SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0016
         (532 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ494789-1|ABF50942.1|  393|Homo sapiens RMND5B protein.               41   0.002
BC009911-1|AAH09911.1|  393|Homo sapiens required for meiotic nu...    41   0.002
AK094065-1|BAC04276.1|  217|Homo sapiens protein ( Homo sapiens ...    41   0.002
X85108-1|CAA59429.1| 1331|Homo sapiens alpha3b subunit of lamini...    33   0.83 
X85107-1|CAA59428.1| 1238|Homo sapiens alpha3a subunit of lamini...    33   0.83 
X84900-1|CAA59325.1| 1806|Homo sapiens alpha 3B chain of laminin...    33   0.83 
L34155-1|AAA59483.1| 1713|Homo sapiens epiligrin alpha 3 subunit...    33   0.83 
AY327116-1|AAQ72571.1| 3277|Homo sapiens laminin alpha 3 splice ...    33   0.83 
AY327115-1|AAQ72570.1| 3333|Homo sapiens laminin alpha 3 splice ...    33   0.83 
AY327114-1|AAQ72569.1| 1668|Homo sapiens laminin alpha 3 splice ...    33   0.83 
AB107369-1|BAD13428.1| 3333|Homo sapiens laminin alpha 3b chain ...    33   0.83 
BC132793-1|AAI32794.1|   98|Homo sapiens hypothetical protein LO...    31   1.9  
BC132791-1|AAI32792.1|   98|Homo sapiens hypothetical protein LO...    31   1.9  
BC069048-1|AAH69048.1|   98|Homo sapiens hypothetical protein LO...    31   1.9  
BC047668-1|AAH47668.1|  391|Homo sapiens RMND5A protein protein.       31   1.9  
BC012165-1|AAH12165.1|  391|Homo sapiens required for meiotic nu...    31   1.9  
AK023972-1|BAB14746.1|  391|Homo sapiens protein ( Homo sapiens ...    31   1.9  
AK022815-1|BAB14257.1|  391|Homo sapiens protein ( Homo sapiens ...    31   1.9  
AC064848-2|AAX88863.1|  391|Homo sapiens unknown protein.              31   1.9  
BC062584-1|AAH62584.1|  518|Homo sapiens receptor-interacting se...    30   4.4  
AY453693-1|AAS16359.1|  518|Homo sapiens receptor interacting pr...    30   4.4  
AL590005-3|CAI14988.1| 5457|Homo sapiens dystonin protein.             30   4.4  
AL590005-2|CAI14989.1| 7543|Homo sapiens dystonin protein.             30   4.4  
AL512448-3|CAI16610.1| 5144|Homo sapiens dystonin protein.             30   4.4  
AL512448-2|CAI16608.1| 5457|Homo sapiens dystonin protein.             30   4.4  
AL512448-1|CAI16609.1| 7543|Homo sapiens dystonin protein.             30   4.4  
AL512422-3|CAI14342.1| 5457|Homo sapiens dystonin protein.             30   4.4  
AL512422-2|CAI14341.1| 7543|Homo sapiens dystonin protein.             30   4.4  
AL137008-4|CAI20332.1| 5144|Homo sapiens dystonin protein.             30   4.4  
AL137008-3|CAI20331.1| 5457|Homo sapiens dystonin protein.             30   4.4  
AL137008-2|CAI20330.1| 7543|Homo sapiens dystonin protein.             30   4.4  
AL096710-4|CAI22045.1| 5144|Homo sapiens dystonin protein.             30   4.4  
AL096710-3|CAI22043.1| 5457|Homo sapiens dystonin protein.             30   4.4  
AL096710-2|CAI22044.1| 7543|Homo sapiens dystonin protein.             30   4.4  
AK094883-1|BAC04449.1|  775|Homo sapiens protein ( Homo sapiens ...    30   4.4  
AK075275-1|BAC11512.1|  427|Homo sapiens protein ( Homo sapiens ...    30   4.4  
AF400226-1|AAL62061.1| 5171|Homo sapiens bullous pemphigoid anti...    30   4.4  
AF156884-1|AAD39005.1|  518|Homo sapiens RIP-like kinase protein.      30   4.4  
BC132867-1|AAI32868.1|  511|Homo sapiens tripartite motif-contai...    30   5.8  
BC132863-1|AAI32864.1|  511|Homo sapiens tripartite motif-contai...    30   5.8  
AF396655-1|AAK85381.1|  329|Homo sapiens glycogenin-interacting ...    30   5.8  
AF396654-1|AAK85380.1|  303|Homo sapiens glycogenin-interacting ...    30   5.8  
AF396653-1|AAK85379.1|  303|Homo sapiens glycogenin-interacting ...    30   5.8  
AF396652-1|AAK85378.1|  303|Homo sapiens glycogenin-interacting ...    30   5.8  
AF396651-1|AAK85377.1|  511|Homo sapiens glycogenin-interacting ...    30   5.8  
BC001104-1|AAH01104.1|  599|Homo sapiens nucleoporin like 1 prot...    29   7.7  
AL646102-1|CAH72184.1|  599|Homo sapiens nucleoporin like 1 prot...    29   7.7  
AL590787-4|CAI39902.1|  463|Homo sapiens nucleoporin like 1 prot...    29   7.7  
AL590787-3|CAI39901.1|  485|Homo sapiens nucleoporin like 1 prot...    29   7.7  
AL590787-2|CAI39898.1|  599|Homo sapiens nucleoporin like 1 prot...    29   7.7  
AL138958-2|CAH71290.1|  599|Homo sapiens nucleoporin like 1 prot...    29   7.7  
AB007870-1|BAA23706.2|  505|Homo sapiens KIAA0410 protein.             29   7.7  

>DQ494789-1|ABF50942.1|  393|Homo sapiens RMND5B protein.
          Length = 393

 Score = 41.1 bits (92), Expect = 0.002
 Identities = 20/64 (31%), Positives = 39/64 (60%), Gaps = 1/64 (1%)
 Frame = +1

Query: 241 SIARYINKVEELRREIAQQP-PNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHATVS 417
           S+   ++ V +LR E+A      TPL+   + V+S+    IK    +L++DH+++H++VS
Sbjct: 28  SLEELLHYVGQLRAELASAALQGTPLSATLSLVMSQCCRKIKDTVQKLASDHKDIHSSVS 87

Query: 418 KSGQ 429
           + G+
Sbjct: 88  RVGK 91


>BC009911-1|AAH09911.1|  393|Homo sapiens required for meiotic
           nuclear division 5 homolog B (S. cerevisiae) protein.
          Length = 393

 Score = 41.1 bits (92), Expect = 0.002
 Identities = 20/64 (31%), Positives = 39/64 (60%), Gaps = 1/64 (1%)
 Frame = +1

Query: 241 SIARYINKVEELRREIAQQP-PNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHATVS 417
           S+   ++ V +LR E+A      TPL+   + V+S+    IK    +L++DH+++H++VS
Sbjct: 28  SLEELLHYVGQLRAELASAALQGTPLSATLSLVMSQCCRKIKDTVQKLASDHKDIHSSVS 87

Query: 418 KSGQ 429
           + G+
Sbjct: 88  RVGK 91


>AK094065-1|BAC04276.1|  217|Homo sapiens protein ( Homo sapiens
           cDNA FLJ36746 fis, clone UTERU2016757. ).
          Length = 217

 Score = 41.1 bits (92), Expect = 0.002
 Identities = 20/64 (31%), Positives = 39/64 (60%), Gaps = 1/64 (1%)
 Frame = +1

Query: 241 SIARYINKVEELRREIAQQP-PNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHATVS 417
           S+   ++ V +LR E+A      TPL+   + V+S+    IK    +L++DH+++H++VS
Sbjct: 28  SLEELLHYVGQLRAELASAALQGTPLSATLSLVMSQCCRKIKDTVQKLASDHKDIHSSVS 87

Query: 418 KSGQ 429
           + G+
Sbjct: 88  RVGK 91


>X85108-1|CAA59429.1| 1331|Homo sapiens alpha3b subunit of laminin 5
           protein.
          Length = 1331

 Score = 32.7 bits (71), Expect = 0.83
 Identities = 18/61 (29%), Positives = 30/61 (49%)
 Frame = +1

Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHAT 411
           YR +I+ + +K+E L RE+           E+AQV S  A T+  N  + +   +EL   
Sbjct: 350 YRSAISNHGSKIEGLERELTDLNQEFETLQEKAQVNSRKAQTLNNNVNRATQSAKELDVK 409

Query: 412 V 414
           +
Sbjct: 410 I 410


>X85107-1|CAA59428.1| 1238|Homo sapiens alpha3a subunit of laminin 5
           protein.
          Length = 1238

 Score = 32.7 bits (71), Expect = 0.83
 Identities = 18/61 (29%), Positives = 30/61 (49%)
 Frame = +1

Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHAT 411
           YR +I+ + +K+E L RE+           E+AQV S  A T+  N  + +   +EL   
Sbjct: 257 YRSAISNHGSKIEGLERELTDLNQEFETLQEKAQVNSRKAQTLNNNVNRATQSAKELDVK 316

Query: 412 V 414
           +
Sbjct: 317 I 317


>X84900-1|CAA59325.1| 1806|Homo sapiens alpha 3B chain of laminin-5
           protein.
          Length = 1806

 Score = 32.7 bits (71), Expect = 0.83
 Identities = 18/61 (29%), Positives = 30/61 (49%)
 Frame = +1

Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHAT 411
           YR +I+ + +K+E L RE+           E+AQV S  A T+  N  + +   +EL   
Sbjct: 350 YRSAISNHGSKIEGLERELTDLNQEFETLQEKAQVNSRKAQTLNNNVNRATQSAKELDVK 409

Query: 412 V 414
           +
Sbjct: 410 I 410


>L34155-1|AAA59483.1| 1713|Homo sapiens epiligrin alpha 3 subunit
           protein.
          Length = 1713

 Score = 32.7 bits (71), Expect = 0.83
 Identities = 18/61 (29%), Positives = 30/61 (49%)
 Frame = +1

Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHAT 411
           YR +I+ + +K+E L RE+           E+AQV S  A T+  N  + +   +EL   
Sbjct: 257 YRSAISNHGSKIEGLERELTDLNQEFETLQEKAQVNSRKAQTLNNNVNRATQSAKELDVK 316

Query: 412 V 414
           +
Sbjct: 317 I 317


>AY327116-1|AAQ72571.1| 3277|Homo sapiens laminin alpha 3 splice
            variant b2 protein.
          Length = 3277

 Score = 32.7 bits (71), Expect = 0.83
 Identities = 18/61 (29%), Positives = 30/61 (49%)
 Frame = +1

Query: 232  YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHAT 411
            YR +I+ + +K+E L RE+           E+AQV S  A T+  N  + +   +EL   
Sbjct: 1877 YRSAISNHGSKIEGLERELTDLNQEFETLQEKAQVNSRKAQTLNNNVNRATQSAKELDVK 1936

Query: 412  V 414
            +
Sbjct: 1937 I 1937


>AY327115-1|AAQ72570.1| 3333|Homo sapiens laminin alpha 3 splice
            variant b1 protein.
          Length = 3333

 Score = 32.7 bits (71), Expect = 0.83
 Identities = 18/61 (29%), Positives = 30/61 (49%)
 Frame = +1

Query: 232  YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHAT 411
            YR +I+ + +K+E L RE+           E+AQV S  A T+  N  + +   +EL   
Sbjct: 1877 YRSAISNHGSKIEGLERELTDLNQEFETLQEKAQVNSRKAQTLNNNVNRATQSAKELDVK 1936

Query: 412  V 414
            +
Sbjct: 1937 I 1937


>AY327114-1|AAQ72569.1| 1668|Homo sapiens laminin alpha 3 splice
           variant a protein.
          Length = 1668

 Score = 32.7 bits (71), Expect = 0.83
 Identities = 18/61 (29%), Positives = 30/61 (49%)
 Frame = +1

Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHAT 411
           YR +I+ + +K+E L RE+           E+AQV S  A T+  N  + +   +EL   
Sbjct: 268 YRSAISNHGSKIEGLERELTDLNQEFETLQEKAQVNSRKAQTLNNNVNRATQSAKELDVK 327

Query: 412 V 414
           +
Sbjct: 328 I 328


>AB107369-1|BAD13428.1| 3333|Homo sapiens laminin alpha 3b chain
            protein.
          Length = 3333

 Score = 32.7 bits (71), Expect = 0.83
 Identities = 18/61 (29%), Positives = 30/61 (49%)
 Frame = +1

Query: 232  YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHAT 411
            YR +I+ + +K+E L RE+           E+AQV S  A T+  N  + +   +EL   
Sbjct: 1877 YRSAISNHGSKIEGLERELTDLNQEFETLQEKAQVNSRKAQTLNNNVNRATQSAKELDVK 1936

Query: 412  V 414
            +
Sbjct: 1937 I 1937


>BC132793-1|AAI32794.1|   98|Homo sapiens hypothetical protein
           LOC285074 protein.
          Length = 98

 Score = 31.5 bits (68), Expect = 1.9
 Identities = 15/53 (28%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +1

Query: 274 LRREIAQQP-PNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHATVSKSGQ 429
           L+ EI Q    +  L+   + V+++    IK    +L++DH+++H++VS+ G+
Sbjct: 39  LKHEILQSHGQDAELSGTLSLVLTQCCKRIKDTVQKLASDHKDIHSSVSRVGK 91



 Score = 29.9 bits (64), Expect = 5.8
 Identities = 10/33 (30%), Positives = 22/33 (66%)
 Frame = +2

Query: 161 MDSCIGVEQDLDKAITKFTNLNEHTDEVLQDIL 259
           MD C+ VE++L+K + KF+   +  +  L++++
Sbjct: 1   MDQCVTVERELEKVLHKFSGYGQLCERGLEELI 33


>BC132791-1|AAI32792.1|   98|Homo sapiens hypothetical protein
           LOC285074 protein.
          Length = 98

 Score = 31.5 bits (68), Expect = 1.9
 Identities = 15/53 (28%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +1

Query: 274 LRREIAQQP-PNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHATVSKSGQ 429
           L+ EI Q    +  L+   + V+++    IK    +L++DH+++H++VS+ G+
Sbjct: 39  LKHEILQSHGQDAELSGTLSLVLTQCCKRIKDTVQKLASDHKDIHSSVSRVGK 91



 Score = 29.9 bits (64), Expect = 5.8
 Identities = 10/33 (30%), Positives = 22/33 (66%)
 Frame = +2

Query: 161 MDSCIGVEQDLDKAITKFTNLNEHTDEVLQDIL 259
           MD C+ VE++L+K + KF+   +  +  L++++
Sbjct: 1   MDQCVTVERELEKVLHKFSGYGQLCERGLEELI 33


>BC069048-1|AAH69048.1|   98|Homo sapiens hypothetical protein
           LOC285074 protein.
          Length = 98

 Score = 31.5 bits (68), Expect = 1.9
 Identities = 15/53 (28%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +1

Query: 274 LRREIAQQP-PNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHATVSKSGQ 429
           L+ EI Q    +  L+   + V+++    IK    +L++DH+++H++VS+ G+
Sbjct: 39  LKHEILQSHGQDAELSGTLSLVLTQCCKRIKDTVQKLASDHKDIHSSVSRVGK 91



 Score = 29.9 bits (64), Expect = 5.8
 Identities = 10/33 (30%), Positives = 22/33 (66%)
 Frame = +2

Query: 161 MDSCIGVEQDLDKAITKFTNLNEHTDEVLQDIL 259
           MD C+ VE++L+K + KF+   +  +  L++++
Sbjct: 1   MDQCVTVERELEKVLHKFSGYGQLCERGLEELI 33


>BC047668-1|AAH47668.1|  391|Homo sapiens RMND5A protein protein.
          Length = 391

 Score = 31.5 bits (68), Expect = 1.9
 Identities = 15/53 (28%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +1

Query: 274 LRREIAQQP-PNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHATVSKSGQ 429
           L+ EI Q    +  L+   + V+++    IK    +L++DH+++H++VS+ G+
Sbjct: 39  LKHEILQSHGQDAELSGTLSLVLTQCCKRIKDTVQKLASDHKDIHSSVSRVGK 91



 Score = 29.9 bits (64), Expect = 5.8
 Identities = 10/33 (30%), Positives = 22/33 (66%)
 Frame = +2

Query: 161 MDSCIGVEQDLDKAITKFTNLNEHTDEVLQDIL 259
           MD C+ VE++L+K + KF+   +  +  L++++
Sbjct: 1   MDQCVTVERELEKVLHKFSGYGQLCERGLEELI 33


>BC012165-1|AAH12165.1|  391|Homo sapiens required for meiotic
           nuclear division 5 homolog A (S. cerevisiae) protein.
          Length = 391

 Score = 31.5 bits (68), Expect = 1.9
 Identities = 15/53 (28%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +1

Query: 274 LRREIAQQP-PNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHATVSKSGQ 429
           L+ EI Q    +  L+   + V+++    IK    +L++DH+++H++VS+ G+
Sbjct: 39  LKHEILQSHGQDAELSGTLSLVLTQCCKRIKDTVQKLASDHKDIHSSVSRVGK 91



 Score = 29.9 bits (64), Expect = 5.8
 Identities = 10/33 (30%), Positives = 22/33 (66%)
 Frame = +2

Query: 161 MDSCIGVEQDLDKAITKFTNLNEHTDEVLQDIL 259
           MD C+ VE++L+K + KF+   +  +  L++++
Sbjct: 1   MDQCVTVERELEKVLHKFSGYGQLCERGLEELI 33


>AK023972-1|BAB14746.1|  391|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13910 fis, clone Y79AA1000131. ).
          Length = 391

 Score = 31.5 bits (68), Expect = 1.9
 Identities = 15/53 (28%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +1

Query: 274 LRREIAQQP-PNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHATVSKSGQ 429
           L+ EI Q    +  L+   + V+++    IK    +L++DH+++H++VS+ G+
Sbjct: 39  LKHEILQSHGQDAELSGTLSLVLTQCCKRIKDTVQKLASDHKDIHSSVSRVGK 91



 Score = 29.9 bits (64), Expect = 5.8
 Identities = 10/33 (30%), Positives = 22/33 (66%)
 Frame = +2

Query: 161 MDSCIGVEQDLDKAITKFTNLNEHTDEVLQDIL 259
           MD C+ VE++L+K + KF+   +  +  L++++
Sbjct: 1   MDQCVTVERELEKVLHKFSGYGQLCERGLEELI 33


>AK022815-1|BAB14257.1|  391|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12753 fis, clone NT2RP2001226. ).
          Length = 391

 Score = 31.5 bits (68), Expect = 1.9
 Identities = 15/53 (28%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +1

Query: 274 LRREIAQQP-PNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHATVSKSGQ 429
           L+ EI Q    +  L+   + V+++    IK    +L++DH+++H++VS+ G+
Sbjct: 39  LKHEILQSHGQDAELSGTLSLVLTQCCKRIKDTVQKLASDHKDIHSSVSRVGK 91



 Score = 29.9 bits (64), Expect = 5.8
 Identities = 10/33 (30%), Positives = 22/33 (66%)
 Frame = +2

Query: 161 MDSCIGVEQDLDKAITKFTNLNEHTDEVLQDIL 259
           MD C+ VE++L+K + KF+   +  +  L++++
Sbjct: 1   MDQCVTVERELEKVLHKFSGYGQLCERGLEELI 33


>AC064848-2|AAX88863.1|  391|Homo sapiens unknown protein.
          Length = 391

 Score = 31.5 bits (68), Expect = 1.9
 Identities = 15/53 (28%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +1

Query: 274 LRREIAQQP-PNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHATVSKSGQ 429
           L+ EI Q    +  L+   + V+++    IK    +L++DH+++H++VS+ G+
Sbjct: 39  LKHEILQSHGQDAELSGTLSLVLTQCCKRIKDTVQKLASDHKDIHSSVSRVGK 91



 Score = 29.9 bits (64), Expect = 5.8
 Identities = 10/33 (30%), Positives = 22/33 (66%)
 Frame = +2

Query: 161 MDSCIGVEQDLDKAITKFTNLNEHTDEVLQDIL 259
           MD C+ VE++L+K + KF+   +  +  L++++
Sbjct: 1   MDQCVTVERELEKVLHKFSGYGQLCERGLEELI 33


>BC062584-1|AAH62584.1|  518|Homo sapiens receptor-interacting
           serine-threonine kinase 3 protein.
          Length = 518

 Score = 30.3 bits (65), Expect = 4.4
 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = -2

Query: 294 LGYFPPQLLYFVNISCNTSS-VCSFKFVNFVIALSKSCSTPIQESIVFQ 151
           LGY  P+L   VN   +T+S V SF  + + +   +    P + S+V++
Sbjct: 183 LGYLAPELFVNVNRKASTASDVYSFGILMWAVLAGREVELPTEPSLVYE 231


>AY453693-1|AAS16359.1|  518|Homo sapiens receptor interacting
           protein 3 protein.
          Length = 518

 Score = 30.3 bits (65), Expect = 4.4
 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = -2

Query: 294 LGYFPPQLLYFVNISCNTSS-VCSFKFVNFVIALSKSCSTPIQESIVFQ 151
           LGY  P+L   VN   +T+S V SF  + + +   +    P + S+V++
Sbjct: 183 LGYLAPELFVNVNRKASTASDVYSFGILMWAVLAGREVELPTEPSLVYE 231


>AL590005-3|CAI14988.1| 5457|Homo sapiens dystonin protein.
          Length = 5457

 Score = 30.3 bits (65), Expect = 4.4
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 3/51 (5%)
 Frame = +1

Query: 256  INKVEELR---REIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRE 399
            +NKV+EL+    E+ ++ P+TP  P   Q+++E+ S   Q   QL+ D ++
Sbjct: 2483 VNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSK-WQELNQLTIDRQQ 2532


>AL590005-2|CAI14989.1| 7543|Homo sapiens dystonin protein.
          Length = 7543

 Score = 30.3 bits (65), Expect = 4.4
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 3/51 (5%)
 Frame = +1

Query: 256  INKVEELR---REIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRE 399
            +NKV+EL+    E+ ++ P+TP  P   Q+++E+ S   Q   QL+ D ++
Sbjct: 4569 VNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSK-WQELNQLTIDRQQ 4618


>AL512448-3|CAI16610.1| 5144|Homo sapiens dystonin protein.
          Length = 5144

 Score = 30.3 bits (65), Expect = 4.4
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 3/51 (5%)
 Frame = +1

Query: 256  INKVEELR---REIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRE 399
            +NKV+EL+    E+ ++ P+TP  P   Q+++E+ S   Q   QL+ D ++
Sbjct: 2157 VNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSK-WQELNQLTIDRQQ 2206


>AL512448-2|CAI16608.1| 5457|Homo sapiens dystonin protein.
          Length = 5457

 Score = 30.3 bits (65), Expect = 4.4
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 3/51 (5%)
 Frame = +1

Query: 256  INKVEELR---REIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRE 399
            +NKV+EL+    E+ ++ P+TP  P   Q+++E+ S   Q   QL+ D ++
Sbjct: 2483 VNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSK-WQELNQLTIDRQQ 2532


>AL512448-1|CAI16609.1| 7543|Homo sapiens dystonin protein.
          Length = 7543

 Score = 30.3 bits (65), Expect = 4.4
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 3/51 (5%)
 Frame = +1

Query: 256  INKVEELR---REIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRE 399
            +NKV+EL+    E+ ++ P+TP  P   Q+++E+ S   Q   QL+ D ++
Sbjct: 4569 VNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSK-WQELNQLTIDRQQ 4618


>AL512422-3|CAI14342.1| 5457|Homo sapiens dystonin protein.
          Length = 5457

 Score = 30.3 bits (65), Expect = 4.4
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 3/51 (5%)
 Frame = +1

Query: 256  INKVEELR---REIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRE 399
            +NKV+EL+    E+ ++ P+TP  P   Q+++E+ S   Q   QL+ D ++
Sbjct: 2483 VNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSK-WQELNQLTIDRQQ 2532


>AL512422-2|CAI14341.1| 7543|Homo sapiens dystonin protein.
          Length = 7543

 Score = 30.3 bits (65), Expect = 4.4
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 3/51 (5%)
 Frame = +1

Query: 256  INKVEELR---REIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRE 399
            +NKV+EL+    E+ ++ P+TP  P   Q+++E+ S   Q   QL+ D ++
Sbjct: 4569 VNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSK-WQELNQLTIDRQQ 4618


>AL137008-4|CAI20332.1| 5144|Homo sapiens dystonin protein.
          Length = 5144

 Score = 30.3 bits (65), Expect = 4.4
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 3/51 (5%)
 Frame = +1

Query: 256  INKVEELR---REIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRE 399
            +NKV+EL+    E+ ++ P+TP  P   Q+++E+ S   Q   QL+ D ++
Sbjct: 2157 VNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSK-WQELNQLTIDRQQ 2206


>AL137008-3|CAI20331.1| 5457|Homo sapiens dystonin protein.
          Length = 5457

 Score = 30.3 bits (65), Expect = 4.4
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 3/51 (5%)
 Frame = +1

Query: 256  INKVEELR---REIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRE 399
            +NKV+EL+    E+ ++ P+TP  P   Q+++E+ S   Q   QL+ D ++
Sbjct: 2483 VNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSK-WQELNQLTIDRQQ 2532


>AL137008-2|CAI20330.1| 7543|Homo sapiens dystonin protein.
          Length = 7543

 Score = 30.3 bits (65), Expect = 4.4
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 3/51 (5%)
 Frame = +1

Query: 256  INKVEELR---REIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRE 399
            +NKV+EL+    E+ ++ P+TP  P   Q+++E+ S   Q   QL+ D ++
Sbjct: 4569 VNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSK-WQELNQLTIDRQQ 4618


>AL096710-4|CAI22045.1| 5144|Homo sapiens dystonin protein.
          Length = 5144

 Score = 30.3 bits (65), Expect = 4.4
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 3/51 (5%)
 Frame = +1

Query: 256  INKVEELR---REIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRE 399
            +NKV+EL+    E+ ++ P+TP  P   Q+++E+ S   Q   QL+ D ++
Sbjct: 2157 VNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSK-WQELNQLTIDRQQ 2206


>AL096710-3|CAI22043.1| 5457|Homo sapiens dystonin protein.
          Length = 5457

 Score = 30.3 bits (65), Expect = 4.4
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 3/51 (5%)
 Frame = +1

Query: 256  INKVEELR---REIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRE 399
            +NKV+EL+    E+ ++ P+TP  P   Q+++E+ S   Q   QL+ D ++
Sbjct: 2483 VNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSK-WQELNQLTIDRQQ 2532


>AL096710-2|CAI22044.1| 7543|Homo sapiens dystonin protein.
          Length = 7543

 Score = 30.3 bits (65), Expect = 4.4
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 3/51 (5%)
 Frame = +1

Query: 256  INKVEELR---REIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRE 399
            +NKV+EL+    E+ ++ P+TP  P   Q+++E+ S   Q   QL+ D ++
Sbjct: 4569 VNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSK-WQELNQLTIDRQQ 4618


>AK094883-1|BAC04449.1|  775|Homo sapiens protein ( Homo sapiens
           cDNA FLJ37564 fis, clone BRCOC2000816, weakly similar to
           Homo sapiens mRNA for actin binding protein ABP620. ).
          Length = 775

 Score = 30.3 bits (65), Expect = 4.4
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 3/51 (5%)
 Frame = +1

Query: 256 INKVEELR---REIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRE 399
           +NKV+EL+    E+ ++ P+TP  P   Q+++E+ S   Q   QL+ D ++
Sbjct: 401 VNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSK-WQELNQLTIDRQQ 450


>AK075275-1|BAC11512.1|  427|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90794 fis, clone THYRO1001700, weakly similar to
           SERINE/THREONINE PROTEIN KINASE RIP (EC 2.7.1.-). ).
          Length = 427

 Score = 30.3 bits (65), Expect = 4.4
 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = -2

Query: 294 LGYFPPQLLYFVNISCNTSS-VCSFKFVNFVIALSKSCSTPIQESIVFQ 151
           LGY  P+L   VN   +T+S V SF  + + +   +    P + S+V++
Sbjct: 183 LGYLAPELFVNVNRKASTASDVYSFGILMWAVLAGREVELPTEPSLVYE 231


>AF400226-1|AAL62061.1| 5171|Homo sapiens bullous pemphigoid antigen 1
            eA protein.
          Length = 5171

 Score = 30.3 bits (65), Expect = 4.4
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 3/51 (5%)
 Frame = +1

Query: 256  INKVEELR---REIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRE 399
            +NKV+EL+    E+ ++ P+TP  P   Q+++E+ S   Q   QL+ D ++
Sbjct: 2157 VNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSK-WQELNQLTIDRQQ 2206


>AF156884-1|AAD39005.1|  518|Homo sapiens RIP-like kinase protein.
          Length = 518

 Score = 30.3 bits (65), Expect = 4.4
 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = -2

Query: 294 LGYFPPQLLYFVNISCNTSS-VCSFKFVNFVIALSKSCSTPIQESIVFQ 151
           LGY  P+L   VN   +T+S V SF  + + +   +    P + S+V++
Sbjct: 183 LGYLAPELFVNVNRKASTASDVYSFGILMWAVLAGREVELPTEPSLVYE 231


>BC132867-1|AAI32868.1|  511|Homo sapiens tripartite
           motif-containing 7 protein.
          Length = 511

 Score = 29.9 bits (64), Expect = 5.8
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 2/63 (3%)
 Frame = +1

Query: 250 RYINKVEELRREIAQ-QPPNTPLTPEQAQVVSELASTIKQNAFQLSTDH-RELHATVSKS 423
           R + ++EEL RE+AQ Q  N      +   +S+L+S I++ A +   D  +E  +T+S+ 
Sbjct: 233 RLLGRLEELSREVAQKQNENLAQLGVEITQLSKLSSQIQETAQKPDLDFLQEFKSTLSRC 292

Query: 424 GQV 432
             V
Sbjct: 293 SNV 295


>BC132863-1|AAI32864.1|  511|Homo sapiens tripartite
           motif-containing 7 protein.
          Length = 511

 Score = 29.9 bits (64), Expect = 5.8
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 2/63 (3%)
 Frame = +1

Query: 250 RYINKVEELRREIAQ-QPPNTPLTPEQAQVVSELASTIKQNAFQLSTDH-RELHATVSKS 423
           R + ++EEL RE+AQ Q  N      +   +S+L+S I++ A +   D  +E  +T+S+ 
Sbjct: 233 RLLGRLEELSREVAQKQNENLAQLGVEITQLSKLSSQIQETAQKPDLDFLQEFKSTLSRC 292

Query: 424 GQV 432
             V
Sbjct: 293 SNV 295


>AF396655-1|AAK85381.1|  329|Homo sapiens glycogenin-interacting
           protein 3 protein.
          Length = 329

 Score = 29.9 bits (64), Expect = 5.8
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 2/63 (3%)
 Frame = +1

Query: 250 RYINKVEELRREIAQ-QPPNTPLTPEQAQVVSELASTIKQNAFQLSTDH-RELHATVSKS 423
           R + ++EEL RE+AQ Q  N      +   +S+L+S I++ A +   D  +E  +T+S+ 
Sbjct: 51  RLLGRLEELSREVAQKQNENLAQLGVEITQLSKLSSQIQETAQKPDLDFLQEFKSTLSRC 110

Query: 424 GQV 432
             V
Sbjct: 111 SNV 113


>AF396654-1|AAK85380.1|  303|Homo sapiens glycogenin-interacting
           protein 2 protein.
          Length = 303

 Score = 29.9 bits (64), Expect = 5.8
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 2/63 (3%)
 Frame = +1

Query: 250 RYINKVEELRREIAQ-QPPNTPLTPEQAQVVSELASTIKQNAFQLSTDH-RELHATVSKS 423
           R + ++EEL RE+AQ Q  N      +   +S+L+S I++ A +   D  +E  +T+S+ 
Sbjct: 25  RLLGRLEELSREVAQKQNENLAQLGVEITQLSKLSSQIQETAQKPDLDFLQEFKSTLSRC 84

Query: 424 GQV 432
             V
Sbjct: 85  SNV 87


>AF396653-1|AAK85379.1|  303|Homo sapiens glycogenin-interacting
           protein 2 protein.
          Length = 303

 Score = 29.9 bits (64), Expect = 5.8
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 2/63 (3%)
 Frame = +1

Query: 250 RYINKVEELRREIAQ-QPPNTPLTPEQAQVVSELASTIKQNAFQLSTDH-RELHATVSKS 423
           R + ++EEL RE+AQ Q  N      +   +S+L+S I++ A +   D  +E  +T+S+ 
Sbjct: 25  RLLGRLEELSREVAQKQNENLAQLGVEITQLSKLSSQIQETAQKPDLDFLQEFKSTLSRC 84

Query: 424 GQV 432
             V
Sbjct: 85  SNV 87


>AF396652-1|AAK85378.1|  303|Homo sapiens glycogenin-interacting
           protein 2 protein.
          Length = 303

 Score = 29.9 bits (64), Expect = 5.8
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 2/63 (3%)
 Frame = +1

Query: 250 RYINKVEELRREIAQ-QPPNTPLTPEQAQVVSELASTIKQNAFQLSTDH-RELHATVSKS 423
           R + ++EEL RE+AQ Q  N      +   +S+L+S I++ A +   D  +E  +T+S+ 
Sbjct: 25  RLLGRLEELSREVAQKQNENLAQLGVEITQLSKLSSQIQETAQKPDLDFLQEFKSTLSRC 84

Query: 424 GQV 432
             V
Sbjct: 85  SNV 87


>AF396651-1|AAK85377.1|  511|Homo sapiens glycogenin-interacting
           protein 1 protein.
          Length = 511

 Score = 29.9 bits (64), Expect = 5.8
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 2/63 (3%)
 Frame = +1

Query: 250 RYINKVEELRREIAQ-QPPNTPLTPEQAQVVSELASTIKQNAFQLSTDH-RELHATVSKS 423
           R + ++EEL RE+AQ Q  N      +   +S+L+S I++ A +   D  +E  +T+S+ 
Sbjct: 233 RLLGRLEELSREVAQKQNENLAQLGVEITQLSKLSSQIQETAQKPDLDFLQEFKSTLSRC 292

Query: 424 GQV 432
             V
Sbjct: 293 SNV 295


>BC001104-1|AAH01104.1|  599|Homo sapiens nucleoporin like 1
           protein.
          Length = 599

 Score = 29.5 bits (63), Expect = 7.7
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 1/81 (1%)
 Frame = +1

Query: 244 IARYINKVEELRREIAQQPPNTPLTPEQ-AQVVSELASTIKQNAFQLSTDHRELHATVSK 420
           + +Y  ++EEL   +A Q  N+ +TP+  +  + ++  T    A QL + H  +   + +
Sbjct: 357 LQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENV-KVLKE 415

Query: 421 SGQVYR*AFRGPIMQQLLQRR 483
               YR  F G  +     RR
Sbjct: 416 QYLGYRKMFLGDAVDVFETRR 436


>AL646102-1|CAH72184.1|  599|Homo sapiens nucleoporin like 1
           protein.
          Length = 599

 Score = 29.5 bits (63), Expect = 7.7
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 1/81 (1%)
 Frame = +1

Query: 244 IARYINKVEELRREIAQQPPNTPLTPEQ-AQVVSELASTIKQNAFQLSTDHRELHATVSK 420
           + +Y  ++EEL   +A Q  N+ +TP+  +  + ++  T    A QL + H  +   + +
Sbjct: 357 LQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENV-KVLKE 415

Query: 421 SGQVYR*AFRGPIMQQLLQRR 483
               YR  F G  +     RR
Sbjct: 416 QYLGYRKMFLGDAVDVFETRR 436


>AL590787-4|CAI39902.1|  463|Homo sapiens nucleoporin like 1
           protein.
          Length = 463

 Score = 29.5 bits (63), Expect = 7.7
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 1/81 (1%)
 Frame = +1

Query: 244 IARYINKVEELRREIAQQPPNTPLTPEQ-AQVVSELASTIKQNAFQLSTDHRELHATVSK 420
           + +Y  ++EEL   +A Q  N+ +TP+  +  + ++  T    A QL + H  +   + +
Sbjct: 304 LQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENV-KVLKE 362

Query: 421 SGQVYR*AFRGPIMQQLLQRR 483
               YR  F G  +     RR
Sbjct: 363 QYLGYRKMFLGDAVDVFETRR 383


>AL590787-3|CAI39901.1|  485|Homo sapiens nucleoporin like 1
           protein.
          Length = 485

 Score = 29.5 bits (63), Expect = 7.7
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 1/81 (1%)
 Frame = +1

Query: 244 IARYINKVEELRREIAQQPPNTPLTPEQ-AQVVSELASTIKQNAFQLSTDHRELHATVSK 420
           + +Y  ++EEL   +A Q  N+ +TP+  +  + ++  T    A QL + H  +   + +
Sbjct: 357 LQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENV-KVLKE 415

Query: 421 SGQVYR*AFRGPIMQQLLQRR 483
               YR  F G  +     RR
Sbjct: 416 QYLGYRKMFLGDAVDVFETRR 436


>AL590787-2|CAI39898.1|  599|Homo sapiens nucleoporin like 1
           protein.
          Length = 599

 Score = 29.5 bits (63), Expect = 7.7
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 1/81 (1%)
 Frame = +1

Query: 244 IARYINKVEELRREIAQQPPNTPLTPEQ-AQVVSELASTIKQNAFQLSTDHRELHATVSK 420
           + +Y  ++EEL   +A Q  N+ +TP+  +  + ++  T    A QL + H  +   + +
Sbjct: 357 LQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENV-KVLKE 415

Query: 421 SGQVYR*AFRGPIMQQLLQRR 483
               YR  F G  +     RR
Sbjct: 416 QYLGYRKMFLGDAVDVFETRR 436


>AL138958-2|CAH71290.1|  599|Homo sapiens nucleoporin like 1
           protein.
          Length = 599

 Score = 29.5 bits (63), Expect = 7.7
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 1/81 (1%)
 Frame = +1

Query: 244 IARYINKVEELRREIAQQPPNTPLTPEQ-AQVVSELASTIKQNAFQLSTDHRELHATVSK 420
           + +Y  ++EEL   +A Q  N+ +TP+  +  + ++  T    A QL + H  +   + +
Sbjct: 357 LQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENV-KVLKE 415

Query: 421 SGQVYR*AFRGPIMQQLLQRR 483
               YR  F G  +     RR
Sbjct: 416 QYLGYRKMFLGDAVDVFETRR 436


>AB007870-1|BAA23706.2|  505|Homo sapiens KIAA0410 protein.
          Length = 505

 Score = 29.5 bits (63), Expect = 7.7
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 1/81 (1%)
 Frame = +1

Query: 244 IARYINKVEELRREIAQQPPNTPLTPEQ-AQVVSELASTIKQNAFQLSTDHRELHATVSK 420
           + +Y  ++EEL   +A Q  N+ +TP+  +  + ++  T    A QL + H  +   + +
Sbjct: 377 LQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENV-KVLKE 435

Query: 421 SGQVYR*AFRGPIMQQLLQRR 483
               YR  F G  +     RR
Sbjct: 436 QYLGYRKMFLGDAVDVFETRR 456


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 78,414,138
Number of Sequences: 237096
Number of extensions: 1654996
Number of successful extensions: 3093
Number of sequences better than 10.0: 52
Number of HSP's better than 10.0 without gapping: 2936
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3093
length of database: 76,859,062
effective HSP length: 85
effective length of database: 56,705,902
effective search space used: 5160237082
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).