RREQNARGHLYKRGA-----LLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           ++E   +G L+K+G        + WK+RWFVL   K  L Y++   +   KG +++
Sbjct: 136 KQEALKQGWLHKKGGGSSTLSRRNWKKRWFVLRQSK--LMYFENDSEEKLKGTVEV 189



 Score = 29.5 bits (63), Expect = 4.1
 Identities = 10/18 (55%), Positives = 13/18 (72%)
 Frame = -3

Query: 247 LYKRGALLKGWKQRWFVL 194
           LY +G L+  WK+RW VL
Sbjct: 108 LYMKGGLMNSWKRRWCVL 125


>AF392454-1|AAL40667.1|  747|Homo sapiens oxysterol-binding
           protein-like protein OSBPL11 protein.
          Length = 747

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 2/54 (3%)
 Frame = -3

Query: 265 QNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYY--DAMEDSHCKGFIDLAEVI 110
           +N  G+L K   L+ GW+ R+FVL++    L Y+  +   +   +G + LA  +
Sbjct: 59  ENVYGYLMKYTNLVTGWQYRFFVLNNEAGLLEYFVNEQSRNQKPRGTLQLAGAV 112


>AF392446-1|AAL40659.1|  842|Homo sapiens oxysterol-binding
           protein-like protein OSBPL7 protein.
          Length = 842

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 2/50 (4%)
 Frame = -3

Query: 265 QNARGHLYKRGAL-LKGWKQRWFVL-DSIKHQLRYYDAMEDSHCKGFIDL 122
           +   GHL KR    LKGW +R+FVL D I H       +      G ID+
Sbjct: 48  ERQEGHLLKRRKWPLKGWHKRYFVLEDGILHYATTRQDITKGKLHGSIDV 97


>AF346292-1|AAK31141.1|  315|Homo sapiens OSBP related protein 11
           protein.
          Length = 315

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 2/54 (3%)
 Frame = -3

Query: 265 QNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYY--DAMEDSHCKGFIDLAEVI 110
           +N  G+L K   L+ GW+ R+FVL++    L Y+  +   +   +G + LA  +
Sbjct: 59  ENVYGYLMKYTNLVTGWQYRFFVLNNEAGLLEYFVNEQSRNQKPRGTLQLAGAV 112


>AF247457-1|AAF68025.2| 2058|Homo sapiens myosin X protein.
          Length = 2058

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 5/56 (8%)
 Frame = -3

Query: 274  RREQNARGHLYKRGA-----LLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
            ++E   +G L+K+G        + WK+RWFVL   K  L Y++   +   KG +++
Sbjct: 1210 KQEALKQGWLHKKGGGSSTLSRRNWKKRWFVLRQSK--LMYFENDSEEKLKGTVEV 1263



 Score = 29.5 bits (63), Expect = 4.1
 Identities = 10/18 (55%), Positives = 13/18 (72%)
 Frame = -3

Query: 247  LYKRGALLKGWKQRWFVL 194
            LY +G L+  WK+RW VL
Sbjct: 1182 LYMKGGLMNSWKRRWCVL 1199


>AF234532-1|AAF37875.1| 2058|Homo sapiens myosin X protein.
          Length = 2058

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 5/56 (8%)
 Frame = -3

Query: 274  RREQNARGHLYKRGA-----LLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
            ++E   +G L+K+G        + WK+RWFVL   K  L Y++   +   KG +++
Sbjct: 1210 KQEALKQGWLHKKGGGSSTLSRRNWKKRWFVLRQSK--LMYFENDSEEKLKGTVEV 1263



 Score = 29.5 bits (63), Expect = 4.1
 Identities = 10/18 (55%), Positives = 13/18 (72%)
 Frame = -3

Query: 247  LYKRGALLKGWKQRWFVL 194
            LY +G L+  WK+RW VL
Sbjct: 1182 LYMKGGLMNSWKRRWCVL 1199


>AF132021-1|AAF36524.1| 1540|Homo sapiens myosin X protein.
          Length = 1540

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 5/56 (8%)
 Frame = -3

Query: 274  RREQNARGHLYKRGA-----LLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
            ++E   +G L+K+G        + WK+RWFVL   K  L Y++   +   KG +++
Sbjct: 1210 KQEALKQGWLHKKGGGSSTLSRRNWKKRWFVLRQSK--LMYFENDSEEKLKGTVEV 1263


>AB018342-1|BAA34519.2| 2111|Homo sapiens KIAA0799 protein protein.
          Length = 2111

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 5/56 (8%)
 Frame = -3

Query: 274  RREQNARGHLYKRGA-----LLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
            ++E   +G L+K+G        + WK+RWFVL   K  L Y++   +   KG +++
Sbjct: 1263 KQEALKQGWLHKKGGGSSTLSRRNWKKRWFVLRQSK--LMYFENDSEEKLKGTVEV 1316



 Score = 29.5 bits (63), Expect = 4.1
 Identities = 10/18 (55%), Positives = 13/18 (72%)
 Frame = -3

Query: 247  LYKRGALLKGWKQRWFVL 194
            LY +G L+  WK+RW VL
Sbjct: 1235 LYMKGGLMNSWKRRWCVL 1252


>BC033758-1|AAH33758.1|  380|Homo sapiens centaurin, alpha 2
           protein.
          Length = 380

 Score = 30.3 bits (65), Expect = 2.4
 Identities = 15/45 (33%), Positives = 25/45 (55%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           +G + K G   + +K+RWF LD  + +L YY    D+  +G + L
Sbjct: 259 QGFMEKTGPKKEPFKKRWFALDCHERRLLYYKNPLDAFEQGQVFL 303


>BT006900-1|AAP35546.1|  720|Homo sapiens connector enhancer of
           KSR-like (Drosophila kinase suppressor of ras) protein.
          Length = 720

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLA 119
           W++RWFVL    H L +Y   +D   +G I+++
Sbjct: 424 WRRRWFVLKG--HTLYWYRQPQDEKAEGLINVS 454


>BC126112-1|AAI26113.1| 1237|Homo sapiens Ras protein-specific
           guanine nucleotide-releasing factor 2 protein.
          Length = 1237

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 20/64 (31%), Positives = 31/64 (48%)
 Frame = -3

Query: 274 RREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQA 95
           R+E   RG L K+ A    W ++WF L   ++ L Y++  +     G   L E  +  + 
Sbjct: 20  RKEGTKRGFLSKKTAEASRWHEKWFAL--YQNVLFYFEGEQSCRPAGMY-LLEGCS-CER 75

Query: 94  TPAP 83
           TPAP
Sbjct: 76  TPAP 79


>BC118914-1|AAI18915.1|  915|Homo sapiens oxysterol binding protein
           2 protein.
          Length = 915

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 20/47 (42%), Positives = 29/47 (61%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYY-DAMEDSH-CKGFIDLA 119
           G L K    LKG+++RWFVL +    L YY +  E +H C+G I+L+
Sbjct: 187 GWLLKWTNYLKGYQRRWFVLGN--GLLSYYRNQGEMAHTCRGTINLS 231


>BC012797-1|AAH12797.1|  720|Homo sapiens CNKSR1 protein protein.
          Length = 720

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLA 119
           W++RWFVL    H L +Y   +D   +G I+++
Sbjct: 424 WRRRWFVLKG--HTLYWYRQPQDEKAEGLINVS 454


>BC011604-1|AAH11604.1|  720|Homo sapiens CNKSR1 protein protein.
          Length = 720

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLA 119
           W++RWFVL    H L +Y   +D   +G I+++
Sbjct: 424 WRRRWFVLKG--HTLYWYRQPQDEKAEGLINVS 454


>AL391650-10|CAI17138.1|  720|Homo sapiens connector enhancer of
           kinase suppressor of Ras 1 protein.
          Length = 720

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLA 119
           W++RWFVL    H L +Y   +D   +G I+++
Sbjct: 424 WRRRWFVLKG--HTLYWYRQPQDEKAEGLINVS 454


>AL391650-9|CAI17139.1|  713|Homo sapiens connector enhancer of
           kinase suppressor of Ras 1 protein.
          Length = 713

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLA 119
           W++RWFVL    H L +Y   +D   +G I+++
Sbjct: 417 WRRRWFVLKG--HTLYWYRQPQDEKAEGLINVS 447


>AL355877-5|CAH71543.1|  720|Homo sapiens connector enhancer of
           kinase suppressor of Ras 1 protein.
          Length = 720

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLA 119
           W++RWFVL    H L +Y   +D   +G I+++
Sbjct: 424 WRRRWFVLKG--HTLYWYRQPQDEKAEGLINVS 454


>AL355877-4|CAH71542.1|  713|Homo sapiens connector enhancer of
           kinase suppressor of Ras 1 protein.
          Length = 713

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLA 119
           W++RWFVL    H L +Y   +D   +G I+++
Sbjct: 417 WRRRWFVLKG--HTLYWYRQPQDEKAEGLINVS 447


>AL079299-1|CAI14632.1|  917|Homo sapiens oxysterol binding protein
           2 protein.
          Length = 917

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 20/47 (42%), Positives = 29/47 (61%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYY-DAMEDSH-CKGFIDLA 119
           G L K    LKG+++RWFVL +    L YY +  E +H C+G I+L+
Sbjct: 187 GWLLKWTNYLKGYQRRWFVLGN--GLLSYYRNQGEMAHTCRGTINLS 231


>AL022336-1|CAI22805.1|  917|Homo sapiens oxysterol binding protein
           2 protein.
          Length = 917

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 20/47 (42%), Positives = 29/47 (61%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYY-DAMEDSH-CKGFIDLA 119
           G L K    LKG+++RWFVL +    L YY +  E +H C+G I+L+
Sbjct: 187 GWLLKWTNYLKGYQRRWFVLGN--GLLSYYRNQGEMAHTCRGTINLS 231


>AK222904-1|BAD96624.1|  713|Homo sapiens connector enhancer of
           kinase suppressor of Ras 1 variant protein.
          Length = 713

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLA 119
           W++RWFVL    H L +Y   +D   +G I+++
Sbjct: 417 WRRRWFVLKG--HTLYWYRQPQDEKAEGLINVS 447


>AK222817-1|BAD96537.1|  713|Homo sapiens connector enhancer of
           kinase suppressor of Ras 1 variant protein.
          Length = 713

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLA 119
           W++RWFVL    H L +Y   +D   +G I+++
Sbjct: 417 WRRRWFVLKG--HTLYWYRQPQDEKAEGLINVS 447


>AF323731-1|AAG53406.1|  916|Homo sapiens OSBP-related protein 4
           protein.
          Length = 916

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 20/47 (42%), Positives = 29/47 (61%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYY-DAMEDSH-CKGFIDLA 119
           G L K    LKG+++RWFVL +    L YY +  E +H C+G I+L+
Sbjct: 187 GWLLKWTNYLKGYQRRWFVLGN--GLLSYYRNQGEMAHTCRGTINLS 231


>AF288742-1|AAK56865.1|  878|Homo sapiens oxysterol binding protein
           2 protein.
          Length = 878

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 20/47 (42%), Positives = 29/47 (61%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYY-DAMEDSH-CKGFIDLA 119
           G L K    LKG+++RWFVL +    L YY +  E +H C+G I+L+
Sbjct: 149 GWLLKWTNYLKGYQRRWFVLGN--GLLSYYRNQGEMAHTCRGTINLS 193


>AF288741-1|AAK56864.1|  878|Homo sapiens oxysterol binding protein
           2 protein.
          Length = 878

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 20/47 (42%), Positives = 29/47 (61%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYY-DAMEDSH-CKGFIDLA 119
           G L K    LKG+++RWFVL +    L YY +  E +H C+G I+L+
Sbjct: 149 GWLLKWTNYLKGYQRRWFVLGN--GLLSYYRNQGEMAHTCRGTINLS 193


>AF181250-1|AAD55268.1| 1237|Homo sapiens Ras guanine nucleotide
           exchange factor 2 protein.
          Length = 1237

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 20/64 (31%), Positives = 31/64 (48%)
 Frame = -3

Query: 274 RREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQA 95
           R+E   RG L K+ A    W ++WF L   ++ L Y++  +     G   L E  +  + 
Sbjct: 20  RKEGTKRGFLSKKTAEASRWHEKWFAL--YQNVLFYFEGEQSCRPAGMY-LLEGCS-CER 75

Query: 94  TPAP 83
           TPAP
Sbjct: 76  TPAP 79


>AF100153-1|AAC80558.1|  713|Homo sapiens connector enhancer of
           KSR-like protein CNK1 protein.
          Length = 713

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLA 119
           W++RWFVL    H L +Y   +D   +G I+++
Sbjct: 417 WRRRWFVLKG--HTLYWYRQPQDEKAEGLINVS 447


>AF023130-1|AAB80953.1| 1237|Homo sapiens Ras-GRF2 protein.
          Length = 1237

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 20/64 (31%), Positives = 31/64 (48%)
 Frame = -3

Query: 274 RREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQA 95
           R+E   RG L K+ A    W ++WF L   ++ L Y++  +     G   L E  +  + 
Sbjct: 20  RKEGTKRGFLSKKTAEASRWHEKWFAL--YQNVLFYFEGEQSCRPAGMY-LLEGCS-CER 75

Query: 94  TPAP 83
           TPAP
Sbjct: 76  TPAP 79


>AB209335-1|BAD92572.1|  456|Homo sapiens Connector enhancer of
           kinase suppressor of ras 1 variant protein.
          Length = 456

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLA 119
           W++RWFVL    H L +Y   +D   +G I+++
Sbjct: 160 WRRRWFVLKG--HTLYWYRQPQDEKAEGLINVS 190


>AB051451-1|BAB33334.2|  920|Homo sapiens KIAA1664 protein protein.
          Length = 920

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 20/47 (42%), Positives = 29/47 (61%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYY-DAMEDSH-CKGFIDLA 119
           G L K    LKG+++RWFVL +    L YY +  E +H C+G I+L+
Sbjct: 191 GWLLKWTNYLKGYQRRWFVLGN--GLLSYYRNQGEMAHTCRGTINLS 235


>DQ907253-1|ABI93267.1|  393|Homo sapiens WDR13 protein.
          Length = 393

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 5/63 (7%)
 Frame = +1

Query: 70  SWAVREPEWPASLLSLPLNQ*ILY-----SASLPSHRSIVADVLSSPTRTIFVSIP*VER 234
           SW  RE   P+ L++  LN+ +LY       +L   RS   +  S P R+IF  +    +
Sbjct: 269 SWVSREARDPSXLINACLNKLLLYRVVDNEGTLQLKRSFPIEQSSHPVRSIFCPLMSFRQ 328

Query: 235 LAC 243
            AC
Sbjct: 329 GAC 331


>BC125069-1|AAI25070.1|  417|Homo sapiens zinc finger protein 114
           protein.
          Length = 417

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 1/45 (2%)
 Frame = -3

Query: 214 KQRWFVLDSIKHQLRYYDAM-EDSHCKGFIDLAEVIAVTQATPAP 83
           K+ W +LD  +  L Y D M E+S    FID A       ATP P
Sbjct: 17  KEEWTLLDPAQRNL-YRDVMLENSRNLAFIDWATPCKTKDATPQP 60


>BC065482-1|AAH65482.1|  842|Homo sapiens oxysterol binding
           protein-like 7 protein.
          Length = 842

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 2/50 (4%)
 Frame = -3

Query: 265 QNARGHLYKRGAL-LKGWKQRWFVL-DSIKHQLRYYDAMEDSHCKGFIDL 122
           +   GHL K+    LKGW +R+FVL D I H       +      G ID+
Sbjct: 48  ERQEGHLLKKRKWPLKGWHKRYFVLEDGILHYATTRQDITKGKLHGSIDV 97


>BC038713-1|AAH38713.1|  400|Homo sapiens pleckstrin homology, Sec7
           and coiled-coil domains 2 (cytohesin-2) protein.
          Length = 400

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 13/36 (36%), Positives = 20/36 (55%)
 Frame = -3

Query: 235 GALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
           G  +K WK+RWF+L    + L Y++   D   +G I
Sbjct: 271 GGRVKTWKRRWFILTD--NCLYYFEYTTDKEPRGII 304


>BC028010-1|AAH28010.1|  357|Homo sapiens OSBPL7 protein protein.
          Length = 357

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 2/50 (4%)
 Frame = -3

Query: 265 QNARGHLYKRGAL-LKGWKQRWFVL-DSIKHQLRYYDAMEDSHCKGFIDL 122
           +   GHL K+    LKGW +R+FVL D I H       +      G ID+
Sbjct: 48  ERQEGHLLKKRKWPLKGWHKRYFVLEDGILHYATTRQDITKGKLHGSIDV 97


>BC000102-1|AAH00102.1|  598|Homo sapiens COL4A3BP protein protein.
          Length = 598

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 2/50 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSH--CKGFIDLAEVI 110
           G L K    + GW+ RW VL +  + L YY + +++   C+G I L++ +
Sbjct: 28  GVLSKWTNYIHGWQDRWVVLKN--NALSYYKSEDETEYGCRGSICLSKAV 75


>AY453386-1|AAR26718.1|  624|Homo sapiens lipid-transfer protein
           CERTL protein.
          Length = 624

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 2/50 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSH--CKGFIDLAEVI 110
           G L K    + GW+ RW VL +  + L YY + +++   C+G I L++ +
Sbjct: 28  GVLSKWTNYIHGWQDRWVVLKN--NALSYYKSEDETEYGCRGSICLSKAV 75


>AY453385-1|AAR26717.1|  598|Homo sapiens lipid-transfer protein
           CERT protein.
          Length = 598

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 2/50 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSH--CKGFIDLAEVI 110
           G L K    + GW+ RW VL +  + L YY + +++   C+G I L++ +
Sbjct: 28  GVLSKWTNYIHGWQDRWVVLKN--NALSYYKSEDETEYGCRGSICLSKAV 75


>AK091851-1|BAC03762.1|  598|Homo sapiens protein ( Homo sapiens
           cDNA FLJ34532 fis, clone HLUNG2008235, highly similar to
           Homo sapiens goodpasture antigen-binding protein
           (COL4A3BP) ).
          Length = 598

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 2/50 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSH--CKGFIDLAEVI 110
           G L K    + GW+ RW VL +  + L YY + +++   C+G I L++ +
Sbjct: 28  GVLSKWTNYIHGWQDRWVVLKN--NALSYYKSEDETEYGCRGSICLSKAV 75


>AK075062-1|BAC11378.1|  417|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90581 fis, clone PLACE1000258, weakly similar to
           ZINC FINGER PROTEIN 91. ).
          Length = 417

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 1/45 (2%)
 Frame = -3

Query: 214 KQRWFVLDSIKHQLRYYDAM-EDSHCKGFIDLAEVIAVTQATPAP 83
           K+ W +LD  +  L Y D M E+S    FID A       ATP P
Sbjct: 17  KEEWTLLDPAQRNL-YRDVMLENSRNLAFIDWATPCKTKDATPQP 60


>AK000267-1|BAA91043.1|  564|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20260 fis, clone COLF7627. ).
          Length = 564

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 2/50 (4%)
 Frame = -3

Query: 265 QNARGHLYKRGAL-LKGWKQRWFVL-DSIKHQLRYYDAMEDSHCKGFIDL 122
           +   GHL K+    LKGW +R+FVL D I H       +      G ID+
Sbjct: 48  ERQEGHLLKKRKWPLKGWHKRYFVLEDGILHYATTRQDITKGKLHGSIDV 97


>AF323729-1|AAG53410.1|  842|Homo sapiens OSBP-related protein 7
           protein.
          Length = 842

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 2/50 (4%)
 Frame = -3

Query: 265 QNARGHLYKRGAL-LKGWKQRWFVL-DSIKHQLRYYDAMEDSHCKGFIDL 122
           +   GHL K+    LKGW +R+FVL D I H       +      G ID+
Sbjct: 48  ERQEGHLLKKRKWPLKGWHKRYFVLEDGILHYATTRQDITKGKLHGSIDV 97


>AF232930-1|AAG42046.1|  598|Homo sapiens Goodpasture
           antigen-binding protein D26 protein.
          Length = 598

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 2/50 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSH--CKGFIDLAEVI 110
           G L K    + GW+ RW VL +  + L YY + +++   C+G I L++ +
Sbjct: 28  GVLSKWTNYIHGWQDRWVVLKN--NALSYYKSEDETEYGCRGSICLSKAV 75


>AF136450-1|AAD30288.1|  624|Homo sapiens goodpasture
           antigen-binding protein protein.
          Length = 624

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 2/50 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSH--CKGFIDLAEVI 110
           G L K    + GW+ RW VL +  + L YY + +++   C+G I L++ +
Sbjct: 28  GVLSKWTNYIHGWQDRWVVLKN--NALSYYKSEDETEYGCRGSICLSKAV 75


>M95936-1|AAA58364.1|  481|Homo sapiens protein serine/threonine
           kinase protein.
          Length = 481

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 11/22 (50%), Positives = 16/22 (72%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDS 188
           G L+KRG  +K W+ R+F+L S
Sbjct: 10  GWLHKRGEYIKTWRPRYFLLKS 31


>M77198-1|AAA36585.1|  520|Homo sapiens rac protein kinase-beta
           protein.
          Length = 520

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 11/22 (50%), Positives = 16/22 (72%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDS 188
           G L+KRG  +K W+ R+F+L S
Sbjct: 10  GWLHKRGEYIKTWRPRYFLLKS 31


>DQ907254-1|ABI93268.1|  363|Homo sapiens WDR13 protein.
          Length = 363

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 5/63 (7%)
 Frame = +1

Query: 70  SWAVREPEWPASLLSLPLNQ*ILY-----SASLPSHRSIVADVLSSPTRTIFVSIP*VER 234
           SW  RE   P+ L++  LN+ +LY       +L   RS   +  S P R+IF  +    +
Sbjct: 239 SWVSREARDPSLLINACLNKLLLYRVVDNEGTLQLKRSFPIEQSSHPVRSIFCPLMSFRQ 298

Query: 235 LAC 243
            AC
Sbjct: 299 GAC 301


>DQ907252-1|ABI93266.1|  485|Homo sapiens WDR13 protein.
          Length = 485

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 5/63 (7%)
 Frame = +1

Query: 70  SWAVREPEWPASLLSLPLNQ*ILY-----SASLPSHRSIVADVLSSPTRTIFVSIP*VER 234
           SW  RE   P+ L++  LN+ +LY       +L   RS   +  S P R+IF  +    +
Sbjct: 361 SWVSREARDPSLLINACLNKLLLYRVVDNEGTLQLKRSFPIEQSSHPVRSIFCPLMSFRQ 420

Query: 235 LAC 243
            AC
Sbjct: 421 GAC 423


>BC131711-1|AAI31712.1|  676|Homo sapiens GRB2-associated binding
           protein 2 protein.
          Length = 676

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 6/76 (7%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQ-----LRYYDAMEDSHCKGFIDLAEVIAVTQATPA-PGPPKKCDDR 56
           WK+RWF+L S +       L YY   ++ H K  + +  +    Q         K+  D 
Sbjct: 27  WKKRWFILRSGRMSGDPDVLEYY---KNDHSKKPLRIINLNFCEQVDAGLTFNKKELQDS 83

Query: 55  SFFDLRTSRRTYNFCA 8
             FD++TS RT+   A
Sbjct: 84  FVFDIKTSERTFYLVA 99


>BC120995-1|AAI20996.1|  438|Homo sapiens AKT2 protein protein.
          Length = 438

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 11/22 (50%), Positives = 16/22 (72%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDS 188
           G L+KRG  +K W+ R+F+L S
Sbjct: 10  GWLHKRGEYIKTWRPRYFLLKS 31


>BC120994-1|AAI20995.1|  481|Homo sapiens v-akt murine thymoma viral
           oncogene homolog 2 protein.
          Length = 481

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 11/22 (50%), Positives = 16/22 (72%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDS 188
           G L+KRG  +K W+ R+F+L S
Sbjct: 10  GWLHKRGEYIKTWRPRYFLLKS 31


>BC080579-1|AAH80579.1|  485|Homo sapiens WD repeat domain 13
           protein.
          Length = 485

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 5/63 (7%)
 Frame = +1

Query: 70  SWAVREPEWPASLLSLPLNQ*ILY-----SASLPSHRSIVADVLSSPTRTIFVSIP*VER 234
           SW  RE   P+ L++  LN+ +LY       +L   RS   +  S P R+IF  +    +
Sbjct: 361 SWVSREARDPSLLINACLNKLLLYRVVDNEGTLQLKRSFPIEQSSHPVRSIFCPLMSFRQ 420

Query: 235 LAC 243
            AC
Sbjct: 421 GAC 423


>BC067094-1|AAH67094.1|  535|Homo sapiens WDR13 protein protein.
          Length = 535

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 5/63 (7%)
 Frame = +1

Query: 70  SWAVREPEWPASLLSLPLNQ*ILY-----SASLPSHRSIVADVLSSPTRTIFVSIP*VER 234
           SW  RE   P+ L++  LN+ +LY       +L   RS   +  S P R+IF  +    +
Sbjct: 411 SWVSREARDPSLLINACLNKLLLYRVVDNEGTLQLKRSFPIEQSSHPVRSIFCPLMSFRQ 470

Query: 235 LAC 243
            AC
Sbjct: 471 GAC 473


>BC032709-1|AAH32709.1|  344|Homo sapiens AKT2 protein protein.
          Length = 344

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 11/22 (50%), Positives = 16/22 (72%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDS 188
           G L+KRG  +K W+ R+F+L S
Sbjct: 10  GWLHKRGEYIKTWRPRYFLLKS 31


>BC002507-1|AAH02507.2|  340|Homo sapiens WDR13 protein protein.
          Length = 340

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 5/63 (7%)
 Frame = +1

Query: 70  SWAVREPEWPASLLSLPLNQ*ILY-----SASLPSHRSIVADVLSSPTRTIFVSIP*VER 234
           SW  RE   P+ L++  LN+ +LY       +L   RS   +  S P R+IF  +    +
Sbjct: 216 SWVSREARDPSLLINACLNKLLLYRVVDNEGTLQLKRSFPIEQSSHPVRSIFCPLMSFRQ 275

Query: 235 LAC 243
            AC
Sbjct: 276 GAC 278


>AK000570-1|BAA91261.1|  198|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20563 fis, clone KAT12009. ).
          Length = 198

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 5/63 (7%)
 Frame = +1

Query: 70  SWAVREPEWPASLLSLPLNQ*ILY-----SASLPSHRSIVADVLSSPTRTIFVSIP*VER 234
           SW  RE   P+ L++  LN+ +LY       +L   RS   +  S P R+IF  +    +
Sbjct: 74  SWVSREARDPSLLINACLNKLLLYRVVDNEGTLQLKRSFPIEQSSHPVRSIFCPLMSFRQ 133

Query: 235 LAC 243
            AC
Sbjct: 134 GAC 136


>AF329819-1|AAG47845.3|  485|Homo sapiens WDR13 protein protein.
          Length = 485

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 5/63 (7%)
 Frame = +1

Query: 70  SWAVREPEWPASLLSLPLNQ*ILY-----SASLPSHRSIVADVLSSPTRTIFVSIP*VER 234
           SW  RE   P+ L++  LN+ +LY       +L   RS   +  S P R+IF  +    +
Sbjct: 361 SWVSREARDPSLLINACLNKLLLYRVVDNEGTLQLKRSFPIEQSSHPVRSIFCPLMSFRQ 420

Query: 235 LAC 243
            AC
Sbjct: 421 GAC 423


>AF149817-1|AAK13247.1|  485|Homo sapiens WDR13 protein protein.
          Length = 485

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 5/63 (7%)
 Frame = +1

Query: 70  SWAVREPEWPASLLSLPLNQ*ILY-----SASLPSHRSIVADVLSSPTRTIFVSIP*VER 234
           SW  RE   P+ L++  LN+ +LY       +L   RS   +  S P R+IF  +    +
Sbjct: 361 SWVSREARDPSLLINACLNKLLLYRVVDNEGTLQLKRSFPIEQSSHPVRSIFCPLMSFRQ 420

Query: 235 LAC 243
            AC
Sbjct: 421 GAC 423


>AB018413-1|BAA76737.1|  676|Homo sapiens Gab2 protein.
          Length = 676

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 6/76 (7%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQ-----LRYYDAMEDSHCKGFIDLAEVIAVTQATPA-PGPPKKCDDR 56
           WK+RWF+L S +       L YY   ++ H K  + +  +    Q         K+  D 
Sbjct: 27  WKKRWFILRSGRMSGDPDVLEYY---KNDHSKKPLRIINLNFCEQVDAGLTFNKKELQDS 83

Query: 55  SFFDLRTSRRTYNFCA 8
             FD++TS RT+   A
Sbjct: 84  FVFDIKTSERTFYLVA 99


>X12883-1|CAA31377.1|  424|Homo sapiens cytokeratin 18 (424 AA)
           protein.
          Length = 424

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 14/57 (24%), Positives = 31/57 (54%)
 Frame = -3

Query: 277 RRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIA 107
           RR E   R HL K+G  ++ W   + +++ ++ Q+ + + ++++     ID A + A
Sbjct: 100 RRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQI-FANTVDNARIVLQIDNARLAA 155


>X12881-1|CAA31375.1|  430|Homo sapiens cytokeratin 18 protein.
          Length = 430

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 14/57 (24%), Positives = 31/57 (54%)
 Frame = -3

Query: 277 RRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIA 107
           RR E   R HL K+G  ++ W   + +++ ++ Q+ + + ++++     ID A + A
Sbjct: 106 RRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQI-FANTVDNARIVLQIDNARLAA 161


>M63167-1|AAA36539.1|  480|Homo sapiens rac protein kinase-alpha
           protein.
          Length = 480

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMED 149
           G L+KRG  +K W+ R+F+L +    + Y +  +D
Sbjct: 10  GWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQD 44


>BT019412-1|AAV38219.1|  430|Homo sapiens keratin 18 protein.
          Length = 430

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 14/57 (24%), Positives = 31/57 (54%)
 Frame = -3

Query: 277 RRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIA 107
           RR E   R HL K+G  ++ W   + +++ ++ Q+ + + ++++     ID A + A
Sbjct: 106 RRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQI-FANTVDNARIVLQIDNARLAA 161


>BC125226-1|AAI25227.1|  639|Homo sapiens FGD6 protein protein.
          Length = 639

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
 Frame = -3

Query: 268 EQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRY-YDAMED 149
           + +  G+LY+     K WK  WFV   IK+++ Y Y A ED
Sbjct: 542 DSSMSGYLYRSKGNKKPWKHFWFV---IKNKVLYTYAASED 579


>BC125225-1|AAI25226.1|  639|Homo sapiens FGD6 protein protein.
          Length = 639

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
 Frame = -3

Query: 268 EQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRY-YDAMED 149
           + +  G+LY+     K WK  WFV   IK+++ Y Y A ED
Sbjct: 542 DSSMSGYLYRSKGNKKPWKHFWFV---IKNKVLYTYAASED 579


>BC084538-1|AAH84538.1|  480|Homo sapiens v-akt murine thymoma viral
           oncogene homolog 1 protein.
          Length = 480

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMED 149
           G L+KRG  +K W+ R+F+L +    + Y +  +D
Sbjct: 10  GWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQD 44


>BC072017-1|AAH72017.1|  430|Homo sapiens keratin 18 protein.
          Length = 430

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 14/57 (24%), Positives = 31/57 (54%)
 Frame = -3

Query: 277 RRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIA 107
           RR E   R HL K+G  ++ W   + +++ ++ Q+ + + ++++     ID A + A
Sbjct: 106 RRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQI-FANTVDNARIVLQIDNARLAA 161


>BC020982-1|AAH20982.1|  430|Homo sapiens keratin 18 protein.
          Length = 430

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 14/57 (24%), Positives = 31/57 (54%)
 Frame = -3

Query: 277 RRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIA 107
           RR E   R HL K+G  ++ W   + +++ ++ Q+ + + ++++     ID A + A
Sbjct: 106 RRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQI-FANTVDNARIVLQIDNARLAA 161


>BC008636-1|AAH08636.1|  430|Homo sapiens keratin 18 protein.
          Length = 430

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 14/57 (24%), Positives = 31/57 (54%)
 Frame = -3

Query: 277 RRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIA 107
           RR E   R HL K+G  ++ W   + +++ ++ Q+ + + ++++     ID A + A
Sbjct: 106 RRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQI-FANTVDNARIVLQIDNARLAA 161


>BC004253-1|AAH04253.1|  430|Homo sapiens keratin 18 protein.
          Length = 430

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 14/57 (24%), Positives = 31/57 (54%)
 Frame = -3

Query: 277 RRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIA 107
           RR E   R HL K+G  ++ W   + +++ ++ Q+ + + ++++     ID A + A
Sbjct: 106 RRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQI-FANTVDNARIVLQIDNARLAA 161


>BC000698-1|AAH00698.1|  430|Homo sapiens keratin 18 protein.
          Length = 430

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 14/57 (24%), Positives = 31/57 (54%)
 Frame = -3

Query: 277 RRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIA 107
           RR E   R HL K+G  ++ W   + +++ ++ Q+ + + ++++     ID A + A
Sbjct: 106 RRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQI-FANTVDNARIVLQIDNARLAA 161


>BC000479-1|AAH00479.1|  480|Homo sapiens v-akt murine thymoma viral
           oncogene homolog 1 protein.
          Length = 480

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMED 149
           G L+KRG  +K W+ R+F+L +    + Y +  +D
Sbjct: 10  GWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQD 44


>BC000180-1|AAH00180.1|  430|Homo sapiens keratin 18 protein.
          Length = 430

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 14/57 (24%), Positives = 31/57 (54%)
 Frame = -3

Query: 277 RRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIA 107
           RR E   R HL K+G  ++ W   + +++ ++ Q+ + + ++++     ID A + A
Sbjct: 106 RRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQI-FANTVDNARIVLQIDNARLAA 161


>AY762101-1|AAX07828.1|  430|Homo sapiens cell
           proliferation-inducing protein 46 protein.
          Length = 430

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 14/57 (24%), Positives = 31/57 (54%)
 Frame = -3

Query: 277 RRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIA 107
           RR E   R HL K+G  ++ W   + +++ ++ Q+ + + ++++     ID A + A
Sbjct: 106 RRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQI-FANTVDNARIVLQIDNARLAA 161


>AK223093-1|BAD96813.1|  430|Homo sapiens keratin 18 variant
           protein.
          Length = 430

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 14/57 (24%), Positives = 31/57 (54%)
 Frame = -3

Query: 277 RRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIA 107
           RR E   R HL K+G  ++ W   + +++ ++ Q+ + + ++++     ID A + A
Sbjct: 106 RRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQI-FANTVDNARIVLQIDNARLAA 161


>AK128492-1|BAC87464.1| 1053|Homo sapiens protein ( Homo sapiens cDNA
            FLJ46642 fis, clone TRACH3003037, weakly  similar to
            Rho/Rac guanine nucleotide exchange factor. ).
          Length = 1053

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
 Frame = -3

Query: 268  EQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRY-YDAMED 149
            + +  G+LY+     K WK  WFV   IK+++ Y Y A ED
Sbjct: 956  DSSMSGYLYRSKGNKKPWKHFWFV---IKNKVLYTYAASED 993


>AK124904-1|BAC85990.1| 1430|Homo sapiens protein ( Homo sapiens cDNA
            FLJ42914 fis, clone BRHIP3025161, weakly  similar to
            Rho/Rac guanine nucleotide exchange factor. ).
          Length = 1430

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
 Frame = -3

Query: 268  EQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRY-YDAMED 149
            + +  G+LY+     K WK  WFV   IK+++ Y Y A ED
Sbjct: 1333 DSSMSGYLYRSKGNKKPWKHFWFV---IKNKVLYTYAASED 1370


>AK002045-1|BAA92052.1|  432|Homo sapiens protein ( Homo sapiens
           cDNA FLJ11183 fis, clone PLACE1007488, weakly similar to
           PUTATIVE RHO/RAC GUANINE NUCLEOTIDE EXCHANGE FACTOR. ).
          Length = 432

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
 Frame = -3

Query: 268 EQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRY-YDAMED 149
           + +  G+LY+     K WK  WFV   IK+++ Y Y A ED
Sbjct: 335 DSSMSGYLYRSKGNKKPWKHFWFV---IKNKVLYTYAASED 372


>AF283830-1|AAL55732.1|  480|Homo sapiens AKT1 protein.
          Length = 480

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMED 149
           G L+KRG  +K W+ R+F+L +    + Y +  +D
Sbjct: 10  GWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQD 44


>AF179904-1|AAA59461.1|  430|Homo sapiens keratin 18 protein.
          Length = 430

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 14/57 (24%), Positives = 31/57 (54%)
 Frame = -3

Query: 277 RRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIA 107
           RR E   R HL K+G  ++ W   + +++ ++ Q+ + + ++++     ID A + A
Sbjct: 106 RRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQI-FANTVDNARIVLQIDNARLAA 161


>AB036936-1|BAB58977.1|   45|Homo sapiens Thr/Ser kinase protein.
          Length = 45

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 13/41 (31%), Positives = 25/41 (60%), Gaps = 2/41 (4%)
 Frame = -3

Query: 226 LKGWKQRWFVLDSIKHQLRYYDAMEDSH--CKGFIDLAEVI 110
           + GW+ RW VL +  + L YY + +++   C+G I L++ +
Sbjct: 5   IHGWQDRWVVLKN--NALSYYKSEDETEYGCRGSICLSKAV 43


>BC105987-1|AAI05988.1|  662|Homo sapiens M-RIP protein protein.
          Length = 662

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 3/43 (6%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQLRYYD---AMEDSHCKGFIDLAEVIAVTQ 98
           WK+ WFVL      LRYY    A E +   G IDL+    VT+
Sbjct: 27  WKKHWFVL--ADQSLRYYRDSVAEEAADLDGEIDLSACYDVTE 67


>BC075847-1|AAH75847.1|  832|Homo sapiens M-RIP protein protein.
          Length = 832

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 3/43 (6%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQLRYYD---AMEDSHCKGFIDLAEVIAVTQ 98
           WK+ WFVL      LRYY    A E +   G IDL+    VT+
Sbjct: 210 WKKHWFVL--ADQSLRYYRDSVAEEAADLDGEIDLSACYDVTE 250


>BC009982-1|AAH09982.2|  842|Homo sapiens M-RIP protein protein.
          Length = 842

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 3/43 (6%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQLRYYD---AMEDSHCKGFIDLAEVIAVTQ 98
           WK+ WFVL      LRYY    A E +   G IDL+    VT+
Sbjct: 207 WKKHWFVL--ADQSLRYYRDSVAEEAADLDGEIDLSACYDVTE 247


>AY296247-1|AAQ63176.1| 1024|Homo sapiens myosin phosphatase-Rho
           interacting protein protein.
          Length = 1024

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 3/43 (6%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQLRYYD---AMEDSHCKGFIDLAEVIAVTQ 98
           WK+ WFVL      LRYY    A E +   G IDL+    VT+
Sbjct: 402 WKKHWFVL--ADQSLRYYRDSVAEEAADLDGEIDLSACYDVTE 442


>AL834513-1|CAD39169.1|  987|Homo sapiens hypothetical protein
           protein.
          Length = 987

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 3/43 (6%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQLRYYD---AMEDSHCKGFIDLAEVIAVTQ 98
           WK+ WFVL      LRYY    A E +   G IDL+    VT+
Sbjct: 365 WKKHWFVL--ADQSLRYYRDSVAEEAADLDGEIDLSACYDVTE 405


>AL592114-6|CAH71228.1| 1048|Homo sapiens pleckstrin homology domain
           containing, family A member 6 protein.
          Length = 1048

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 25/83 (30%), Positives = 36/83 (43%), Gaps = 1/83 (1%)
 Frame = -3

Query: 253 GHLYKRGAL-LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGP 77
           G L+K+ +  +K W +RWFVL  +   L YY   ++    G I L     V    P+   
Sbjct: 64  GWLFKQASSGVKQWNKRWFVL--VDRCLFYYKDEKEESILGSIPLLS-FRVAAVQPSDNI 120

Query: 76  PKKCDDRSFFDLRTSRRTYNFCA 8
            +K    +F       RTY F A
Sbjct: 121 SRK---HTFKAEHAGVRTYFFSA 140


>AK092287-1|BAC03851.1|  586|Homo sapiens protein ( Homo sapiens
           cDNA FLJ34968 fis, clone NTONG2004844, highly similar to
           P116 RHO-INTERACTING PROTEIN. ).
          Length = 586

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 3/43 (6%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQLRYYD---AMEDSHCKGFIDLAEVIAVTQ 98
           WK+ WFVL      LRYY    A E +   G IDL+    VT+
Sbjct: 196 WKKHWFVL--ADQSLRYYRDSVAEEAADLDGEIDLSACYDVTE 236


>AB189741-1|BAD89507.1| 1036|Homo sapiens Rho interacting protein
           protein.
          Length = 1036

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 3/43 (6%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQLRYYD---AMEDSHCKGFIDLAEVIAVTQ 98
           WK+ WFVL      LRYY    A E +   G IDL+    VT+
Sbjct: 401 WKKHWFVL--ADQSLRYYRDSVAEEAADLDGEIDLSACYDVTE 441


>AB098507-1|BAC78198.1| 1037|Homo sapiens Rho-interacting protein 3
           protein.
          Length = 1037

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 3/43 (6%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQLRYYD---AMEDSHCKGFIDLAEVIAVTQ 98
           WK+ WFVL      LRYY    A E +   G IDL+    VT+
Sbjct: 402 WKKHWFVL--ADQSLRYYRDSVAEEAADLDGEIDLSACYDVTE 442


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 46,722,730
Number of Sequences: 237096
Number of extensions: 864204
Number of successful extensions: 2483
Number of sequences better than 10.0: 251
Number of HSP's better than 10.0 without gapping: 2421
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2480
length of database: 76,859,062
effective HSP length: 82
effective length of database: 57,417,190
effective search space used: 2756025120
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).