SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0018
         (502 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X04098-1|CAA27723.1|  375|Homo sapiens gamma-actin protein.           239   5e-63
M19283-1|AAA51579.1|  375|Homo sapiens ACTG1 protein.                 239   5e-63
BT019856-1|AAV38659.1|  375|Homo sapiens actin, gamma 1 protein.      239   5e-63
BC053572-1|AAH53572.1|  375|Homo sapiens actin, gamma 1 protein.      239   5e-63
BC018774-1|AAH18774.1|  375|Homo sapiens ACTG1 protein protein.       239   5e-63
BC015779-1|AAH15779.1|  375|Homo sapiens ACTG1 protein protein.       239   5e-63
BC015695-1|AAH15695.1|  375|Homo sapiens actin, gamma 1 protein.      239   5e-63
BC015005-1|AAH15005.1|  375|Homo sapiens ACTG1 protein protein.       239   5e-63
BC012050-1|AAH12050.1|  375|Homo sapiens actin, gamma 1 protein.      239   5e-63
BC010999-1|AAH10999.1|  375|Homo sapiens actin, gamma 1 protein.      239   5e-63
BC009848-1|AAH09848.1|  375|Homo sapiens actin, gamma 1 protein.      239   5e-63
BC007442-1|AAH07442.1|  375|Homo sapiens actin, gamma 1 protein.      239   5e-63
BC001920-1|AAH01920.1|  375|Homo sapiens ACTG1 protein protein.       239   5e-63
BC000292-1|AAH00292.1|  375|Homo sapiens actin, gamma 1 protein.      239   5e-63
X63432-1|CAA45026.1|  375|Homo sapiens mutant beta-actin  (beta'...   238   7e-63
X00351-1|CAA25099.1|  375|Homo sapiens protein ( Human mRNA for ...   238   7e-63
M10277-1|AAA51567.1|  375|Homo sapiens protein ( Human cytoplasm...   238   7e-63
DQ471327-1|ABF01018.1|  375|Homo sapiens PS1TP5-binding protein ...   238   7e-63
BC014861-1|AAH14861.1|  375|Homo sapiens actin, beta protein.         238   7e-63
BC013380-1|AAH13380.1|  375|Homo sapiens actin, beta protein.         238   7e-63
BC004251-1|AAH04251.1|  375|Homo sapiens actin, beta protein.         238   7e-63
BC002409-1|AAH02409.1|  375|Homo sapiens actin, beta protein.         238   7e-63
BC001301-1|AAH01301.1|  375|Homo sapiens actin, beta protein.         238   7e-63
AY582799-1|AAS79319.1|  375|Homo sapiens actin, beta protein.         238   7e-63
AK223055-1|BAD96775.1|  375|Homo sapiens beta actin variant prot...   238   7e-63
AK223032-1|BAD96752.1|  375|Homo sapiens beta actin variant prot...   238   7e-63
AK222925-1|BAD96645.1|  375|Homo sapiens beta actin variant prot...   238   7e-63
AC006483-1|AAP22343.1|  375|Homo sapiens unknown protein.             238   7e-63
BC016045-1|AAH16045.1|  375|Homo sapiens actin, beta protein.         236   3e-62
X16940-1|CAA34814.1|  376|Homo sapiens protein ( Human mRNA for ...   235   6e-62
D00654-1|BAA00546.1|  376|Homo sapiens enteric smooth muscle gam...   235   6e-62
CR541794-1|CAG46593.1|  376|Homo sapiens ACTG2 protein.               235   6e-62
CR536515-1|CAG38753.1|  376|Homo sapiens ACTG2 protein.               235   6e-62
BC094877-1|AAH94877.1|  376|Homo sapiens ACTG2 protein protein.       235   6e-62
BC012617-1|AAH12617.1|  376|Homo sapiens actin, gamma 2, smooth ...   235   6e-62
AC073046-2|AAX88909.1|  376|Homo sapiens unknown protein.             235   6e-62
X13839-1|CAA32064.1|  377|Homo sapiens protein ( Human mRNA for ...   230   2e-60
M20543-1|AAA60296.1|  377|Homo sapiens ACTA1 protein.                 230   2e-60
J05192-1|AAA51577.1|  377|Homo sapiens ACTA3 protein.                 230   2e-60
J00073-1|AAB59619.1|  377|Homo sapiens alpha-cardiac actin protein.   230   2e-60
J00068-1|AAB59376.1|  377|Homo sapiens ACTA1 protein.                 230   2e-60
CR541796-1|CAG46595.1|  377|Homo sapiens ACTA1 protein.               230   2e-60
CR541795-1|CAG46594.1|  377|Homo sapiens ACTC protein.                230   2e-60
CR536518-1|CAG38756.1|  377|Homo sapiens ACTA2 protein.               230   2e-60
CR536516-1|CAG38754.1|  377|Homo sapiens ACTA1 protein.               230   2e-60
BC093052-1|AAH93052.1|  377|Homo sapiens actin, alpha 2, smooth ...   230   2e-60
BC017554-1|AAH17554.1|  377|Homo sapiens actin, alpha 2, smooth ...   230   2e-60
BC012597-1|AAH12597.1|  377|Homo sapiens actin, alpha 1, skeleta...   230   2e-60
BC009978-1|AAH09978.1|  377|Homo sapiens actin, alpha, cardiac m...   230   2e-60
BC008633-1|AAH08633.1|  368|Homo sapiens actin, beta protein.         230   2e-60
AY692464-1|AAW29811.1|  377|Homo sapiens growth-inhibiting gene ...   230   2e-60
AY280960-1|AAP37280.1|  254|Homo sapiens actin alpha 1 skeletal ...   230   2e-60
AL160004-6|CAI19050.1|  377|Homo sapiens actin, alpha 1, skeleta...   230   2e-60
AL160004-4|CAI19051.1|  287|Homo sapiens actin, alpha 1, skeleta...   230   2e-60
AL157394-7|CAI13865.1|  151|Homo sapiens actin, alpha 2, smooth ...   230   2e-60
AL157394-6|CAI13864.1|  377|Homo sapiens actin, alpha 2, smooth ...   230   2e-60
AF182035-1|AAF02694.1|  377|Homo sapiens skeletal muscle alpha-a...   230   2e-60
K01747-1|AAA51586.1|  330|Homo sapiens ACTA2 protein.                 227   2e-59
EF095209-1|ABL01513.1|  121|Homo sapiens beta-actin protein.          225   7e-59
EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin prot...   215   5e-56
BC012854-1|AAH12854.1|  360|Homo sapiens ACTB protein protein.        214   2e-55
BC017450-1|AAH17450.1|  363|Homo sapiens Unknown (protein for IM...   208   8e-54
AL160004-5|CAI19052.1|  342|Homo sapiens actin, alpha 1, skeleta...   150   3e-36
X82207-1|CAA57691.1|  376|Homo sapiens beta-centracetin protein.      135   9e-32
BC010090-1|AAH10090.1|  376|Homo sapiens ARP1 actin-related prot...   135   9e-32
BC006372-1|AAH06372.1|  376|Homo sapiens ARP1 actin-related prot...   135   9e-32
BC004374-1|AAH04374.1|  376|Homo sapiens ARP1 actin-related prot...   135   9e-32
AC017099-2|AAY24280.1|  376|Homo sapiens unknown protein.             135   9e-32
Z14978-1|CAA78701.1|  376|Homo sapiens actin-related protein pro...   134   1e-31
X82206-1|CAA57690.1|  376|Homo sapiens alpha-centractin protein.      134   1e-31
BC026016-1|AAH26016.1|  376|Homo sapiens ARP1 actin-related prot...   134   1e-31
BC000693-1|AAH00693.1|  376|Homo sapiens ARP1 actin-related prot...   134   1e-31
AL121928-12|CAC08404.1|  376|Homo sapiens ARP1 actin-related pro...   134   1e-31
Z74696-1|CAI42428.1|  376|Homo sapiens actin-related protein T1 ...   112   8e-25
BC014597-1|AAH14597.1|  376|Homo sapiens actin-related protein T...   112   8e-25
AF440739-1|AAM00432.1|  376|Homo sapiens actin-related protein T...   112   8e-25
X82208-1|CAA57692.1|  329|Homo sapiens beta-centractin protein.       106   5e-23
AL356984-1|CAH72587.1|  377|Homo sapiens actin-related protein M...   102   6e-22
AK058153-1|BAB71690.1|  328|Homo sapiens protein ( Homo sapiens ...   102   6e-22
AF440740-1|AAM00433.1|  377|Homo sapiens actin-related protein T...   102   6e-22
AB057364-1|BAB85862.1|  377|Homo sapiens actin-related protein h...   102   6e-22
AK055346-1|BAB70906.1|  372|Homo sapiens protein ( Homo sapiens ...   100   3e-21
AB049117-1|BAB39481.1|  372|Homo sapiens actin related protein p...   100   3e-21
BC029499-1|AAH29499.1|  376|Homo sapiens actin-related protein T...    99   1e-20
BC014610-1|AAH14610.1|  435|Homo sapiens actin-like 7A protein.        97   3e-20
AL359692-4|CAI40571.1|  435|Homo sapiens actin-like 7A protein.        97   3e-20
AF113526-1|AAD44109.1|  435|Homo sapiens actin-like-7-alpha prot...    97   3e-20
AB284520-1|BAF41971.1|  435|Homo sapiens human t-actin 2 protein.      97   3e-20
AF006082-1|AAB64187.1|  394|Homo sapiens Arp2 protein.                 96   5e-20
BC014546-1|AAH14546.1|  394|Homo sapiens ARP2 actin-related prot...    95   9e-20
BC007289-1|AAH07289.1|  372|Homo sapiens actin related protein M...    95   1e-19
BC033789-1|AAH33789.1|  415|Homo sapiens actin-like 7B protein.        85   2e-16
AL359692-3|CAI40570.1|  415|Homo sapiens actin-like 7B protein.        85   2e-16
AF113527-1|AAD44110.1|  415|Homo sapiens actin-like-7-beta protein.    85   2e-16
AB284521-1|BAF41972.1|  415|Homo sapiens t-actin 1 protein.            85   2e-16
BC045752-1|AAH45752.1|  416|Homo sapiens hypothetical protein MG...    82   1e-15
BC024028-1|AAH24028.1|  416|Homo sapiens hypothetical protein MG...    82   1e-15
BC044590-1|AAH44590.1|  418|Homo sapiens ARP3 actin-related prot...    81   3e-15
AF127773-1|AAD51904.1|  418|Homo sapiens unknown protein.              81   3e-15
AF006083-1|AAB64188.1|  418|Homo sapiens Arp3 protein.                 81   3e-15
AC110769-1|AAX93226.1|  418|Homo sapiens unknown protein.              81   3e-15
AY970501-1|AAX82307.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970500-1|AAX82306.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970499-1|AAX82305.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970498-1|AAX82304.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970497-1|AAX82303.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970495-1|AAX82301.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970494-1|AAX82300.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970493-1|AAX82299.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970491-1|AAX82297.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970489-1|AAX82295.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970488-1|AAX82294.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970487-1|AAX82293.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970486-1|AAX82292.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970485-1|AAX82291.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970481-1|AAX82287.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970479-1|AAX82285.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970478-1|AAX82284.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970477-1|AAX82283.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970476-1|AAX82282.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970474-1|AAX82280.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970473-1|AAX82279.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970472-1|AAX82278.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970471-1|AAX82277.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970470-1|AAX82276.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970469-1|AAX82275.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970468-1|AAX82274.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970465-1|AAX82272.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970443-1|AAX82252.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970442-1|AAX82251.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970441-1|AAX82250.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970420-1|AAX82229.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970419-1|AAX82228.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970418-1|AAX82227.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970417-1|AAX82226.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970416-1|AAX82225.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970415-1|AAX82224.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970414-1|AAX82223.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970413-1|AAX82222.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970412-1|AAX82221.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970411-1|AAX82220.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970410-1|AAX82219.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970409-1|AAX82218.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970408-1|AAX82217.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970406-1|AAX82215.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970405-1|AAX82214.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970404-1|AAX82213.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970403-1|AAX82212.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970402-1|AAX82211.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970383-1|AAX82192.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970382-1|AAX82191.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970381-1|AAX82190.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970380-1|AAX82189.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970377-1|AAX82186.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970376-1|AAX82185.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970375-1|AAX82184.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970372-1|AAX82182.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970371-1|AAX82181.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970370-1|AAX82180.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970369-1|AAX82179.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970368-1|AAX82178.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970366-1|AAX82176.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970364-1|AAX82174.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
AY970363-1|AAX82173.1|  103|Homo sapiens actin-like protein prot...    74   3e-13
BC015207-1|AAH15207.1|  348|Homo sapiens ARP3 actin-related prot...    73   4e-13
BC008682-1|AAH08682.1|  418|Homo sapiens ARP3 actin-related prot...    73   4e-13
AY970502-1|AAX82308.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AY970480-1|AAX82286.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AY970464-1|AAX82271.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AY970462-1|AAX82269.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AY970460-1|AAX82267.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AY970457-1|AAX82264.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AY970456-1|AAX82263.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AY970455-1|AAX82262.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AY970447-1|AAX82256.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AY970446-1|AAX82255.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AY970432-1|AAX82241.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AY970431-1|AAX82240.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AY970430-1|AAX82239.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AY970429-1|AAX82238.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AY970428-1|AAX82237.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AY970427-1|AAX82236.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AY970426-1|AAX82235.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AY970421-1|AAX82230.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AY970392-1|AAX82201.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AY970390-1|AAX82199.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AY970389-1|AAX82198.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AY970388-1|AAX82197.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AY970387-1|AAX82196.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AY970386-1|AAX82195.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AY970385-1|AAX82194.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AY970378-1|AAX82187.1|  103|Homo sapiens actin-like protein prot...    73   4e-13
AF023453-1|AAC98904.1|  418|Homo sapiens actin-related protein 3...    73   4e-13
AY970492-1|AAX82298.1|  103|Homo sapiens actin-like protein prot...    73   7e-13
AY970490-1|AAX82296.1|  103|Homo sapiens actin-like protein prot...    72   1e-12
AY970444-1|AAX82253.1|  103|Homo sapiens actin-like protein prot...    72   1e-12
AY970475-1|AAX82281.1|  103|Homo sapiens actin-like protein prot...    71   2e-12
AY970463-1|AAX82270.1|  103|Homo sapiens actin-like protein prot...    71   2e-12
AY970458-1|AAX82265.1|  103|Homo sapiens actin-like protein prot...    71   2e-12
AY970374-1|AAX82183.1|  103|Homo sapiens actin-like protein prot...    71   2e-12
AY970391-1|AAX82200.1|  103|Homo sapiens actin-like protein prot...    71   2e-12
AY970365-1|AAX82175.1|  103|Homo sapiens actin-like protein prot...    71   2e-12
AY970496-1|AAX82302.1|  103|Homo sapiens actin-like protein prot...    71   3e-12
AY970440-1|AAX82249.1|  103|Homo sapiens actin-like protein prot...    71   3e-12
AY970439-1|AAX82248.1|  103|Homo sapiens actin-like protein prot...    71   3e-12
AY970407-1|AAX82216.1|  103|Homo sapiens actin-like protein prot...    71   3e-12
AY970367-1|AAX82177.1|  103|Homo sapiens actin-like protein prot...    71   3e-12
AY970454-1|AAX82261.1|  103|Homo sapiens actin-like protein prot...    70   4e-12
AY970483-1|AAX82289.1|  103|Homo sapiens actin-like protein prot...    69   7e-12
AY970424-1|AAX82233.1|  103|Homo sapiens actin-like protein prot...    69   7e-12
AY970452-1|AAX82260.1|  103|Homo sapiens actin-like protein prot...    69   9e-12
AY970451-1|AAX82259.1|  103|Homo sapiens actin-like protein prot...    69   9e-12
AY970384-1|AAX82193.1|  103|Homo sapiens actin-like protein prot...    69   9e-12
BC020944-1|AAH20944.1|  426|Homo sapiens actin-like 6B protein.        68   2e-11
AY970461-1|AAX82268.1|  103|Homo sapiens actin-like protein prot...    68   2e-11
AY970433-1|AAX82242.1|  103|Homo sapiens actin-like protein prot...    68   2e-11
AF053356-5|AAC78795.1|  475|Homo sapiens actin like gene protein.      68   2e-11
AF041475-1|AAD54678.1|  426|Homo sapiens BAF53b protein.               68   2e-11
AC099394-1|AAP21874.1|  426|Homo sapiens unknown protein.              68   2e-11
AB015906-1|BAA74576.1|  426|Homo sapiens actin-related protein h...    68   2e-11
AY129015-1|AAM98758.1|  109|Homo sapiens unknown protein.              67   3e-11
AY970400-1|AAX82209.1|  103|Homo sapiens actin-like protein prot...    67   4e-11
BC036371-1|AAH36371.1|  429|Homo sapiens actin-like 6A protein.        66   9e-11
BC001391-1|AAH01391.1|  429|Homo sapiens actin-like 6A protein.        66   9e-11
AF041474-1|AAC94991.1|  429|Homo sapiens BAF53a protein.               66   9e-11
AB015907-1|BAA74577.1|  429|Homo sapiens actin-related protein h...    66   9e-11
AY970467-1|AAX82273.1|  103|Homo sapiens actin-like protein prot...    65   1e-10
AY970422-1|AAX82231.1|  103|Homo sapiens actin-like protein prot...    65   1e-10
AY970401-1|AAX82210.1|  103|Homo sapiens actin-like protein prot...    65   1e-10
CR533529-1|CAG38560.1|  429|Homo sapiens BAF53A protein.               65   1e-10
AY970398-1|AAX82207.1|  103|Homo sapiens actin-like protein prot...    65   1e-10
AY970425-1|AAX82234.1|  103|Homo sapiens actin-like protein prot...    64   2e-10
AY970448-1|AAX82257.1|  103|Homo sapiens actin-like protein prot...    64   3e-10
AY970379-1|AAX82188.1|  103|Homo sapiens actin-like protein prot...    64   3e-10
AY970445-1|AAX82254.1|  103|Homo sapiens actin-like protein prot...    64   3e-10
AY970423-1|AAX82232.1|  103|Homo sapiens actin-like protein prot...    64   3e-10
AY970393-1|AAX82202.1|  103|Homo sapiens actin-like protein prot...    64   3e-10
AY970450-1|AAX82258.1|  102|Homo sapiens actin-like protein prot...    62   8e-10
BC036253-1|AAH36253.1|  339|Homo sapiens ACTR2 protein protein.        62   1e-09
AK223212-1|BAD96932.1|  429|Homo sapiens actin-like 6A isoform 1...    62   1e-09
AB209353-1|BAD92590.1|  369|Homo sapiens ARP3 actin-related prot...    62   1e-09
AY970459-1|AAX82266.1|  103|Homo sapiens actin-like protein prot...    62   1e-09
AY970396-1|AAX82205.1|  103|Homo sapiens actin-like protein prot...    61   2e-09
AY970484-1|AAX82290.1|  103|Homo sapiens actin-like protein prot...    61   2e-09
AY970395-1|AAX82204.1|  103|Homo sapiens actin-like protein prot...    61   2e-09
AY970394-1|AAX82203.1|  103|Homo sapiens actin-like protein prot...    61   2e-09
AY970482-1|AAX82288.1|  103|Homo sapiens actin-like protein prot...    60   6e-09
BC028909-1|AAH28909.1|  366|Homo sapiens actin-like 8 protein.         59   7e-09
AY970503-1|AAX82309.1|  103|Homo sapiens actin-like protein prot...    59   7e-09
AL136529-1|CAC15940.1|  366|Homo sapiens actin-like 8 protein.         59   7e-09
AK057339-1|BAB71434.1|  366|Homo sapiens protein ( Homo sapiens ...    59   7e-09
AY970438-1|AAX82247.1|  103|Homo sapiens actin-like protein prot...    57   4e-08
AF086920-1|AAP97150.1|  402|Homo sapiens actin related protein A...    57   4e-08
AY970436-1|AAX82245.1|  103|Homo sapiens actin-like protein prot...    56   5e-08
AY970397-1|AAX82206.1|  103|Homo sapiens actin-like protein prot...    55   2e-07
AY970435-1|AAX82244.1|  103|Homo sapiens actin-like protein prot...    54   2e-07
AY970434-1|AAX82243.1|  103|Homo sapiens actin-like protein prot...    54   3e-07
AY970437-1|AAX82246.1|  103|Homo sapiens actin-like protein prot...    54   4e-07
U20582-1|AAA62476.1|  302|Homo sapiens protein ( Human actin-lik...    47   3e-05
AY970399-1|AAX82208.1|   97|Homo sapiens actin-like protein prot...    47   3e-05
BC000949-1|AAH00949.1|  387|Homo sapiens actin-like 6A protein.        45   2e-04
AB061315-1|BAB87848.1|  387|Homo sapiens hArpNbeta-s protein.          45   2e-04
AB060168-1|BAB87844.1|  387|Homo sapiens hArpNbeta-s protein.          45   2e-04
BC011997-1|AAH11997.1|  417|Homo sapiens actin-related protein 1...    39   0.011
BC005208-1|AAH05208.1|  339|Homo sapiens Unknown (protein for IM...    39   0.011
BC004223-1|AAH04223.2|   32|Homo sapiens ACTG1 protein protein.        39   0.011
AK222702-1|BAD96422.1|  417|Homo sapiens uncharacterized hypotha...    39   0.011
AK222624-1|BAD96344.1|  417|Homo sapiens uncharacterized hypotha...    39   0.011
AK022534-1|BAB14083.1|  417|Homo sapiens protein ( Homo sapiens ...    39   0.011
AK000544-1|BAA91243.1|  417|Homo sapiens protein ( Homo sapiens ...    39   0.011
AF220190-1|AAF67655.1|  417|Homo sapiens uncharacterized hypotha...    39   0.011
BC038402-1|AAH38402.1|  607|Homo sapiens ARP5 actin-related prot...    38   0.026
AL133519-2|CAD37358.1|  607|Homo sapiens ARP5 actin-related prot...    38   0.026
AK022847-1|BAB14270.1|  607|Homo sapiens protein ( Homo sapiens ...    38   0.026
K00790-1|AAA51578.1|   17|Homo sapiens ACTB protein.                   34   0.24 
BC015107-1|AAH15107.1|  396|Homo sapiens ARP6 actin-related prot...    34   0.24 
AK222959-1|BAD96679.1|  396|Homo sapiens ARP6 actin-related prot...    34   0.24 
AK023495-1|BAB14588.1|  396|Homo sapiens protein ( Homo sapiens ...    34   0.24 
AF212251-1|AAK14934.1|  396|Homo sapiens CDA12 protein.                34   0.24 
AB038229-1|BAB20762.1|  396|Homo sapiens hARPX protein.                34   0.24 
BC065199-1|AAH65199.1|  453|Homo sapiens family with sequence si...    32   0.98 
BC037572-1|AAH37572.1|  453|Homo sapiens family with sequence si...    32   0.98 
AF123073-1|AAK01477.1|  453|Homo sapiens C/EBP-induced protein p...    32   0.98 
BC022231-1|AAH22231.1|  548|Homo sapiens Ets2 repressor factor p...    30   3.9  
AC006486-2|AAD11987.1|  548|Homo sapiens ERF_HUMAN protein.            30   3.9  
AB209271-1|BAD92508.1|  561|Homo sapiens ETS domain transcriptio...    30   3.9  
U27831-1|AAA87555.1|  537|Homo sapiens striatum-enriched phospha...    30   5.2  
BC064807-1|AAH64807.1|  565|Homo sapiens protein tyrosine phosph...    30   5.2  
BC046435-1|AAH46435.1|  201|Homo sapiens PTPN5 protein protein.        30   5.2  
BC039897-1|AAH39897.1|  596|Homo sapiens PTPN5 protein protein.        30   5.2  
AK090923-1|BAC03548.1|  565|Homo sapiens protein ( Homo sapiens ...    30   5.2  
U15655-1|AAA86686.1|  548|Homo sapiens ERF protein.                    29   6.9  
BC146794-1|AAI46795.1| 1919|Homo sapiens discs, large homolog 5 ...    29   6.9  
BC073996-1|AAH73996.1|  845|Homo sapiens DLG5 protein protein.         29   6.9  
AL450306-3|CAI17324.2| 1919|Homo sapiens discs, large homolog 5 ...    29   6.9  
AL450306-2|CAI17323.1|  880|Homo sapiens discs, large homolog 5 ...    29   6.9  
AL391421-2|CAI12104.2| 1919|Homo sapiens discs, large homolog 5 ...    29   6.9  
AL391421-1|CAI12103.1|  880|Homo sapiens discs, large homolog 5 ...    29   6.9  
AK096229-1|BAC04732.1|  454|Homo sapiens protein ( Homo sapiens ...    29   6.9  
AF352034-1|AAL83938.1| 1809|Homo sapiens DLG5 protein.                 29   6.9  
AF352033-1|AAL83937.1| 1809|Homo sapiens DLG5 protein.                 29   6.9  
AB091676-1|BAC65420.1| 1764|Homo sapiens discs large protein lp-...    29   6.9  
AB011155-1|BAA25509.2| 1952|Homo sapiens KIAA0583 protein protein.     29   6.9  
D79986-1|BAA11481.2|  929|Homo sapiens KIAA0164 protein.               29   9.1  
BC132780-1|AAI32781.1|  920|Homo sapiens BCL2-associated transcr...    29   9.1  
AY358911-1|AAQ89270.1|  807|Homo sapiens Ksp-cadherin protein.         29   9.1  
AL121713-4|CAB96722.1|  920|Homo sapiens protein ( Human DNA seq...    29   9.1  

>X04098-1|CAA27723.1|  375|Homo sapiens gamma-actin protein.
          Length = 375

 Score =  239 bits (584), Expect = 5e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>M19283-1|AAA51579.1|  375|Homo sapiens ACTG1 protein.
          Length = 375

 Score =  239 bits (584), Expect = 5e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>BT019856-1|AAV38659.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  239 bits (584), Expect = 5e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>BC053572-1|AAH53572.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  239 bits (584), Expect = 5e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>BC018774-1|AAH18774.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  239 bits (584), Expect = 5e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>BC015779-1|AAH15779.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  239 bits (584), Expect = 5e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>BC015695-1|AAH15695.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  239 bits (584), Expect = 5e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>BC015005-1|AAH15005.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  239 bits (584), Expect = 5e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>BC012050-1|AAH12050.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  239 bits (584), Expect = 5e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>BC010999-1|AAH10999.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  239 bits (584), Expect = 5e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>BC009848-1|AAH09848.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  239 bits (584), Expect = 5e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>BC007442-1|AAH07442.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  239 bits (584), Expect = 5e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>BC001920-1|AAH01920.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  239 bits (584), Expect = 5e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>BC000292-1|AAH00292.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  239 bits (584), Expect = 5e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>X63432-1|CAA45026.1|  375|Homo sapiens mutant beta-actin
           (beta'-actin) protein.
          Length = 375

 Score =  238 bits (583), Expect = 7e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>X00351-1|CAA25099.1|  375|Homo sapiens protein ( Human mRNA for
           beta-actin. ).
          Length = 375

 Score =  238 bits (583), Expect = 7e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>M10277-1|AAA51567.1|  375|Homo sapiens protein ( Human cytoplasmic
           beta-actin gene, complete cds. ).
          Length = 375

 Score =  238 bits (583), Expect = 7e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>DQ471327-1|ABF01018.1|  375|Homo sapiens PS1TP5-binding protein 1
           protein.
          Length = 375

 Score =  238 bits (583), Expect = 7e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>BC014861-1|AAH14861.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  238 bits (583), Expect = 7e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>BC013380-1|AAH13380.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  238 bits (583), Expect = 7e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>BC004251-1|AAH04251.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  238 bits (583), Expect = 7e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>BC002409-1|AAH02409.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  238 bits (583), Expect = 7e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>BC001301-1|AAH01301.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  238 bits (583), Expect = 7e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>AY582799-1|AAS79319.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  238 bits (583), Expect = 7e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>AK223055-1|BAD96775.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  238 bits (583), Expect = 7e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>AK223032-1|BAD96752.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  238 bits (583), Expect = 7e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>AK222925-1|BAD96645.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  238 bits (583), Expect = 7e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>AC006483-1|AAP22343.1|  375|Homo sapiens unknown protein.
          Length = 375

 Score =  238 bits (583), Expect = 7e-63
 Identities = 107/113 (94%), Positives = 111/113 (98%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 114


>BC016045-1|AAH16045.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  236 bits (578), Expect = 3e-62
 Identities = 106/113 (93%), Positives = 110/113 (97%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRV PEEHPVLLTEAPLNPKA
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVPPEEHPVLLTEAPLNPKA 114


>X16940-1|CAA34814.1|  376|Homo sapiens protein ( Human mRNA for
           enteric smooth muscle gamma-actin. ).
          Length = 376

 Score =  235 bits (575), Expect = 6e-62
 Identities = 104/115 (90%), Positives = 109/115 (94%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKA 115


>D00654-1|BAA00546.1|  376|Homo sapiens enteric smooth muscle
           gamma-actin protein.
          Length = 376

 Score =  235 bits (575), Expect = 6e-62
 Identities = 104/115 (90%), Positives = 109/115 (94%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKA 115


>CR541794-1|CAG46593.1|  376|Homo sapiens ACTG2 protein.
          Length = 376

 Score =  235 bits (575), Expect = 6e-62
 Identities = 104/115 (90%), Positives = 109/115 (94%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKA 115


>CR536515-1|CAG38753.1|  376|Homo sapiens ACTG2 protein.
          Length = 376

 Score =  235 bits (575), Expect = 6e-62
 Identities = 104/115 (90%), Positives = 109/115 (94%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKA 115


>BC094877-1|AAH94877.1|  376|Homo sapiens ACTG2 protein protein.
          Length = 376

 Score =  235 bits (575), Expect = 6e-62
 Identities = 104/115 (90%), Positives = 109/115 (94%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKA 115


>BC012617-1|AAH12617.1|  376|Homo sapiens actin, gamma 2, smooth
           muscle, enteric protein.
          Length = 376

 Score =  235 bits (575), Expect = 6e-62
 Identities = 104/115 (90%), Positives = 109/115 (94%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKA 115


>AC073046-2|AAX88909.1|  376|Homo sapiens unknown protein.
          Length = 376

 Score =  235 bits (575), Expect = 6e-62
 Identities = 104/115 (90%), Positives = 109/115 (94%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKA 115


>X13839-1|CAA32064.1|  377|Homo sapiens protein ( Human mRNA for
           vascular smooth muscle alpha-actin. ).
          Length = 377

 Score =  230 bits (562), Expect = 2e-60
 Identities = 104/116 (89%), Positives = 110/116 (94%), Gaps = 1/116 (0%)
 Frame = +2

Query: 83  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +SKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKA 116


>M20543-1|AAA60296.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  230 bits (562), Expect = 2e-60
 Identities = 105/116 (90%), Positives = 108/116 (93%), Gaps = 1/116 (0%)
 Frame = +2

Query: 83  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKA 116


>J05192-1|AAA51577.1|  377|Homo sapiens ACTA3 protein.
          Length = 377

 Score =  230 bits (562), Expect = 2e-60
 Identities = 104/116 (89%), Positives = 110/116 (94%), Gaps = 1/116 (0%)
 Frame = +2

Query: 83  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +SKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKA 116


>J00073-1|AAB59619.1|  377|Homo sapiens alpha-cardiac actin protein.
          Length = 377

 Score =  230 bits (562), Expect = 2e-60
 Identities = 105/116 (90%), Positives = 108/116 (93%), Gaps = 1/116 (0%)
 Frame = +2

Query: 83  MCD-EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           MCD EE  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKA 116


>J00068-1|AAB59376.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  230 bits (562), Expect = 2e-60
 Identities = 105/116 (90%), Positives = 108/116 (93%), Gaps = 1/116 (0%)
 Frame = +2

Query: 83  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKA 116


>CR541796-1|CAG46595.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  230 bits (562), Expect = 2e-60
 Identities = 105/116 (90%), Positives = 108/116 (93%), Gaps = 1/116 (0%)
 Frame = +2

Query: 83  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKA 116


>CR541795-1|CAG46594.1|  377|Homo sapiens ACTC protein.
          Length = 377

 Score =  230 bits (562), Expect = 2e-60
 Identities = 105/116 (90%), Positives = 108/116 (93%), Gaps = 1/116 (0%)
 Frame = +2

Query: 83  MCD-EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           MCD EE  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKA 116


>CR536518-1|CAG38756.1|  377|Homo sapiens ACTA2 protein.
          Length = 377

 Score =  230 bits (562), Expect = 2e-60
 Identities = 104/116 (89%), Positives = 110/116 (94%), Gaps = 1/116 (0%)
 Frame = +2

Query: 83  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +SKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKA 116


>CR536516-1|CAG38754.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  230 bits (562), Expect = 2e-60
 Identities = 105/116 (90%), Positives = 108/116 (93%), Gaps = 1/116 (0%)
 Frame = +2

Query: 83  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKA 116


>BC093052-1|AAH93052.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  230 bits (562), Expect = 2e-60
 Identities = 104/116 (89%), Positives = 110/116 (94%), Gaps = 1/116 (0%)
 Frame = +2

Query: 83  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +SKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKA 116


>BC017554-1|AAH17554.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  230 bits (562), Expect = 2e-60
 Identities = 104/116 (89%), Positives = 110/116 (94%), Gaps = 1/116 (0%)
 Frame = +2

Query: 83  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +SKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKA 116


>BC012597-1|AAH12597.1|  377|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 377

 Score =  230 bits (562), Expect = 2e-60
 Identities = 105/116 (90%), Positives = 108/116 (93%), Gaps = 1/116 (0%)
 Frame = +2

Query: 83  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKA 116


>BC009978-1|AAH09978.1|  377|Homo sapiens actin, alpha, cardiac
           muscle 1 protein.
          Length = 377

 Score =  230 bits (562), Expect = 2e-60
 Identities = 105/116 (90%), Positives = 108/116 (93%), Gaps = 1/116 (0%)
 Frame = +2

Query: 83  MCD-EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           MCD EE  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKA 116


>BC008633-1|AAH08633.1|  368|Homo sapiens actin, beta protein.
          Length = 368

 Score =  230 bits (562), Expect = 2e-60
 Identities = 104/107 (97%), Positives = 105/107 (98%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SKRGILTL
Sbjct: 1   LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 60

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 107


>AY692464-1|AAW29811.1|  377|Homo sapiens growth-inhibiting gene 46
           protein.
          Length = 377

 Score =  230 bits (562), Expect = 2e-60
 Identities = 104/116 (89%), Positives = 110/116 (94%), Gaps = 1/116 (0%)
 Frame = +2

Query: 83  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +SKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKA 116


>AY280960-1|AAP37280.1|  254|Homo sapiens actin alpha 1 skeletal
           muscle protein protein.
          Length = 254

 Score =  230 bits (562), Expect = 2e-60
 Identities = 105/116 (90%), Positives = 108/116 (93%), Gaps = 1/116 (0%)
 Frame = +2

Query: 83  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKA 116


>AL160004-6|CAI19050.1|  377|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 377

 Score =  230 bits (562), Expect = 2e-60
 Identities = 105/116 (90%), Positives = 108/116 (93%), Gaps = 1/116 (0%)
 Frame = +2

Query: 83  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKA 116


>AL160004-4|CAI19051.1|  287|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 287

 Score =  230 bits (562), Expect = 2e-60
 Identities = 105/116 (90%), Positives = 108/116 (93%), Gaps = 1/116 (0%)
 Frame = +2

Query: 83  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKA 116


>AL157394-7|CAI13865.1|  151|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 151

 Score =  230 bits (562), Expect = 2e-60
 Identities = 104/116 (89%), Positives = 110/116 (94%), Gaps = 1/116 (0%)
 Frame = +2

Query: 83  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +SKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKA 116


>AL157394-6|CAI13864.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  230 bits (562), Expect = 2e-60
 Identities = 104/116 (89%), Positives = 110/116 (94%), Gaps = 1/116 (0%)
 Frame = +2

Query: 83  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +SKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKA 116


>AF182035-1|AAF02694.1|  377|Homo sapiens skeletal muscle
           alpha-actin precursor protein.
          Length = 377

 Score =  230 bits (562), Expect = 2e-60
 Identities = 105/116 (90%), Positives = 108/116 (93%), Gaps = 1/116 (0%)
 Frame = +2

Query: 83  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKA 116


>K01747-1|AAA51586.1|  330|Homo sapiens ACTA2 protein.
          Length = 330

 Score =  227 bits (555), Expect = 2e-59
 Identities = 103/116 (88%), Positives = 109/116 (93%), Gaps = 1/116 (0%)
 Frame = +2

Query: 83  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGHEA 60

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +SKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 61  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKA 116


>EF095209-1|ABL01513.1|  121|Homo sapiens beta-actin protein.
          Length = 121

 Score =  225 bits (550), Expect = 7e-59
 Identities = 101/104 (97%), Positives = 102/104 (98%)
 Frame = +2

Query: 116 DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTLKYP 295
           DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SKRGILTLKYP
Sbjct: 1   DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYP 60

Query: 296 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 104


>EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin protein.
          Length = 1075

 Score =  215 bits (526), Expect = 5e-56
 Identities = 96/113 (84%), Positives = 104/113 (92%)
 Frame = +2

Query: 89   DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
            D++ A LV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPR QG+M GM QK+SYVG   +SK
Sbjct: 702  DDDTAVLVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRQQGMMGGMHQKESYVGKEAQSK 761

Query: 269  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
            RGILTLKYP+EHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPKA
Sbjct: 762  RGILTLKYPMEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEATLNPKA 814


>BC012854-1|AAH12854.1|  360|Homo sapiens ACTB protein protein.
          Length = 360

 Score =  214 bits (522), Expect = 2e-55
 Identities = 96/99 (96%), Positives = 97/99 (97%)
 Frame = +2

Query: 131 MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTLKYPIEHGI 310
           MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SKRGILTLKYPIEHGI
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI 60

Query: 311 VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 99


>BC017450-1|AAH17450.1|  363|Homo sapiens Unknown (protein for
           IMAGE:3538275) protein.
          Length = 363

 Score =  208 bits (508), Expect = 8e-54
 Identities = 94/97 (96%), Positives = 95/97 (97%)
 Frame = +2

Query: 137 KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTLKYPIEHGIVT 316
           KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +SKRGILTLKYPIEHGIVT
Sbjct: 6   KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVT 65

Query: 317 NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 66  NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 102


>AL160004-5|CAI19052.1|  342|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 342

 Score =  150 bits (363), Expect = 3e-36
 Identities = 74/94 (78%), Positives = 79/94 (84%), Gaps = 3/94 (3%)
 Frame = +2

Query: 83  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 260 KSKRGILTLKYPIEHGIVT--NWDDMEKIWHHTF 355
           +SKRGILTLKYPIEHGI+T  N + M +I   TF
Sbjct: 61  QSKRGILTLKYPIEHGIITKANREKMTQIMFETF 94


>X82207-1|CAA57691.1|  376|Homo sapiens beta-centracetin protein.
          Length = 376

 Score =  135 bits (326), Expect = 9e-32
 Identities = 57/106 (53%), Positives = 80/106 (75%), Gaps = 1/106 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G   +  RG+LT+
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTI 71

Query: 287 KYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNP 421
           +YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP
Sbjct: 72  RYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNP 117


>BC010090-1|AAH10090.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score =  135 bits (326), Expect = 9e-32
 Identities = 57/106 (53%), Positives = 80/106 (75%), Gaps = 1/106 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G   +  RG+LT+
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTI 71

Query: 287 KYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNP 421
           +YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP
Sbjct: 72  RYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNP 117


>BC006372-1|AAH06372.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score =  135 bits (326), Expect = 9e-32
 Identities = 57/106 (53%), Positives = 80/106 (75%), Gaps = 1/106 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G   +  RG+LT+
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTI 71

Query: 287 KYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNP 421
           +YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP
Sbjct: 72  RYPMEHGVVRDWNDMERIWQYAYSKDQLQTFSEEHPVLLTEAPLNP 117


>BC004374-1|AAH04374.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score =  135 bits (326), Expect = 9e-32
 Identities = 57/106 (53%), Positives = 80/106 (75%), Gaps = 1/106 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G   +  RG+LT+
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTI 71

Query: 287 KYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNP 421
           +YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP
Sbjct: 72  RYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNP 117


>AC017099-2|AAY24280.1|  376|Homo sapiens unknown protein.
          Length = 376

 Score =  135 bits (326), Expect = 9e-32
 Identities = 57/106 (53%), Positives = 80/106 (75%), Gaps = 1/106 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G   +  RG+LT+
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTI 71

Query: 287 KYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNP 421
           +YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP
Sbjct: 72  RYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNP 117


>Z14978-1|CAA78701.1|  376|Homo sapiens actin-related protein
           protein.
          Length = 376

 Score =  134 bits (325), Expect = 1e-31
 Identities = 58/112 (51%), Positives = 83/112 (74%), Gaps = 1/112 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G   +  RG+L++
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 287 KYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNPKALQRR 439
           +YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+  + R
Sbjct: 72  RYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRER 123


>X82206-1|CAA57690.1|  376|Homo sapiens alpha-centractin protein.
          Length = 376

 Score =  134 bits (325), Expect = 1e-31
 Identities = 58/112 (51%), Positives = 83/112 (74%), Gaps = 1/112 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G   +  RG+L++
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 287 KYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNPKALQRR 439
           +YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+  + R
Sbjct: 72  RYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRER 123


>BC026016-1|AAH26016.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score =  134 bits (325), Expect = 1e-31
 Identities = 58/112 (51%), Positives = 83/112 (74%), Gaps = 1/112 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G   +  RG+L++
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 287 KYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNPKALQRR 439
           +YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+  + R
Sbjct: 72  RYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRER 123


>BC000693-1|AAH00693.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score =  134 bits (325), Expect = 1e-31
 Identities = 58/112 (51%), Positives = 83/112 (74%), Gaps = 1/112 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G   +  RG+L++
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 287 KYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNPKALQRR 439
           +YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+  + R
Sbjct: 72  RYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRER 123


>AL121928-12|CAC08404.1|  376|Homo sapiens ARP1 actin-related
           protein 1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score =  134 bits (325), Expect = 1e-31
 Identities = 58/112 (51%), Positives = 83/112 (74%), Gaps = 1/112 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G   +  RG+L++
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 287 KYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNPKALQRR 439
           +YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+  + R
Sbjct: 72  RYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRER 123


>Z74696-1|CAI42428.1|  376|Homo sapiens actin-related protein T1
           (ACTRT1) protein.
          Length = 376

 Score =  112 bits (269), Expect = 8e-25
 Identities = 52/115 (45%), Positives = 72/115 (62%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRG 274
           +V A++ DNGSG+CKAG +G+  PR V  S++G  +    +  + QK  +VG     K  
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK-YFVGQEALYKYE 66

Query: 275 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRR 439
            L L YPIE G+VT WDDMEK+W H F  EL V P + PVL+TE  LNP+ ++ +
Sbjct: 67  ALHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREK 121


>BC014597-1|AAH14597.1|  376|Homo sapiens actin-related protein T1
           protein.
          Length = 376

 Score =  112 bits (269), Expect = 8e-25
 Identities = 52/115 (45%), Positives = 72/115 (62%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRG 274
           +V A++ DNGSG+CKAG +G+  PR V  S++G  +    +  + QK  +VG     K  
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK-YFVGQEALYKYE 66

Query: 275 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRR 439
            L L YPIE G+VT WDDMEK+W H F  EL V P + PVL+TE  LNP+ ++ +
Sbjct: 67  ALHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREK 121


>AF440739-1|AAM00432.1|  376|Homo sapiens actin-related protein T1
           protein.
          Length = 376

 Score =  112 bits (269), Expect = 8e-25
 Identities = 52/115 (45%), Positives = 72/115 (62%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRG 274
           +V A++ DNGSG+CKAG +G+  PR V  S++G  +    +  + QK  +VG     K  
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK-YFVGQEALYKYE 66

Query: 275 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRR 439
            L L YPIE G+VT WDDMEK+W H F  EL V P + PVL+TE  LNP+ ++ +
Sbjct: 67  ALHLHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREK 121


>X82208-1|CAA57692.1|  329|Homo sapiens beta-centractin protein.
          Length = 329

 Score =  106 bits (254), Expect = 5e-23
 Identities = 44/87 (50%), Positives = 64/87 (73%), Gaps = 1/87 (1%)
 Frame = +2

Query: 164 PRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTLKYPIEHGIVTNWDDMEKIW 343
           P+  FP+ VGRP+H  VM G  + D ++G   +  RG+LT++YP+EHG+V +W+DME+IW
Sbjct: 1   PKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTIRYPMEHGVVRDWNDMERIW 60

Query: 344 HHTF-YNELRVAPEEHPVLLTEAPLNP 421
            + +  ++L+   EEHPVLLTEAPLNP
Sbjct: 61  QYVYSKDQLQTFSEEHPVLLTEAPLNP 87


>AL356984-1|CAH72587.1|  377|Homo sapiens actin-related protein M2
           (ARPM2) protein.
          Length = 377

 Score =  102 bits (245), Expect = 6e-22
 Identities = 47/107 (43%), Positives = 64/107 (59%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILT 283
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+    K+  L 
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYKQEALQ 70

Query: 284 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
           L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+
Sbjct: 71  LHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPR 117


>AK058153-1|BAB71690.1|  328|Homo sapiens protein ( Homo sapiens
           cDNA FLJ25424 fis, clone TST04169. ).
          Length = 328

 Score =  102 bits (245), Expect = 6e-22
 Identities = 47/107 (43%), Positives = 64/107 (59%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILT 283
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+    K+  L 
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYKQEALQ 70

Query: 284 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
           L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+
Sbjct: 71  LHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPR 117


>AF440740-1|AAM00433.1|  377|Homo sapiens actin-related protein T2
           protein.
          Length = 377

 Score =  102 bits (245), Expect = 6e-22
 Identities = 47/107 (43%), Positives = 64/107 (59%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILT 283
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+    K+  L 
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYKQEALQ 70

Query: 284 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
           L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+
Sbjct: 71  LHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPR 117


>AB057364-1|BAB85862.1|  377|Homo sapiens actin-related protein
           hArpM2 protein.
          Length = 377

 Score =  102 bits (245), Expect = 6e-22
 Identities = 47/107 (43%), Positives = 64/107 (59%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILT 283
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+    K+  L 
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYKQEALQ 70

Query: 284 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
           L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+
Sbjct: 71  LHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPR 117


>AK055346-1|BAB70906.1|  372|Homo sapiens protein ( Homo sapiens
           cDNA FLJ30784 fis, clone FEBRA2000881, moderately
           similar to ACTIN 6. ).
          Length = 372

 Score =  100 bits (239), Expect = 3e-21
 Identities = 46/107 (42%), Positives = 68/107 (63%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VGD  +  R  L +
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVGDQAQDWRSSLFI 66

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
            YP+E G++T+W+DME +W H +   L++ P + PVL+TE  LNP A
Sbjct: 67  SYPVERGLITSWEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLA 113


>AB049117-1|BAB39481.1|  372|Homo sapiens actin related protein
           protein.
          Length = 372

 Score =  100 bits (239), Expect = 3e-21
 Identities = 46/107 (42%), Positives = 68/107 (63%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VGD  +  R  L +
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVGDQAQDWRSSLFI 66

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
            YP+E G++T+W+DME +W H +   L++ P + PVL+TE  LNP A
Sbjct: 67  SYPVERGLITSWEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLA 113


>BC029499-1|AAH29499.1|  376|Homo sapiens actin-related protein T2
           protein.
          Length = 376

 Score = 98.7 bits (235), Expect = 1e-20
 Identities = 47/107 (43%), Positives = 64/107 (59%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILT 283
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+    K+  L 
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQK-YFVGEEALYKQEALQ 69

Query: 284 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
           L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+
Sbjct: 70  LHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPR 116


>BC014610-1|AAH14610.1|  435|Homo sapiens actin-like 7A protein.
          Length = 435

 Score = 97.1 bits (231), Expect = 3e-20
 Identities = 43/110 (39%), Positives = 66/110 (60%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG    +  
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTN 126

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
             L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P
Sbjct: 127 VHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSP 176


>AL359692-4|CAI40571.1|  435|Homo sapiens actin-like 7A protein.
          Length = 435

 Score = 97.1 bits (231), Expect = 3e-20
 Identities = 43/110 (39%), Positives = 66/110 (60%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG    +  
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTN 126

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
             L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P
Sbjct: 127 VHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSP 176


>AF113526-1|AAD44109.1|  435|Homo sapiens actin-like-7-alpha
           protein.
          Length = 435

 Score = 97.1 bits (231), Expect = 3e-20
 Identities = 43/110 (39%), Positives = 66/110 (60%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG    +  
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTN 126

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
             L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P
Sbjct: 127 VHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSP 176


>AB284520-1|BAF41971.1|  435|Homo sapiens human t-actin 2 protein.
          Length = 435

 Score = 97.1 bits (231), Expect = 3e-20
 Identities = 43/110 (39%), Positives = 66/110 (60%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG    +  
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTN 126

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
             L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P
Sbjct: 127 VHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSP 176


>AF006082-1|AAB64187.1|  394|Homo sapiens Arp2 protein.
          Length = 394

 Score = 96.3 bits (229), Expect = 5e-20
 Identities = 47/108 (43%), Positives = 66/108 (61%), Gaps = 3/108 (2%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDGHKSKRGIL 280
           +V DNG+G  K G+AG + P  +FP++VGRP  R    +  +  KD  VGD     R +L
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASELRSML 68

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNP 421
            + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP
Sbjct: 69  EVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNP 116


>BC014546-1|AAH14546.1|  394|Homo sapiens ARP2 actin-related protein
           2 homolog (yeast) protein.
          Length = 394

 Score = 95.5 bits (227), Expect = 9e-20
 Identities = 47/108 (43%), Positives = 65/108 (60%), Gaps = 3/108 (2%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDGHKSKRGIL 280
           +V DNG+G  K G+AG + P  +FP++VGRP  R    +  +  KD  VGD     R  L
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASELRSTL 68

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNP 421
            + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP
Sbjct: 69  EVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNP 116


>BC007289-1|AAH07289.1|  372|Homo sapiens actin related protein M1
           protein.
          Length = 372

 Score = 95.1 bits (226), Expect = 1e-19
 Identities = 45/107 (42%), Positives = 67/107 (62%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VGD  +  R  L +
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVGDQAQDWRSSLFI 66

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
            YP+E G++T+ +DME +W H +   L++ P + PVL+TE  LNP A
Sbjct: 67  SYPVERGLITSCEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLA 113


>BC033789-1|AAH33789.1|  415|Homo sapiens actin-like 7B protein.
          Length = 415

 Score = 84.6 bits (200), Expect = 2e-16
 Identities = 38/111 (34%), Positives = 64/111 (57%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRG 274
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG    +   
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHELLNTEA 107

Query: 275 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
            L L  P++HGIV +WD ++ IW + F   +++ PEEH VL+++ PL+P +
Sbjct: 108 PLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSS 158


>AL359692-3|CAI40570.1|  415|Homo sapiens actin-like 7B protein.
          Length = 415

 Score = 84.6 bits (200), Expect = 2e-16
 Identities = 38/111 (34%), Positives = 64/111 (57%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRG 274
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG    +   
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHELLNTEA 107

Query: 275 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
            L L  P++HGIV +WD ++ IW + F   +++ PEEH VL+++ PL+P +
Sbjct: 108 PLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSS 158


>AF113527-1|AAD44110.1|  415|Homo sapiens actin-like-7-beta protein.
          Length = 415

 Score = 84.6 bits (200), Expect = 2e-16
 Identities = 38/111 (34%), Positives = 64/111 (57%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRG 274
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG    +   
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHELLNTEA 107

Query: 275 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
            L L  P++HGIV +WD ++ IW + F   +++ PEEH VL+++ PL+P +
Sbjct: 108 PLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSS 158


>AB284521-1|BAF41972.1|  415|Homo sapiens t-actin 1 protein.
          Length = 415

 Score = 84.6 bits (200), Expect = 2e-16
 Identities = 38/111 (34%), Positives = 64/111 (57%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRG 274
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG    +   
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHELLNTEA 107

Query: 275 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
            L L  P++HGIV +WD ++ IW + F   +++ PEEH VL+++ PL+P +
Sbjct: 108 PLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSS 158


>BC045752-1|AAH45752.1|  416|Homo sapiens hypothetical protein
           MGC33407 protein.
          Length = 416

 Score = 81.8 bits (193), Expect = 1e-15
 Identities = 38/109 (34%), Positives = 60/109 (55%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRG 274
           +  A+V+D G+G CK GFAG  +P     +I+G    +    G     +++G+  +    
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIGEAARVLPE 107

Query: 275 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
            LTL  P+  GIV +WD  E IW H   ++LRVA  +HP+L ++ P +P
Sbjct: 108 -LTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLFSDPPFSP 155


>BC024028-1|AAH24028.1|  416|Homo sapiens hypothetical protein
           MGC33407 protein.
          Length = 416

 Score = 81.8 bits (193), Expect = 1e-15
 Identities = 38/109 (34%), Positives = 60/109 (55%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRG 274
           +  A+V+D G+G CK GFAG  +P     +I+G    +    G     +++G+  +    
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIGEAARVLPE 107

Query: 275 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
            LTL  P+  GIV +WD  E IW H   ++LRVA  +HP+L ++ P +P
Sbjct: 108 -LTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLFSDPPFSP 155


>BC044590-1|AAH44590.1|  418|Homo sapiens ARP3 actin-related protein
           3 homolog (yeast) protein.
          Length = 418

 Score = 80.6 bits (190), Expect = 3e-15
 Identities = 46/113 (40%), Positives = 60/113 (53%), Gaps = 8/113 (7%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDGH 259
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GD  
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
             K    T K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN
Sbjct: 67  IEKPTYAT-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLN 118


>AF127773-1|AAD51904.1|  418|Homo sapiens unknown protein.
          Length = 418

 Score = 80.6 bits (190), Expect = 3e-15
 Identities = 46/113 (40%), Positives = 60/113 (53%), Gaps = 8/113 (7%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDGH 259
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GD  
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
             K    T K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN
Sbjct: 67  IEKPTYAT-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLN 118


>AF006083-1|AAB64188.1|  418|Homo sapiens Arp3 protein.
          Length = 418

 Score = 80.6 bits (190), Expect = 3e-15
 Identities = 46/113 (40%), Positives = 60/113 (53%), Gaps = 8/113 (7%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDGH 259
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GD  
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
             K    T K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN
Sbjct: 67  IEKPTYAT-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLN 118


>AC110769-1|AAX93226.1|  418|Homo sapiens unknown protein.
          Length = 418

 Score = 80.6 bits (190), Expect = 3e-15
 Identities = 46/113 (40%), Positives = 60/113 (53%), Gaps = 8/113 (7%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDGH 259
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GD  
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
             K    T K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN
Sbjct: 67  IEKPTYAT-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLN 118


>AY970501-1|AAX82307.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970500-1|AAX82306.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970499-1|AAX82305.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970498-1|AAX82304.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970497-1|AAX82303.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970495-1|AAX82301.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970494-1|AAX82300.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970493-1|AAX82299.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970491-1|AAX82297.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970489-1|AAX82295.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970488-1|AAX82294.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970487-1|AAX82293.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970486-1|AAX82292.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970485-1|AAX82291.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970481-1|AAX82287.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970479-1|AAX82285.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970478-1|AAX82284.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970477-1|AAX82283.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970476-1|AAX82282.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970474-1|AAX82280.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970473-1|AAX82279.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970472-1|AAX82278.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970471-1|AAX82277.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970470-1|AAX82276.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970469-1|AAX82275.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970468-1|AAX82274.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970465-1|AAX82272.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970443-1|AAX82252.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970442-1|AAX82251.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970441-1|AAX82250.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970420-1|AAX82229.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970419-1|AAX82228.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970418-1|AAX82227.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970417-1|AAX82226.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970416-1|AAX82225.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970415-1|AAX82224.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970414-1|AAX82223.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970413-1|AAX82222.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970412-1|AAX82221.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970411-1|AAX82220.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970410-1|AAX82219.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970409-1|AAX82218.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970408-1|AAX82217.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970406-1|AAX82215.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970405-1|AAX82214.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970404-1|AAX82213.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970403-1|AAX82212.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970402-1|AAX82211.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970383-1|AAX82192.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970382-1|AAX82191.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970381-1|AAX82190.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970380-1|AAX82189.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970377-1|AAX82186.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970376-1|AAX82185.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970375-1|AAX82184.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970372-1|AAX82182.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970371-1|AAX82181.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970370-1|AAX82180.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970369-1|AAX82179.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970368-1|AAX82178.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970366-1|AAX82176.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970364-1|AAX82174.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970363-1|AAX82173.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 31/31 (100%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>BC015207-1|AAH15207.1|  348|Homo sapiens ARP3 actin-related protein
           3 homolog B (yeast) protein.
          Length = 348

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 40/111 (36%), Positives = 58/111 (52%), Gaps = 8/111 (7%)
 Frame = +2

Query: 110 VVDNGSGMCKAGFAGDDAPRAVFPSIVG--------RPRHQGVMVGMGQKDSYVGDGHKS 265
           VVD G+G  K G+AG+  P+ + PS +             + V+ G+   D ++GD    
Sbjct: 9   VVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAID 68

Query: 266 KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
           K    T K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE PLN
Sbjct: 69  KPTYAT-KWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLN 118


>BC008682-1|AAH08682.1|  418|Homo sapiens ARP3 actin-related protein
           3 homolog B (yeast) protein.
          Length = 418

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 40/111 (36%), Positives = 58/111 (52%), Gaps = 8/111 (7%)
 Frame = +2

Query: 110 VVDNGSGMCKAGFAGDDAPRAVFPSIVG--------RPRHQGVMVGMGQKDSYVGDGHKS 265
           VVD G+G  K G+AG+  P+ + PS +             + V+ G+   D ++GD    
Sbjct: 9   VVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAID 68

Query: 266 KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
           K    T K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE PLN
Sbjct: 69  KPTYAT-KWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLN 118


>AY970502-1|AAX82308.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AY970480-1|AAX82286.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AY970464-1|AAX82271.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AY970462-1|AAX82269.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AY970460-1|AAX82267.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AY970457-1|AAX82264.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AY970456-1|AAX82263.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AY970455-1|AAX82262.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AY970447-1|AAX82256.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AY970446-1|AAX82255.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AY970432-1|AAX82241.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AY970431-1|AAX82240.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AY970430-1|AAX82239.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AY970429-1|AAX82238.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AY970428-1|AAX82237.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AY970427-1|AAX82236.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AY970426-1|AAX82235.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AY970421-1|AAX82230.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AY970392-1|AAX82201.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AY970390-1|AAX82199.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AY970389-1|AAX82198.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AY970388-1|AAX82197.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AY970387-1|AAX82196.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AY970386-1|AAX82195.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AY970385-1|AAX82194.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AY970378-1|AAX82187.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKA 31


>AF023453-1|AAC98904.1|  418|Homo sapiens actin-related protein
           3-beta protein.
          Length = 418

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 40/111 (36%), Positives = 58/111 (52%), Gaps = 8/111 (7%)
 Frame = +2

Query: 110 VVDNGSGMCKAGFAGDDAPRAVFPSIVG--------RPRHQGVMVGMGQKDSYVGDGHKS 265
           VVD G+G  K G+AG+  P+ + PS +             + V+ G+   D ++GD    
Sbjct: 9   VVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAID 68

Query: 266 KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
           K    T K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE PLN
Sbjct: 69  KPTYAT-KWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLN 118


>AY970492-1|AAX82298.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 72.5 bits (170), Expect = 7e-13
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLT+APLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTQAPLNPKA 31


>AY970490-1|AAX82296.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 72.1 bits (169), Expect = 1e-12
 Identities = 30/31 (96%), Positives = 30/31 (96%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRV PEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVTPEEHPVLLTEAPLNPKA 31


>AY970444-1|AAX82253.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 72.1 bits (169), Expect = 1e-12
 Identities = 30/31 (96%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYN+LRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNKLRVAPEEHPVLLTEAPLNPKA 31


>AY970475-1|AAX82281.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 71.3 bits (167), Expect = 2e-12
 Identities = 30/31 (96%), Positives = 30/31 (96%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHT YNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTLYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970463-1|AAX82270.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 71.3 bits (167), Expect = 2e-12
 Identities = 29/31 (93%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFY+ELRVAPEEHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYSELRVAPEEHPILLTEAPLNPKA 31


>AY970458-1|AAX82265.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 71.3 bits (167), Expect = 2e-12
 Identities = 29/31 (93%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPL+PKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLSPKA 31


>AY970374-1|AAX82183.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 71.3 bits (167), Expect = 2e-12
 Identities = 30/31 (96%), Positives = 30/31 (96%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHPVLLTEAPL PKA
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLTPKA 31


>AY970391-1|AAX82200.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 70.9 bits (166), Expect = 2e-12
 Identities = 29/31 (93%), Positives = 30/31 (96%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEHP+LLTEAPLNP A
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPMA 31


>AY970365-1|AAX82175.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 70.9 bits (166), Expect = 2e-12
 Identities = 30/31 (96%), Positives = 30/31 (96%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNEL VAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELGVAPEEHPVLLTEAPLNPKA 31


>AY970496-1|AAX82302.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 70.5 bits (165), Expect = 3e-12
 Identities = 30/31 (96%), Positives = 30/31 (96%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWH TFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHRTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970440-1|AAX82249.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 70.5 bits (165), Expect = 3e-12
 Identities = 29/31 (93%), Positives = 30/31 (96%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHH+FYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 1   KIWHHSFYNELRVAPEEHPTLLTEAPLNPKA 31


>AY970439-1|AAX82248.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 70.5 bits (165), Expect = 3e-12
 Identities = 29/31 (93%), Positives = 30/31 (96%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHH+FYNELRVAPEEHP LLTEAPLNPKA
Sbjct: 1   KIWHHSFYNELRVAPEEHPTLLTEAPLNPKA 31


>AY970407-1|AAX82216.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 70.5 bits (165), Expect = 3e-12
 Identities = 30/31 (96%), Positives = 30/31 (96%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHT YNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWHHTSYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970367-1|AAX82177.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 70.5 bits (165), Expect = 3e-12
 Identities = 30/31 (96%), Positives = 30/31 (96%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIW HTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 1   KIWRHTFYNELRVAPEEHPVLLTEAPLNPKA 31


>AY970454-1|AAX82261.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 70.1 bits (164), Expect = 4e-12
 Identities = 29/31 (93%), Positives = 30/31 (96%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEEH +LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEHSILLTEAPLNPKA 31


>AY970483-1|AAX82289.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 69.3 bits (162), Expect = 7e-12
 Identities = 29/31 (93%), Positives = 30/31 (96%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +IWHHTFYNELRVAPEEHPVLLTEA LNPKA
Sbjct: 1   RIWHHTFYNELRVAPEEHPVLLTEATLNPKA 31


>AY970424-1|AAX82233.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 69.3 bits (162), Expect = 7e-12
 Identities = 28/31 (90%), Positives = 31/31 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAP++HPVLLT+APLNPKA
Sbjct: 1   KIWHHTFYNELRVAPKQHPVLLTKAPLNPKA 31


>AY970452-1|AAX82260.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 68.9 bits (161), Expect = 9e-12
 Identities = 30/40 (75%), Positives = 35/40 (87%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRRR*PQI 454
           KIW+HTFYNELRVAP+EHP+LLTEAPLNPK + R +  QI
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPK-INREKMTQI 39


>AY970451-1|AAX82259.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 68.9 bits (161), Expect = 9e-12
 Identities = 30/40 (75%), Positives = 35/40 (87%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRRR*PQI 454
           KIW+HTFYNELRVAP+EHP+LLTEAPLNPK + R +  QI
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPK-INREKMTQI 39


>AY970384-1|AAX82193.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 68.9 bits (161), Expect = 9e-12
 Identities = 30/40 (75%), Positives = 35/40 (87%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRRR*PQI 454
           KIW+HTFYNELRVAP+EHP+LLTEAPLNPK + R +  QI
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPK-INREKMTQI 39


>BC020944-1|AAH20944.1|  426|Homo sapiens actin-like 6B protein.
          Length = 426

 Score = 68.1 bits (159), Expect = 2e-11
 Identities = 40/125 (32%), Positives = 67/125 (53%), Gaps = 9/125 (7%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG--RPRHQGVMVGMGQKDS-----YVG 250
           +EV ALV D GS   +AG+AG+D P+A FP+ VG       G +   G K+      ++ 
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHID 68

Query: 251 DG--HKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
               H  + G   +  P+++G++ +W+    I  HT+   ++  P  HPVL++EAP N +
Sbjct: 69  TNALHVPRDGAEVMS-PLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTR 127

Query: 425 ALQRR 439
           A + +
Sbjct: 128 AKREK 132


>AY970461-1|AAX82268.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 68.1 bits (159), Expect = 2e-11
 Identities = 29/31 (93%), Positives = 29/31 (93%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHT YNELRVAPEEHPVLLTEA LNPKA
Sbjct: 1   KIWHHTLYNELRVAPEEHPVLLTEATLNPKA 31


>AY970433-1|AAX82242.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 68.1 bits (159), Expect = 2e-11
 Identities = 27/30 (90%), Positives = 30/30 (100%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
           KIW+HTFYNELRVAP+EHP+LLTEAPLNPK
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPK 30


>AF053356-5|AAC78795.1|  475|Homo sapiens actin like gene protein.
          Length = 475

 Score = 68.1 bits (159), Expect = 2e-11
 Identities = 40/125 (32%), Positives = 67/125 (53%), Gaps = 9/125 (7%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG--RPRHQGVMVGMGQKDS-----YVG 250
           +EV ALV D GS   +AG+AG+D P+A FP+ VG       G +   G K+      ++ 
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHID 68

Query: 251 DG--HKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
               H  + G   +  P+++G++ +W+    I  HT+   ++  P  HPVL++EAP N +
Sbjct: 69  TNALHVPRDGAEVMS-PLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTR 127

Query: 425 ALQRR 439
           A + +
Sbjct: 128 AKREK 132


>AF041475-1|AAD54678.1|  426|Homo sapiens BAF53b protein.
          Length = 426

 Score = 68.1 bits (159), Expect = 2e-11
 Identities = 40/125 (32%), Positives = 67/125 (53%), Gaps = 9/125 (7%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG--RPRHQGVMVGMGQKDS-----YVG 250
           +EV ALV D GS   +AG+AG+D P+A FP+ VG       G +   G K+      ++ 
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHID 68

Query: 251 DG--HKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
               H  + G   +  P+++G++ +W+    I  HT+   ++  P  HPVL++EAP N +
Sbjct: 69  TNALHVPRDGAEVMS-PLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTR 127

Query: 425 ALQRR 439
           A + +
Sbjct: 128 AKREK 132


>AC099394-1|AAP21874.1|  426|Homo sapiens unknown protein.
          Length = 426

 Score = 68.1 bits (159), Expect = 2e-11
 Identities = 40/125 (32%), Positives = 67/125 (53%), Gaps = 9/125 (7%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG--RPRHQGVMVGMGQKDS-----YVG 250
           +EV ALV D GS   +AG+AG+D P+A FP+ VG       G +   G K+      ++ 
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHID 68

Query: 251 DG--HKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
               H  + G   +  P+++G++ +W+    I  HT+   ++  P  HPVL++EAP N +
Sbjct: 69  TNALHVPRDGAEVMS-PLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTR 127

Query: 425 ALQRR 439
           A + +
Sbjct: 128 AKREK 132


>AB015906-1|BAA74576.1|  426|Homo sapiens actin-related protein
           hArpN alpha protein.
          Length = 426

 Score = 68.1 bits (159), Expect = 2e-11
 Identities = 40/125 (32%), Positives = 67/125 (53%), Gaps = 9/125 (7%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG--RPRHQGVMVGMGQKDS-----YVG 250
           +EV ALV D GS   +AG+AG+D P+A FP+ VG       G +   G K+      ++ 
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHID 68

Query: 251 DG--HKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
               H  + G   +  P+++G++ +W+    I  HT+   ++  P  HPVL++EAP N +
Sbjct: 69  TNALHVPRDGAEVMS-PLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTR 127

Query: 425 ALQRR 439
           A + +
Sbjct: 128 AKREK 132


>AY129015-1|AAM98758.1|  109|Homo sapiens unknown protein.
          Length = 109

 Score = 67.3 bits (157), Expect = 3e-11
 Identities = 29/39 (74%), Positives = 32/39 (82%)
 Frame = +2

Query: 311 VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +TNWDD+EKIWHHTFY  L +A EEH VLLTE PLN KA
Sbjct: 1   MTNWDDIEKIWHHTFYKGLHMALEEHLVLLTEDPLNLKA 39


>AY970400-1|AAX82209.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 66.9 bits (156), Expect = 4e-11
 Identities = 28/31 (90%), Positives = 29/31 (93%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEE P+LL EAPLNPKA
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLIEAPLNPKA 31


>BC036371-1|AAH36371.1|  429|Homo sapiens actin-like 6A protein.
          Length = 429

 Score = 65.7 bits (153), Expect = 9e-11
 Identities = 41/127 (32%), Positives = 65/127 (51%), Gaps = 11/127 (8%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR--PRHQG--VMVGMGQKDSYVGDGH 259
           +EV ALV D GS   +AG+AG+D P+  FP+ +G    R  G  +M   G K    G  +
Sbjct: 9   DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTY 68

Query: 260 KSKRGILTLKY-------PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
                 L +         P+++G+V +WD  + I  HT+   ++     HPVL++EAP N
Sbjct: 69  YIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWN 128

Query: 419 PKALQRR 439
            +A + +
Sbjct: 129 TRAKREK 135


>BC001391-1|AAH01391.1|  429|Homo sapiens actin-like 6A protein.
          Length = 429

 Score = 65.7 bits (153), Expect = 9e-11
 Identities = 41/127 (32%), Positives = 65/127 (51%), Gaps = 11/127 (8%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR--PRHQG--VMVGMGQKDSYVGDGH 259
           +EV ALV D GS   +AG+AG+D P+  FP+ +G    R  G  +M   G K    G  +
Sbjct: 9   DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTY 68

Query: 260 KSKRGILTLKY-------PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
                 L +         P+++G+V +WD  + I  HT+   ++     HPVL++EAP N
Sbjct: 69  YIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWN 128

Query: 419 PKALQRR 439
            +A + +
Sbjct: 129 TRAKREK 135


>AF041474-1|AAC94991.1|  429|Homo sapiens BAF53a protein.
          Length = 429

 Score = 65.7 bits (153), Expect = 9e-11
 Identities = 41/127 (32%), Positives = 65/127 (51%), Gaps = 11/127 (8%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR--PRHQG--VMVGMGQKDSYVGDGH 259
           +EV ALV D GS   +AG+AG+D P+  FP+ +G    R  G  +M   G K    G  +
Sbjct: 9   DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTY 68

Query: 260 KSKRGILTLKY-------PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
                 L +         P+++G+V +WD  + I  HT+   ++     HPVL++EAP N
Sbjct: 69  YIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWN 128

Query: 419 PKALQRR 439
            +A + +
Sbjct: 129 TRAKREK 135


>AB015907-1|BAA74577.1|  429|Homo sapiens actin-related protein
           hArpN beta protein.
          Length = 429

 Score = 65.7 bits (153), Expect = 9e-11
 Identities = 41/127 (32%), Positives = 65/127 (51%), Gaps = 11/127 (8%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR--PRHQG--VMVGMGQKDSYVGDGH 259
           +EV ALV D GS   +AG+AG+D P+  FP+ +G    R  G  +M   G K    G  +
Sbjct: 9   DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTY 68

Query: 260 KSKRGILTLKY-------PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
                 L +         P+++G+V +WD  + I  HT+   ++     HPVL++EAP N
Sbjct: 69  YIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWN 128

Query: 419 PKALQRR 439
            +A + +
Sbjct: 129 TRAKREK 135


>AY970467-1|AAX82273.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 65.3 bits (152), Expect = 1e-10
 Identities = 27/31 (87%), Positives = 29/31 (93%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEE P+LL EAPLNP+A
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLFEAPLNPRA 31


>AY970422-1|AAX82231.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 65.3 bits (152), Expect = 1e-10
 Identities = 27/31 (87%), Positives = 29/31 (93%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEE P+LL EAPLNP+A
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLFEAPLNPRA 31


>AY970401-1|AAX82210.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 65.3 bits (152), Expect = 1e-10
 Identities = 27/31 (87%), Positives = 29/31 (93%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNELRVAPEE P+LL EAPLNP+A
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLFEAPLNPRA 31


>CR533529-1|CAG38560.1|  429|Homo sapiens BAF53A protein.
          Length = 429

 Score = 64.9 bits (151), Expect = 1e-10
 Identities = 41/127 (32%), Positives = 64/127 (50%), Gaps = 11/127 (8%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR--PRHQG--VMVGMGQKDSYVGDGH 259
           +EV ALV D GS   +AG+AG+D P+  FP+ +G    R  G  +M   G K    G  +
Sbjct: 9   DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTY 68

Query: 260 KSKRGILTLKY-------PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
                 L +         P+++G V +WD  + I  HT+   ++     HPVL++EAP N
Sbjct: 69  YIDTNALRVPRENMEAISPLKNGTVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWN 128

Query: 419 PKALQRR 439
            +A + +
Sbjct: 129 TRAKREK 135


>AY970398-1|AAX82207.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 64.9 bits (151), Expect = 1e-10
 Identities = 26/31 (83%), Positives = 30/31 (96%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHH F+NELRVAP++HPVLLT+APLNPKA
Sbjct: 1   KIWHHIFHNELRVAPKQHPVLLTKAPLNPKA 31


>AY970425-1|AAX82234.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 64.5 bits (150), Expect = 2e-10
 Identities = 27/31 (87%), Positives = 29/31 (93%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNEL VA +EHP+LLTEAPLNPKA
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTEAPLNPKA 31


>AY970448-1|AAX82257.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 64.1 bits (149), Expect = 3e-10
 Identities = 26/31 (83%), Positives = 28/31 (90%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFY E+RV PEEHPVL+TEA LNPKA
Sbjct: 1   KIWHHTFYKEVRVVPEEHPVLVTEATLNPKA 31


>AY970379-1|AAX82188.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 64.1 bits (149), Expect = 3e-10
 Identities = 26/35 (74%), Positives = 30/35 (85%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRR 439
           KIWHHTFYNEL VAP+EH +LLTE PLNPKA  ++
Sbjct: 1   KIWHHTFYNELHVAPKEHRMLLTEVPLNPKANHKK 35


>AY970445-1|AAX82254.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 63.7 bits (148), Expect = 3e-10
 Identities = 25/31 (80%), Positives = 30/31 (96%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHH F+NELRVAP++HPVLLT+APLNP+A
Sbjct: 1   KIWHHIFHNELRVAPKQHPVLLTKAPLNPRA 31


>AY970423-1|AAX82232.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 63.7 bits (148), Expect = 3e-10
 Identities = 26/31 (83%), Positives = 29/31 (93%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           +IWHHTFYNELRVAPEE P+LL EAPLNP+A
Sbjct: 1   EIWHHTFYNELRVAPEEQPMLLFEAPLNPRA 31


>AY970393-1|AAX82202.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 63.7 bits (148), Expect = 3e-10
 Identities = 25/31 (80%), Positives = 29/31 (93%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYN+L + PEEHP+LLT+APLNPKA
Sbjct: 1   KIWHHTFYNKLCMTPEEHPMLLTQAPLNPKA 31


>AY970450-1|AAX82258.1|  102|Homo sapiens actin-like protein
           protein.
          Length = 102

 Score = 62.5 bits (145), Expect = 8e-10
 Identities = 27/31 (87%), Positives = 29/31 (93%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNEL VAP+EHPVLLT+ PLNPKA
Sbjct: 1   KIWHHTFYNEL-VAPKEHPVLLTKVPLNPKA 30


>BC036253-1|AAH36253.1|  339|Homo sapiens ACTR2 protein protein.
          Length = 339

 Score = 62.1 bits (144), Expect = 1e-09
 Identities = 28/60 (46%), Positives = 38/60 (63%), Gaps = 1/60 (1%)
 Frame = +2

Query: 245 VGDGHKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNP 421
           VGD     R +L + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP
Sbjct: 2   VGDEASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNP 61


>AK223212-1|BAD96932.1|  429|Homo sapiens actin-like 6A isoform 1
           variant protein.
          Length = 429

 Score = 62.1 bits (144), Expect = 1e-09
 Identities = 40/127 (31%), Positives = 64/127 (50%), Gaps = 11/127 (8%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR--PRHQG--VMVGMGQKDSYVGDGH 259
           +EV ALV   GS   +AG+AG+D P+  FP+ +G    R  G  +M   G K    G  +
Sbjct: 9   DEVGALVFYIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTY 68

Query: 260 KSKRGILTLKY-------PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
                 L +         P+++G+V +WD  + I  HT+   ++     HPVL++EAP N
Sbjct: 69  YIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWN 128

Query: 419 PKALQRR 439
            +A + +
Sbjct: 129 TRAKREK 135


>AB209353-1|BAD92590.1|  369|Homo sapiens ARP3 actin-related protein
           3 homolog variant protein.
          Length = 369

 Score = 62.1 bits (144), Expect = 1e-09
 Identities = 31/69 (44%), Positives = 39/69 (56%)
 Frame = +2

Query: 212 VMVGMGQKDSYVGDGHKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP 391
           VM G+   D ++GD    K    T K+PI HGIV +WD ME+      +  LR  PE+H 
Sbjct: 2   VMKGVDDLDFFIGDEAIEKPTYAT-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHY 60

Query: 392 VLLTEAPLN 418
            LLTE PLN
Sbjct: 61  FLLTEPPLN 69


>AY970459-1|AAX82266.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 61.7 bits (143), Expect = 1e-09
 Identities = 24/31 (77%), Positives = 30/31 (96%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHH F+NELRVAP++HP+LLT+APL+PKA
Sbjct: 1   KIWHHIFHNELRVAPKQHPMLLTKAPLDPKA 31


>AY970396-1|AAX82205.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 61.3 bits (142), Expect = 2e-09
 Identities = 25/31 (80%), Positives = 29/31 (93%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYN+L VAPEE+ VL+T+APLNPKA
Sbjct: 1   KIWHHTFYNKLHVAPEEYLVLMTKAPLNPKA 31


>AY970484-1|AAX82290.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 60.9 bits (141), Expect = 2e-09
 Identities = 25/35 (71%), Positives = 29/35 (82%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRR 439
           KIWHHTFYNEL VAP+EH +LLTE PLN KA  ++
Sbjct: 1   KIWHHTFYNELHVAPKEHRMLLTEVPLNSKANHKK 35


>AY970395-1|AAX82204.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 60.9 bits (141), Expect = 2e-09
 Identities = 26/31 (83%), Positives = 27/31 (87%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHH FYN LRVAPEE  VLLTEAPLNP+A
Sbjct: 1   KIWHHVFYNVLRVAPEEQVVLLTEAPLNPRA 31


>AY970394-1|AAX82203.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 60.9 bits (141), Expect = 2e-09
 Identities = 25/31 (80%), Positives = 29/31 (93%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNEL VA +EHP+LLT+APL+PKA
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTKAPLSPKA 31


>AY970482-1|AAX82288.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 59.7 bits (138), Expect = 6e-09
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRR 439
           KIWHHTFYNEL VA +EHP+LLT+ PL+PKA  ++
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTKVPLSPKANHKK 35


>BC028909-1|AAH28909.1|  366|Homo sapiens actin-like 8 protein.
          Length = 366

 Score = 59.3 bits (137), Expect = 7e-09
 Identities = 36/114 (31%), Positives = 56/114 (49%), Gaps = 3/114 (2%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGR---PRHQGVMVGMGQKDSYVGDGHKSKRGI 277
           +++D+GSG  KAG AG + P+ VFP+IV       + G      +    +   H      
Sbjct: 6   VIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPD---- 61

Query: 278 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRR 439
            T  YPIE G + NW+ ++ +W     N  R   E  PV++TE PL   A +++
Sbjct: 62  -TFSYPIERGRILNWEGVQYLWSFVLENHRR-EQEVPPVIITETPLREPADRKK 113


>AY970503-1|AAX82309.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score = 59.3 bits (137), Expect = 7e-09
 Identities = 24/31 (77%), Positives = 28/31 (90%)
 Frame = +2

Query: 335 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           KIWHHTFYNEL VA +EHP+LLT+ PL+PKA
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTKVPLSPKA 31


>AL136529-1|CAC15940.1|  366|Homo sapiens actin-like 8 protein.
          Length = 366

 Score = 59.3 bits (137), Expect = 7e-09
 Identities = 36/114 (31%), Positives = 56/114 (49%), Gaps = 3/114 (2%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGR---PRHQGVMVGMGQKDSYVGDGHKSKRGI 277
           +++D+GSG  KAG AG + P+ VFP+IV       + G      +    +   H      
Sbjct: 6   VIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPD---- 61

Query: 278 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRR 439
            T  YPIE G + NW+ ++ +W     N  R   E  PV++TE PL   A +++
Sbjct: 62  -TFSYPIERGRILNWEGVQYLWSFVLENHRR-EQEVPPVIITETPLREPADRKK 113


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 85,060,615
Number of Sequences: 237096
Number of extensions: 2188351
Number of successful extensions: 6694
Number of sequences better than 10.0: 307
Number of HSP's better than 10.0 without gapping: 6068
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6647
length of database: 76,859,062
effective HSP length: 85
effective length of database: 56,705,902
effective search space used: 4593178062
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).